2YW5A

Solution structure of the bromodomain from human bromodomain containing protein 3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
138
structure length
138
Chain Sequence
GSSGSSGEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 3
publication title Solution structure of the bromodomain from human bromodomain containing protein 3
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 37
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2007-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2yw5A00
2WP1A 4PCEA 2DVQA 5EI4A 3SVFA 5IBNA 5EQ1A 3FKMX 3MB3A 5FE2A 4FLPA 4NYVA 5E73A 5L8UA 2RNYA 5F3AA 5A81A 4ZC9A 5DYUA 5F5ZA 5E9YA 5HENA 2E7NA 3ONIA 5E7DA 3D7CA 3IU5A 4UYDA 1WUMA 5F60A 4UYEA 5EWHA 5HM0A 5CQ7A 5DY7A 5A83A 4QR5A 5CPEA 4MR6A 5LJ2A 5IG6A 5DW2A 4XUAA 5EPSA 4QUTA 5C85A 5D3TA 4F3IA 5EWWA 3LJWA 5CUAA 5DFBA 5CUDA 3P1CA 5L96A 5FE5A 4NYWA 4CLBA 1JSPB 4YYDA 5J0DA 5HLSA 4Q0OA 4LRGA 5D0CA 3UVYA 2LSPB 4Y03A 4CUUA 3QZSA 5F1LA 5KTXA 4LDFA 5FE3A 4LR6A 3IU6A 5ENFA 4E96A 5A82A 2R0YA 4NR8A 5KO4A 5LUUA 2NXBA 5EM3A 4BW1A 3LXJA 5ENJA 5E3GA 4O7FA 5CY9A 4QSWA 3G0JA 4IOOA 5H1TA 5I7XA 4CFLA 5FE4A 3HMEA 5E9KA 4LYSA 4QEWA 5DBMA 5FH7A 4RVRA 5DLXA 3S92A 4NXJA 4QEVA 4YAXA 2L5EA 4CUSA 4NR6A 2YW5A 4YBTA 4IORA 2F6JA 3TLPA 4UIUA 5KTWA 4LYIA 4CUQA 2H60A 4ZQLA 2N9GA 5ENGA 5EU1A 2RNXA 5D24A 4NR4A 3SVGA 4PS5A 5F2PA 5FDZA 5FE7A 2YEKA 2YELA 5E0RA 5DYXA 5CUCA 5EWVA 4YK0A 4NR5A 5AD3A 5A5QA 4UYGA 3SVHA 5DYCA 4A9EA 4BW2A 4A9MA 3QZVA 4HXRA 5FE6A 5ETBA 2E3KA 4KV4A 5HEMA 5FE8A 4HXKA 5CQ4A 4QSPA 5EWCA 3P1DA 5CZGA 2GRCA 4YH3A 5FFYA 2E7OA 3MB4A 4N4IA 4TT4A 4NR7A 5CFWA 4QY4A 4QYDA 5C7NA 5D3NA 1EQFA 2DVVA 2KTBB 3UVWA 4NUCA 5G4RA 4TU6A 5CQ6A 3HMFA 4QBMA 5HFQA 4YY6A 4J0RA 4MR3A 4AKNA 3JVKA 5FE0A 4HXLA 4O7CA 5A5NA 4ALHA 4OGIA 4NUEA 4O75A 4HXPA 5HRXA 5DYAA 4LC2A 3O36A 4HXNA 4C66A 4CUTA 4HBWA 4PCIA 2YQDA 3U5MA 5L8TA 4YBMA 3HMHA 4KV1A 4QSQA 5DFCA 5CQTA 5D26A 4O72A 4A9IA 4O7BA 5DKDA 4LZSA 2FSAA 5AMFA 4QSUA 2L85A 4XY8A 4MR4A 4LYWA 5CRMA 5F36A 2DVSA 4HBXA 2OO1A 5EP7A 1ZS5A 3UV5A 4YYKA 5E9VA 3AQAA 5DKHA 5E9MA 5E9IA 4Z6IA 3U5KA 3AADA 5COIA 5TCMA 3G0LA 5ENIA 4WHUA 5L97A 2YYNA 4IR5A 4TU4A 4O77A 5G4SA 4X2IA 5D3JA 3DWYA 3LQHA 5CUGA 3U5LA 1F68A 5DW1A 4A9LA 4ZW1A 5II2A 5FH6A 2DVRA 4LZ2A 4Z93A 4MENA 3O34A 5LVRA 5EA1A 5H1UA 5I88A 5I1QA 5FE1A 5F62A 3Q2EA 5HJCA 1X0JA 4QR3A 4TTEA 3ZYUA 4BW3A 5D7XA 4YYNA 4KCXA 5EVAA 3MUKA 4YYJA 3DAIA 4YABA 5D3SA 4TT6A 3JVJA 2RO1A 5IGMA 5E3DA 2YDWA 4YYMA 4UITA 4A9NA 2DKWA 4UIVA 4UIZA 5D25A 3UV2A 4HXSA 2F6NA 5L99A 5FB1A 4A9HA 5I40A 3RCWA 5E74A 5D3PA 5F63A 3UW9A 4A9OA 4O7EA 4PTBA 4Q0NA 5CUBA 4QYLA 4YYGA 2YEMA 5D3RA 4QC3A 4HXOA 5I86A 5CTLA 3O35A 4NUDA 5C89A 5I29A 5I80A 2I8NA 4TZ2A 4CUPA 5ENBA 4A9KA 4QSXA 4MR5A 2RS9B 4O78A 5HFRA 5F1HA 4A9FA 3U5PA 5D3HA 5ENCA 5HELA 4QSVA 2DWWA 2DATA 4YH4A 1N72A 2R10A 5A5OA 3I3JA 4HXMA 5I83A 4O70A 5A5RA 5CQ8A 3GG3A 5AD2A 4IR6A 3LQIA 4N4FA 5BT4A 5LJ0A 5C8GA 5BT3A 4QZSA 3S91A 5LVQA 5EGUA 2R0VA 4OUFA 3MQMA 3JVLA 4NQMA 4QEUA 4TZ8A 5II1A 2WP2A 5CGPA 4PY6A 4PKLA 4NQNA 5EK9A 5CQ5A 5FBXA 4CURA 4NR9A 5LJ1A 2L84A 5A85A 4UYFB 5HQ7A 5KHMA 5A5SA 4J0SA 4IR4A 5IGLA 3MXFA 3UV4A 5EWDA 5H1VA 4LZRA 4CFKA 3P1FA 4TT2A 3JVMA 4N4HA 5DKCA 1JM4B 4NRCA 3Q2FA 4YYHA 5ACYA 5HCLA 4MEQA 5IGKA 4QUUA 4IR3A 4QSTA 5FB0A 5FG5A 4YBSA 4N3WA 5FFWA 4TQNA 5AMEA 4QR4A 4NYXA 5LKZA 5HRWA 5BT5A 4BW4A 2RFJA 5FFVA 5EISA 5CQAA 2RI7A 4O74A 5EICA 3P1EA 4MEOA 4QSRA 5EPBA 2OUOA 4IOQA 4UYHA 4XYAA 5KU3A 5DFDA 1WUGA 5KTUA 3MULA 4TS8A 3QZTA 5D3LA 5IIDA 3O37A 4UYFA 4O76A 5HQ5A 2D82A 5DLZA 5E9LA 2RNWA 4A9JA 4O71A 3UVDA 5CU8A 5ETDA 5A5PA 4Z6HA 5K29A 4CL9A 2R0SA 4XUBA 2D9EA 5CS8A 5F25A 3U5JA 5CQ3A 2OSSA 5CUEA 3LQJA 5I7YA 4J3IA 5ENEA 5I89A 5ENHA 5JI8A 4MEPA 4UIWA 4C67A 5A7CA 5EV9A 4HBYA 5LKTA 5F61A 4NS5A 5CP5A 4N4GA 3O33A 4GPJA 5FG4A 3U5NA 4Z1SA 2G4AA 4YY4A 5FG6A 4QNSA 4NRBA 3UVXA 4O7AA 5JWMA 3NXBA 5HQ6A 5HRVA 5DX4A 4WHWA 4UIYA 5FH8A 3K2JA 2I7KA 4DONA 4Z1QA 4HBVA 5LKUA 4TYLA 4NRAA 4QSSA 5EPRA 4OGJA 2MJVB 5H85A 4YADA 4YATA 4YC9A 5LKXA 5C87A 5TB6A 5C4QA 4XY9A 4YYIA 4ALGA 4UIXA 5L98A 5CRZA 5IGNA 4QC1A 5FE9A 3U5OA 4WIVA 4BHWA 3P5OA 4J1PA 4QB3A 1E6IA 4BJXA
chains in the Genus database with same CATH superfamily
2WP1A 4PCEA 2DVQA 5EI4A 3SVFA 5IBNA 5EQ1A 3FKMX 3MB3A 5FE2A 4FLPA 4NYVA 5E73A 5L8UA 2RNYA 5F3AA 5A81A 4ZC9A 5DYUA 5F5ZA 3VKHA 5E9YA 5HENA 2E7NA 3ONIA 5E7DA 3D7CA 3IU5A 4UYDA 1WUMA 3ERRA 5F60A 4UYEA 5EWHA 5HM0A 5CQ7A 5DY7A 5A83A 4QR5A 5CPEA 4MR6A 5LJ2A 5IG6A 5DW2A 4XUAA 5EPSA 4QUTA 5C85A 5D3TA 4F3IA 5EWWA 3LJWA 5CUAA 5DFBA 5CUDA 3P1CA 5L96A 5FE5A 4NYWA 4CLBA 1JSPB 4YYDA 5J0DA 5HLSA 4Q0OA 4LRGA 5D0CA 3UVYA 2LSPB 4Y03A 4CUUA 3QZSA 5F1LA 5KTXA 4LDFA 5FE3A 4LR6A 3IU6A 5ENFA 4E96A 5A82A 2R0YA 4NR8A 5KO4A 5LUUA 2NXBA 5EM3A 4BW1A 3LXJA 5ENJA 5E3GA 4O7FA 5CY9A 4QSWA 3G0JA 4IOOA 5H1TA 5I7XA 4CFLA 5FE4A 3HMEA 5E9KA 4LYSA 4QEWA 5DBMA 5FH7A 4RVRA 5DLXA 3S92A 4NXJA 4QEVA 4YAXA 2L5EA 4CUSA 4NR6A 2YW5A 4YBTA 4IORA 2F6JA 3TLPA 4UIUA 5KTWA 4LYIA 4CUQA 2H60A 4ZQLA 2N9GA 5ENGA 5EU1A 2RNXA 5D24A 4NR4A 3SVGA 4PS5A 5F2PA 5FDZA 5FE7A 2YEKA 2YELA 5E0RA 5DYXA 5CUCA 5EWVA 4YK0A 4NR5A 4AI6A 5AD3A 5A5QA 4UYGA 3SVHA 5DYCA 4A9EA 4BW2A 4A9MA 3QZVA 4HXRA 5FE6A 5ETBA 2E3KA 4KV4A 5HEMA 5FE8A 4HXKA 5CQ4A 4QSPA 5EWCA 3P1DA 5CZGA 2GRCA 4YH3A 5FFYA 2E7OA 3MB4A 4N4IA 4TT4A 4NR7A 5CFWA 4QY4A 4QYDA 5C7NA 5D3NA 1EQFA 2DVVA 2KTBB 3UVWA 4NUCA 5G4RA 4TU6A 5CQ6A 3HMFA 4QBMA 5HFQA 4YY6A 4J0RA 4MR3A 4AKNA 3JVKA 5FE0A 4HXLA 1ZKRA 4O7CA 5A5NA 4ALHA 4OGIA 4NUEA 4O75A 4HXPA 5HRXA 5DYAA 4LC2A 3O36A 3D1BA 4HXNA 4C66A 4CUTA 4HBWA 4PCIA 2YQDA 3U5MA 5L8TA 4YBMA 3HMHA 4KV1A 4QSQA 5DFCA 5CQTA 5D26A 4O72A 4A9IA 4O7BA 5DKDA 4LZSA 2FSAA 5AMFA 4QSUA 2L85A 4XY8A 4MR4A 4LYWA 5CRMA 5F36A 2DVSA 4HBXA 2OO1A 5EP7A 1ZS5A 3UV5A 4YYKA 5E9VA 3AQAA 5DKHA 5E9MA 5E9IA 4Z6IA 3U5KA 3AADA 5COIA 5TCMA 3G0LA 5ENIA 4WHUA 5L97A 2YYNA 4IR5A 4TU4A 1PUOA 4O77A 5G4SA 4X2IA 5D3JA 3DWYA 3LQHA 5CUGA 3U5LA 1F68A 5DW1A 4A9LA 4ZW1A 5II2A 5FH6A 2DVRA 4LZ2A 4Z93A 4MENA 3O34A 5LVRA 5EA1A 5H1UA 5I88A 5I1QA 5FE1A 5F62A 3Q2EA 5HJCA 1X0JA 4QR3A 4TTEA 3ZYUA 4BW3A 5D7XA 4YYNA 4KCXA 5EVAA 3MUKA 4YYJA 3DAIA 4YABA 5D3SA 4TT6A 3JVJA 2RO1A 5IGMA 5E3DA 2YDWA 4YYMA 4UITA 4A9NA 2DKWA 4UIVA 4UIZA 5D25A 3UV2A 4HXSA 2F6NA 5L99A 5FB1A 4AKIA 4A9HA 5I40A 3RCWA 5E74A 5D3PA 5F63A 3UW9A 4A9OA 4O7EA 4PTBA 4Q0NA 5CUBA 4QYLA 4YYGA 2YEMA 5D3RA 4QC3A 4HXOA 5I86A 5CTLA 3O35A 4NUDA 5C89A 5I29A 5I80A 2I8NA 4TZ2A 4CUPA 5ENBA 4A9KA 4QSXA 4MR5A 2RS9B 4O78A 5HFRA 5F1HA 4A9FA 3U5PA 5D3HA 5ENCA 5HELA 4QSVA 2DWWA 2DATA 4YH4A 1N72A 2R10A 5A5OA 3I3JA 4HXMA 5I83A 4O70A 5A5RA 5CQ8A 3GG3A 5AD2A 4IR6A 3LQIA 4N4FA 5BT4A 5LJ0A 5C8GA 5BT3A 4QZSA 3S91A 5LVQA 5EGUA 2R0VA 4OUFA 3MQMA 3JVLA 4NQMA 4QEUA 4TZ8A 5II1A 2WP2A 5CGPA 4PY6A 4PKLA 4NQNA 5EK9A 5CQ5A 5FBXA 4CURA 4NR9A 5LJ1A 2L84A 5A85A 4UYFB 5HQ7A 5KHMA 5A5SA 4J0SA 4IR4A 5IGLA 3MXFA 3UV4A 5EWDA 5H1VA 4LZRA 4CFKA 3P1FA 4TT2A 3JVMA 4N4HA 5DKCA 1JM4B 4NRCA 3Q2FA 4YYHA 5ACYA 5HCLA 4MEQA 5IGKA 4QUUA 4IR3A 4QSTA 5FB0A 5FG5A 4YBSA 4N3WA 5FFWA 4TQNA 5AMEA 4QR4A 4NYXA 5LKZA 5HRWA 5BT5A 4BW4A 2RFJA 5FFVA 5EISA 5CQAA 2RI7A 4O74A 5EICA 3P1EA 4AKHA 4MEOA 4QSRA 5EPBA 2OUOA 4IOQA 4UYHA 4XYAA 5KU3A 5DFDA 1WUGA 5KTUA 3VKGA 3MULA 4TS8A 3QZTA 5D3LA 5IIDA 3O37A 4UYFA 4O76A 5HQ5A 2D82A 5DLZA 5E9LA 2RNWA 4A9JA 4O71A 3UVDA 2EJNA 5CU8A 5ETDA 5A5PA 4Z6HA 5K29A 4CL9A 2R0SA 4XUBA 2D9EA 5CS8A 5F25A 3U5JA 5CQ3A 2OSSA 5CUEA 3LQJA 5I7YA 4J3IA 5ENEA 5I89A 5ENHA 5JI8A 4MEPA 4UIWA 4C67A 5A7CA 5EV9A 4HBYA 5LKTA 5F61A 4NS5A 5CP5A 4N4GA 3O33A 4GPJA 5FG4A 3U5NA 4Z1SA 2G4AA 4YY4A 5FG6A 4QNSA 4NRBA 3UVXA 4O7AA 5JWMA 3NXBA 5HQ6A 5HRVA 5DX4A 4WHWA 4UIYA 5FH8A 3K2JA 2I7KA 4DONA 4Z1QA 4HBVA 5LKUA 4TYLA 4NRAA 4QSSA 5EPRA 4OGJA 2MJVB 5H85A 4YADA 4YATA 4AKGA 4YC9A 5LKXA 5C87A 5TB6A 5C4QA 4XY9A 4YYIA 4ALGA 4UIXA 5L98A 5CRZA 5IGNA 4QC1A 3D1DA 5FE9A 3U5OA 4WIVA 4BHWA 3P5OA 4J1PA 4QB3A 1E6IA 4BJXA
chains in the Genus database with same CATH topology
2WP1A 4PCEA 2DVQA 5EI4A 3SVFA 5IBNA 5EQ1A 3FKMX 3MB3A 5FE2A 4FLPA 4NYVA 5E73A 5L8UA 2RNYA 5F3AA 5A81A 4ZC9A 5DYUA 5F5ZA 5E9YA 5HENA 2E7NA 3ONIA 5E7DA 3D7CA 3IU5A 4UYDA 1WUMA 5F60A 4UYEA 5EWHA 5HM0A 5CQ7A 5DY7A 5A83A 4QR5A 5CPEA 4MR6A 5LJ2A 5IG6A 5DW2A 4XUAA 5EPSA 4QUTA 5C85A 5D3TA 4F3IA 5EWWA 3LJWA 5CUAA 5DFBA 5CUDA 3P1CA 5L96A 5FE5A 4NYWA 4CLBA 1JSPB 4YYDA 5J0DA 5HLSA 4Q0OA 4LRGA 5D0CA 3UVYA 2LSPB 4Y03A 4CUUA 3QZSA 5F1LA 5KTXA 4LDFA 5FE3A 4LR6A 3IU6A 5ENFA 4E96A 5A82A 2R0YA 4NR8A 5KO4A 5LUUA 2NXBA 5EM3A 4BW1A 3LXJA 5ENJA 5E3GA 4O7FA 5CY9A 4QSWA 3G0JA 4IOOA 5H1TA 5I7XA 4CFLA 5FE4A 3HMEA 5E9KA 4LYSA 4QEWA 5DBMA 5FH7A 4RVRA 5DLXA 3S92A 4NXJA 4QEVA 4YAXA 2L5EA 4CUSA 4NR6A 2YW5A 4YBTA 4IORA 2F6JA 3TLPA 4UIUA 5KTWA 4LYIA 4CUQA 2H60A 4ZQLA 2N9GA 5ENGA 5EU1A 2RNXA 5D24A 4NR4A 3SVGA 4PS5A 5F2PA 5FDZA 5FE7A 2YEKA 2YELA 5E0RA 5DYXA 5CUCA 5EWVA 4YK0A 4NR5A 5AD3A 5A5QA 4UYGA 3SVHA 5DYCA 4A9EA 4BW2A 4A9MA 3QZVA 4HXRA 5FE6A 5ETBA 2E3KA 4KV4A 5HEMA 5FE8A 4HXKA 5CQ4A 4QSPA 5EWCA 3P1DA 5CZGA 2GRCA 4YH3A 5FFYA 2E7OA 3MB4A 4N4IA 4TT4A 4NR7A 5CFWA 4QY4A 4QYDA 5C7NA 5D3NA 1EQFA 2DVVA 2KTBB 3UVWA 4NUCA 5G4RA 4TU6A 5CQ6A 3HMFA 4QBMA 5HFQA 4YY6A 4J0RA 4MR3A 4AKNA 3JVKA 5FE0A 4HXLA 4O7CA 5A5NA 4ALHA 4OGIA 4NUEA 4O75A 4HXPA 5HRXA 5DYAA 4LC2A 3O36A 4HXNA 4C66A 4CUTA 4HBWA 4PCIA 2YQDA 3U5MA 5L8TA 4YBMA 3HMHA 4KV1A 4QSQA 5DFCA 5CQTA 5D26A 4O72A 4A9IA 4O7BA 5DKDA 4LZSA 2FSAA 5AMFA 4QSUA 2L85A 4XY8A 4MR4A 4LYWA 5CRMA 5F36A 2DVSA 4HBXA 2OO1A 5EP7A 1ZS5A 3UV5A 4YYKA 5E9VA 3AQAA 5DKHA 5E9MA 5E9IA 4Z6IA 3U5KA 3AADA 5COIA 5TCMA 3G0LA 5ENIA 4WHUA 5L97A 2YYNA 4IR5A 4TU4A 4O77A 5G4SA 4X2IA 5D3JA 3DWYA 3LQHA 5CUGA 3U5LA 1F68A 5DW1A 4A9LA 4ZW1A 5II2A 5FH6A 2DVRA 4LZ2A 4Z93A 4MENA 3O34A 5LVRA 5EA1A 5H1UA 5I88A 5I1QA 5FE1A 5F62A 3Q2EA 5HJCA 1X0JA 4QR3A 4TTEA 3ZYUA 4BW3A 5D7XA 4YYNA 4KCXA 5EVAA 3MUKA 4YYJA 3DAIA 4YABA 5D3SA 4TT6A 3JVJA 2RO1A 5IGMA 5E3DA 2YDWA 4YYMA 4UITA 4A9NA 2DKWA 4UIVA 4UIZA 5D25A 3UV2A 4HXSA 2F6NA 5L99A 5FB1A 4A9HA 5I40A 3RCWA 5E74A 5D3PA 5F63A 3UW9A 4A9OA 4O7EA 4PTBA 4Q0NA 5CUBA 4QYLA 4YYGA 2YEMA 5D3RA 4QC3A 4HXOA 5I86A 5CTLA 3O35A 4NUDA 5C89A 5I29A 5I80A 2I8NA 4TZ2A 4CUPA 5ENBA 4A9KA 4QSXA 4MR5A 2RS9B 4O78A 5HFRA 5F1HA 4A9FA 3U5PA 5D3HA 5ENCA 5HELA 4QSVA 2DWWA 2DATA 4YH4A 1N72A 2R10A 5A5OA 3I3JA 4HXMA 5I83A 4O70A 5A5RA 5CQ8A 3GG3A 5AD2A 4IR6A 3LQIA 4N4FA 5BT4A 5LJ0A 5C8GA 5BT3A 4QZSA 3S91A 5LVQA 5EGUA 2R0VA 4OUFA 3MQMA 3JVLA 4NQMA 4QEUA 4TZ8A 5II1A 2WP2A 5CGPA 4PY6A 4PKLA 4NQNA 5EK9A 5CQ5A 5FBXA 4CURA 4NR9A 5LJ1A 2L84A 5A85A 4UYFB 5HQ7A 5KHMA 5A5SA 4J0SA 4IR4A 5IGLA 3MXFA 3UV4A 5EWDA 5H1VA 4LZRA 4CFKA 3P1FA 4TT2A 3JVMA 4N4HA 5DKCA 1JM4B 4NRCA 3Q2FA 4YYHA 5ACYA 5HCLA 4MEQA 5IGKA 4QUUA 4IR3A 4QSTA 5FB0A 5FG5A 4YBSA 4N3WA 5FFWA 4TQNA 5AMEA 4QR4A 4NYXA 5LKZA 5HRWA 5BT5A 4BW4A 2RFJA 5FFVA 5EISA 5CQAA 2RI7A 4O74A 5EICA 3P1EA 4MEOA 4QSRA 5EPBA 2OUOA 4IOQA 4UYHA 4XYAA 5KU3A 5DFDA 1WUGA 5KTUA 3MULA 4TS8A 3QZTA 5D3LA 5IIDA 3O37A 4UYFA 4O76A 5HQ5A 2D82A 5DLZA 5E9LA 2RNWA 4A9JA 4O71A 3UVDA 5CU8A 5ETDA 5A5PA 4Z6HA 5K29A 4CL9A 2R0SA 4XUBA 2D9EA 5CS8A 5F25A 3U5JA 5CQ3A 2OSSA 5CUEA 3LQJA 5I7YA 4J3IA 5ENEA 5I89A 5ENHA 5JI8A 4MEPA 4UIWA 4C67A 5A7CA 5EV9A 4HBYA 5LKTA 5F61A 4NS5A 5CP5A 4N4GA 3O33A 4GPJA 5FG4A 3U5NA 4Z1SA 2G4AA 4YY4A 5FG6A 4QNSA 4NRBA 3UVXA 4O7AA 5JWMA 3NXBA 5HQ6A 5HRVA 5DX4A 4WHWA 4UIYA 5FH8A 3K2JA 2I7KA 4DONA 4Z1QA 4HBVA 5LKUA 4TYLA 4NRAA 4QSSA 5EPRA 4OGJA 2MJVB 5H85A 4YADA 4YATA 4YC9A 5LKXA 5C87A 5TB6A 5C4QA 4XY9A 4YYIA 4ALGA 4UIXA 5L98A 5CRZA 5IGNA 4QC1A 5FE9A 3U5OA 4WIVA 4BHWA 3P5OA 4J1PA 4QB3A 1E6IA 4BJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP1 A;  4PCE A;  2DVQ A;  5EI4 A;  3SVF A;  5IBN A;  5EQ1 A;  3FKM X;  3MB3 A;  5FE2 A;  4FLP A;  4NYV A;  5E73 A;  5L8U A;  2RNY A;  5F3A A;  5A81 A;  4ZC9 A;  5DYU A;  5F5Z A;  5E9Y A;  5HEN A;  2E7N A;  3ONI A;  5E7D A;  3D7C A;  3IU5 A;  4UYD A;  1WUM A;  5F60 A;  4UYE A;  5EWH A;  5HM0 A;  5CQ7 A;  5DY7 A;  5A83 A;  4QR5 A;  5CPE A;  4MR6 A;  5LJ2 A;  5IG6 A;  5DW2 A;  4XUA A;  5EPS A;  4QUT A;  5C85 A;  5D3T A;  4F3I A;  5EWW A;  3LJW A;  5CUA A;  5DFB A;  5CUD A;  3P1C A;  5L96 A;  5FE5 A;  4NYW A;  4CLB A;  1JSP B;  4YYD A;  5J0D A;  5HLS A;  4Q0O A;  4LRG A;  5D0C A;  3UVY A;  2LSP B;  4Y03 A;  4CUU A;  3QZS A;  5F1L A;  5KTX A;  4LDF A;  5FE3 A;  4LR6 A;  3IU6 A;  5ENF A;  4E96 A;  5A82 A;  2R0Y A;  4NR8 A;  5KO4 A;  5LUU A;  2NXB A;  5EM3 A;  4BW1 A;  3LXJ A;  5ENJ A;  5E3G A;  4O7F A;  5CY9 A;  4QSW A;  3G0J A;  4IOO A;  5H1T A;  5I7X A;  4CFL A;  5FE4 A;  3HME A;  5E9K A;  4LYS A;  4QEW A;  5DBM A;  5FH7 A;  4RVR A;  5DLX A;  3S92 A;  4NXJ A;  4QEV A;  4YAX A;  2L5E A;  4CUS A;  4NR6 A;  2YW5 A;  4YBT A;  4IOR A;  2F6J A;  3TLP A;  4UIU A;  5KTW A;  4LYI A;  4CUQ A;  2H60 A;  4ZQL A;  2N9G A;  5ENG A;  5EU1 A;  2RNX A;  5D24 A;  4NR4 A;  3SVG A;  4PS5 A;  5F2P A;  5FDZ A;  5FE7 A;  2YEK A;  2YEL A;  5E0R A;  5DYX A;  5CUC A;  5EWV A;  4YK0 A;  4NR5 A;  5AD3 A;  5A5Q A;  4UYG A;  3SVH A;  5DYC A;  4A9E A;  4BW2 A;  4A9M A;  3QZV A;  4HXR A;  5FE6 A;  5ETB A;  2E3K A;  4KV4 A;  5HEM A;  5FE8 A;  4HXK A;  5CQ4 A;  4QSP A;  5EWC A;  3P1D A;  5CZG A;  2GRC A;  4YH3 A;  5FFY A;  2E7O A;  3MB4 A;  4N4I A;  4TT4 A;  4NR7 A;  5CFW A;  4QY4 A;  4QYD A;  5C7N A;  5D3N A;  1EQF A;  2DVV A;  2KTB B;  3UVW A;  4NUC A;  5G4R A;  4TU6 A;  5CQ6 A;  3HMF A;  4QBM A;  5HFQ A;  4YY6 A;  4J0R A;  4MR3 A;  4AKN A;  3JVK A;  5FE0 A;  4HXL A;  4O7C A;  5A5N A;  4ALH A;  4OGI A;  4NUE A;  4O75 A;  4HXP A;  5HRX A;  5DYA A;  4LC2 A;  3O36 A;  4HXN A;  4C66 A;  4CUT A;  4HBW A;  4PCI A;  2YQD A;  3U5M A;  5L8T A;  4YBM A;  3HMH A;  4KV1 A;  4QSQ A;  5DFC A;  5CQT A;  5D26 A;  4O72 A;  4A9I A;  4O7B A;  5DKD A;  4LZS A;  2FSA A;  5AMF A;  4QSU A;  2L85 A;  4XY8 A;  4MR4 A;  4LYW A;  5CRM A;  5F36 A;  2DVS A;  4HBX A;  2OO1 A;  5EP7 A;  1ZS5 A;  3UV5 A;  4YYK A;  5E9V A;  3AQA A;  5DKH A;  5E9M A;  5E9I A;  4Z6I A;  3U5K A;  3AAD A;  5COI A;  5TCM A;  3G0L A;  5ENI A;  4WHU A;  5L97 A;  2YYN A;  4IR5 A;  4TU4 A;  4O77 A;  5G4S A;  4X2I A;  5D3J A;  3DWY A;  3LQH A;  5CUG A;  3U5L A;  1F68 A;  5DW1 A;  4A9L A;  4ZW1 A;  5II2 A;  5FH6 A;  2DVR A;  4LZ2 A;  4Z93 A;  4MEN A;  3O34 A;  5LVR A;  5EA1 A;  5H1U A;  5I88 A;  5I1Q A;  5FE1 A;  5F62 A;  3Q2E A;  5HJC A;  1X0J A;  4QR3 A;  4TTE A;  3ZYU A;  4BW3 A;  5D7X A;  4YYN A;  4KCX A;  5EVA A;  3MUK A;  4YYJ A;  3DAI A;  4YAB A;  5D3S A;  4TT6 A;  3JVJ A;  2RO1 A;  5IGM A;  5E3D A;  2YDW A;  4YYM A;  4UIT A;  4A9N A;  2DKW A;  4UIV A;  4UIZ A;  5D25 A;  3UV2 A;  4HXS A;  2F6N A;  5L99 A;  5FB1 A;  4A9H A;  5I40 A;  3RCW A;  5E74 A;  5D3P A;  5F63 A;  3UW9 A;  4A9O A;  4O7E A;  4PTB A;  4Q0N A;  5CUB A;  4QYL A;  4YYG A;  2YEM A;  5D3R A;  4QC3 A;  4HXO A;  5I86 A;  5CTL A;  3O35 A;  4NUD A;  5C89 A;  5I29 A;  5I80 A;  2I8N A;  4TZ2 A;  4CUP A;  5ENB A;  4A9K A;  4QSX A;  4MR5 A;  2RS9 B;  4O78 A;  5HFR A;  5F1H A;  4A9F A;  3U5P A;  5D3H A;  5ENC A;  5HEL A;  4QSV A;  2DWW A;  2DAT A;  4YH4 A;  1N72 A;  2R10 A;  5A5O A;  3I3J A;  4HXM A;  5I83 A;  4O70 A;  5A5R A;  5CQ8 A;  3GG3 A;  5AD2 A;  4IR6 A;  3LQI A;  4N4F A;  5BT4 A;  5LJ0 A;  5C8G A;  5BT3 A;  4QZS A;  3S91 A;  5LVQ A;  5EGU A;  2R0V A;  4OUF A;  3MQM A;  3JVL A;  4NQM A;  4QEU A;  4TZ8 A;  5II1 A;  2WP2 A;  5CGP A;  4PY6 A;  4PKL A;  4NQN A;  5EK9 A;  5CQ5 A;  5FBX A;  4CUR A;  4NR9 A;  5LJ1 A;  2L84 A;  5A85 A;  4UYF B;  5HQ7 A;  5KHM A;  5A5S A;  4J0S A;  4IR4 A;  5IGL A;  3MXF A;  3UV4 A;  5EWD A;  5H1V A;  4LZR A;  4CFK A;  3P1F A;  4TT2 A;  3JVM A;  4N4H A;  5DKC A;  1JM4 B;  4NRC A;  3Q2F A;  4YYH A;  5ACY A;  5HCL A;  4MEQ A;  5IGK A;  4QUU A;  4IR3 A;  4QST A;  5FB0 A;  5FG5 A;  4YBS A;  4N3W A;  5FFW A;  4TQN A;  5AME A;  4QR4 A;  4NYX A;  5LKZ A;  5HRW A;  5BT5 A;  4BW4 A;  2RFJ A;  5FFV A;  5EIS A;  5CQA A;  2RI7 A;  4O74 A;  5EIC A;  3P1E A;  4MEO A;  4QSR A;  5EPB A;  2OUO A;  4IOQ A;  4UYH A;  4XYA A;  5KU3 A;  5DFD A;  1WUG A;  5KTU A;  3MUL A;  4TS8 A;  3QZT A;  5D3L A;  5IID A;  3O37 A;  4UYF A;  4O76 A;  5HQ5 A;  2D82 A;  5DLZ A;  5E9L A;  2RNW A;  4A9J A;  4O71 A;  3UVD A;  5CU8 A;  5ETD A;  5A5P A;  4Z6H A;  5K29 A;  4CL9 A;  2R0S A;  4XUB A;  2D9E A;  5CS8 A;  5F25 A;  3U5J A;  5CQ3 A;  2OSS A;  5CUE A;  3LQJ A;  5I7Y A;  4J3I A;  5ENE A;  5I89 A;  5ENH A;  5JI8 A;  4MEP A;  4UIW A;  4C67 A;  5A7C A;  5EV9 A;  4HBY A;  5LKT A;  5F61 A;  4NS5 A;  5CP5 A;  4N4G A;  3O33 A;  4GPJ A;  5FG4 A;  3U5N A;  4Z1S A;  2G4A A;  4YY4 A;  5FG6 A;  4QNS A;  4NRB A;  3UVX A;  4O7A A;  5JWM A;  3NXB A;  5HQ6 A;  5HRV A;  5DX4 A;  4WHW A;  4UIY A;  5FH8 A;  3K2J A;  2I7K A;  4DON A;  4Z1Q A;  4HBV A;  5LKU A;  4TYL A;  4NRA A;  4QSS A;  5EPR A;  4OGJ A;  2MJV B;  5H85 A;  4YAD A;  4YAT A;  4YC9 A;  5LKX A;  5C87 A;  5TB6 A;  5C4Q A;  4XY9 A;  4YYI A;  4ALG A;  4UIX A;  5L98 A;  5CRZ A;  5IGN A;  4QC1 A;  5FE9 A;  3U5O A;  4WIV A;  4BHW A;  3P5O A;  4J1P A;  4QB3 A;  1E6I A;  4BJX A; 
#chains in the Genus database with same CATH topology
 2WP1 A;  4PCE A;  2DVQ A;  5EI4 A;  3SVF A;  5IBN A;  5EQ1 A;  3FKM X;  3MB3 A;  5FE2 A;  4FLP A;  4NYV A;  5E73 A;  5L8U A;  2RNY A;  5F3A A;  5A81 A;  4ZC9 A;  5DYU A;  5F5Z A;  3VKH A;  5E9Y A;  5HEN A;  2E7N A;  3ONI A;  5E7D A;  3D7C A;  3IU5 A;  4UYD A;  1WUM A;  3ERR A;  5F60 A;  4UYE A;  5EWH A;  5HM0 A;  5CQ7 A;  5DY7 A;  5A83 A;  4QR5 A;  5CPE A;  4MR6 A;  5LJ2 A;  5IG6 A;  5DW2 A;  4XUA A;  5EPS A;  4QUT A;  5C85 A;  5D3T A;  4F3I A;  5EWW A;  3LJW A;  5CUA A;  5DFB A;  5CUD A;  3P1C A;  5L96 A;  5FE5 A;  4NYW A;  4CLB A;  1JSP B;  4YYD A;  5J0D A;  5HLS A;  4Q0O A;  4LRG A;  5D0C A;  3UVY A;  2LSP B;  4Y03 A;  4CUU A;  3QZS A;  5F1L A;  5KTX A;  4LDF A;  5FE3 A;  4LR6 A;  3IU6 A;  5ENF A;  4E96 A;  5A82 A;  2R0Y A;  4NR8 A;  5KO4 A;  5LUU A;  2NXB A;  5EM3 A;  4BW1 A;  3LXJ A;  5ENJ A;  5E3G A;  4O7F A;  5CY9 A;  4QSW A;  3G0J A;  4IOO A;  5H1T A;  5I7X A;  4CFL A;  5FE4 A;  3HME A;  5E9K A;  4LYS A;  4QEW A;  5DBM A;  5FH7 A;  4RVR A;  5DLX A;  3S92 A;  4NXJ A;  4QEV A;  4YAX A;  2L5E A;  4CUS A;  4NR6 A;  2YW5 A;  4YBT A;  4IOR A;  2F6J A;  3TLP A;  4UIU A;  5KTW A;  4LYI A;  4CUQ A;  2H60 A;  4ZQL A;  2N9G A;  5ENG A;  5EU1 A;  2RNX A;  5D24 A;  4NR4 A;  3SVG A;  4PS5 A;  5F2P A;  5FDZ A;  5FE7 A;  2YEK A;  2YEL A;  5E0R A;  5DYX A;  5CUC A;  5EWV A;  4YK0 A;  4NR5 A;  4AI6 A;  5AD3 A;  5A5Q A;  4UYG A;  3SVH A;  5DYC A;  4A9E A;  4BW2 A;  4A9M A;  3QZV A;  4HXR A;  5FE6 A;  5ETB A;  2E3K A;  4KV4 A;  5HEM A;  5FE8 A;  4HXK A;  5CQ4 A;  4QSP A;  5EWC A;  3P1D A;  5CZG A;  2GRC A;  4YH3 A;  5FFY A;  2E7O A;  3MB4 A;  4N4I A;  4TT4 A;  4NR7 A;  5CFW A;  4QY4 A;  4QYD A;  5C7N A;  5D3N A;  1EQF A;  2DVV A;  2KTB B;  3UVW A;  4NUC A;  5G4R A;  4TU6 A;  5CQ6 A;  3HMF A;  4QBM A;  5HFQ A;  4YY6 A;  4J0R A;  4MR3 A;  4AKN A;  3JVK A;  5FE0 A;  4HXL A;  1ZKR A;  4O7C A;  5A5N A;  4ALH A;  4OGI A;  4NUE A;  4O75 A;  4HXP A;  5HRX A;  5DYA A;  4LC2 A;  3O36 A;  3D1B A;  4HXN A;  4C66 A;  4CUT A;  4HBW A;  4PCI A;  2YQD A;  3U5M A;  5L8T A;  4YBM A;  3HMH A;  4KV1 A;  4QSQ A;  5DFC A;  5CQT A;  5D26 A;  4O72 A;  4A9I A;  4O7B A;  5DKD A;  4LZS A;  2FSA A;  5AMF A;  4QSU A;  2L85 A;  4XY8 A;  4MR4 A;  4LYW A;  5CRM A;  5F36 A;  2DVS A;  4HBX A;  2OO1 A;  5EP7 A;  1ZS5 A;  3UV5 A;  4YYK A;  5E9V A;  3AQA A;  5DKH A;  5E9M A;  5E9I A;  4Z6I A;  3U5K A;  3AAD A;  5COI A;  5TCM A;  3G0L A;  5ENI A;  4WHU A;  5L97 A;  2YYN A;  4IR5 A;  4TU4 A;  1PUO A;  4O77 A;  5G4S A;  4X2I A;  5D3J A;  3DWY A;  3LQH A;  5CUG A;  3U5L A;  1F68 A;  5DW1 A;  4A9L A;  4ZW1 A;  5II2 A;  5FH6 A;  2DVR A;  4LZ2 A;  4Z93 A;  4MEN A;  3O34 A;  5LVR A;  5EA1 A;  5H1U A;  5I88 A;  5I1Q A;  5FE1 A;  5F62 A;  3Q2E A;  5HJC A;  1X0J A;  4QR3 A;  4TTE A;  3ZYU A;  4BW3 A;  5D7X A;  4YYN A;  4KCX A;  5EVA A;  3MUK A;  4YYJ A;  3DAI A;  4YAB A;  5D3S A;  4TT6 A;  3JVJ A;  2RO1 A;  5IGM A;  5E3D A;  2YDW A;  4YYM A;  4UIT A;  4A9N A;  2DKW A;  4UIV A;  4UIZ A;  5D25 A;  3UV2 A;  4HXS A;  2F6N A;  5L99 A;  5FB1 A;  4AKI A;  4A9H A;  5I40 A;  3RCW A;  5E74 A;  5D3P A;  5F63 A;  3UW9 A;  4A9O A;  4O7E A;  4PTB A;  4Q0N A;  5CUB A;  4QYL A;  4YYG A;  2YEM A;  5D3R A;  4QC3 A;  4HXO A;  5I86 A;  5CTL A;  3O35 A;  4NUD A;  5C89 A;  5I29 A;  5I80 A;  2I8N A;  4TZ2 A;  4CUP A;  5ENB A;  4A9K A;  4QSX A;  4MR5 A;  2RS9 B;  4O78 A;  5HFR A;  5F1H A;  4A9F A;  3U5P A;  5D3H A;  5ENC A;  5HEL A;  4QSV A;  2DWW A;  2DAT A;  4YH4 A;  1N72 A;  2R10 A;  5A5O A;  3I3J A;  4HXM A;  5I83 A;  4O70 A;  5A5R A;  5CQ8 A;  3GG3 A;  5AD2 A;  4IR6 A;  3LQI A;  4N4F A;  5BT4 A;  5LJ0 A;  5C8G A;  5BT3 A;  4QZS A;  3S91 A;  5LVQ A;  5EGU A;  2R0V A;  4OUF A;  3MQM A;  3JVL A;  4NQM A;  4QEU A;  4TZ8 A;  5II1 A;  2WP2 A;  5CGP A;  4PY6 A;  4PKL A;  4NQN A;  5EK9 A;  5CQ5 A;  5FBX A;  4CUR A;  4NR9 A;  5LJ1 A;  2L84 A;  5A85 A;  4UYF B;  5HQ7 A;  5KHM A;  5A5S A;  4J0S A;  4IR4 A;  5IGL A;  3MXF A;  3UV4 A;  5EWD A;  5H1V A;  4LZR A;  4CFK A;  3P1F A;  4TT2 A;  3JVM A;  4N4H A;  5DKC A;  1JM4 B;  4NRC A;  3Q2F A;  4YYH A;  5ACY A;  5HCL A;  4MEQ A;  5IGK A;  4QUU A;  4IR3 A;  4QST A;  5FB0 A;  5FG5 A;  4YBS A;  4N3W A;  5FFW A;  4TQN A;  5AME A;  4QR4 A;  4NYX A;  5LKZ A;  5HRW A;  5BT5 A;  4BW4 A;  2RFJ A;  5FFV A;  5EIS A;  5CQA A;  2RI7 A;  4O74 A;  5EIC A;  3P1E A;  4AKH A;  4MEO A;  4QSR A;  5EPB A;  2OUO A;  4IOQ A;  4UYH A;  4XYA A;  5KU3 A;  5DFD A;  1WUG A;  5KTU A;  3VKG A;  3MUL A;  4TS8 A;  3QZT A;  5D3L A;  5IID A;  3O37 A;  4UYF A;  4O76 A;  5HQ5 A;  2D82 A;  5DLZ A;  5E9L A;  2RNW A;  4A9J A;  4O71 A;  3UVD A;  2EJN A;  5CU8 A;  5ETD A;  5A5P A;  4Z6H A;  5K29 A;  4CL9 A;  2R0S A;  4XUB A;  2D9E A;  5CS8 A;  5F25 A;  3U5J A;  5CQ3 A;  2OSS A;  5CUE A;  3LQJ A;  5I7Y A;  4J3I A;  5ENE A;  5I89 A;  5ENH A;  5JI8 A;  4MEP A;  4UIW A;  4C67 A;  5A7C A;  5EV9 A;  4HBY A;  5LKT A;  5F61 A;  4NS5 A;  5CP5 A;  4N4G A;  3O33 A;  4GPJ A;  5FG4 A;  3U5N A;  4Z1S A;  2G4A A;  4YY4 A;  5FG6 A;  4QNS A;  4NRB A;  3UVX A;  4O7A A;  5JWM A;  3NXB A;  5HQ6 A;  5HRV A;  5DX4 A;  4WHW A;  4UIY A;  5FH8 A;  3K2J A;  2I7K A;  4DON A;  4Z1Q A;  4HBV A;  5LKU A;  4TYL A;  4NRA A;  4QSS A;  5EPR A;  4OGJ A;  2MJV B;  5H85 A;  4YAD A;  4YAT A;  4AKG A;  4YC9 A;  5LKX A;  5C87 A;  5TB6 A;  5C4Q A;  4XY9 A;  4YYI A;  4ALG A;  4UIX A;  5L98 A;  5CRZ A;  5IGN A;  4QC1 A;  3D1D A;  5FE9 A;  3U5O A;  4WIV A;  4BHW A;  3P5O A;  4J1P A;  4QB3 A;  1E6I A;  4BJX A; 
#chains in the Genus database with same CATH homology
 2WP1 A;  4PCE A;  2DVQ A;  5EI4 A;  3SVF A;  5IBN A;  5EQ1 A;  3FKM X;  3MB3 A;  5FE2 A;  4FLP A;  4NYV A;  5E73 A;  5L8U A;  2RNY A;  5F3A A;  5A81 A;  4ZC9 A;  5DYU A;  5F5Z A;  5E9Y A;  5HEN A;  2E7N A;  3ONI A;  5E7D A;  3D7C A;  3IU5 A;  4UYD A;  1WUM A;  5F60 A;  4UYE A;  5EWH A;  5HM0 A;  5CQ7 A;  5DY7 A;  5A83 A;  4QR5 A;  5CPE A;  4MR6 A;  5LJ2 A;  5IG6 A;  5DW2 A;  4XUA A;  5EPS A;  4QUT A;  5C85 A;  5D3T A;  4F3I A;  5EWW A;  3LJW A;  5CUA A;  5DFB A;  5CUD A;  3P1C A;  5L96 A;  5FE5 A;  4NYW A;  4CLB A;  1JSP B;  4YYD A;  5J0D A;  5HLS A;  4Q0O A;  4LRG A;  5D0C A;  3UVY A;  2LSP B;  4Y03 A;  4CUU A;  3QZS A;  5F1L A;  5KTX A;  4LDF A;  5FE3 A;  4LR6 A;  3IU6 A;  5ENF A;  4E96 A;  5A82 A;  2R0Y A;  4NR8 A;  5KO4 A;  5LUU A;  2NXB A;  5EM3 A;  4BW1 A;  3LXJ A;  5ENJ A;  5E3G A;  4O7F A;  5CY9 A;  4QSW A;  3G0J A;  4IOO A;  5H1T A;  5I7X A;  4CFL A;  5FE4 A;  3HME A;  5E9K A;  4LYS A;  4QEW A;  5DBM A;  5FH7 A;  4RVR A;  5DLX A;  3S92 A;  4NXJ A;  4QEV A;  4YAX A;  2L5E A;  4CUS A;  4NR6 A;  2YW5 A;  4YBT A;  4IOR A;  2F6J A;  3TLP A;  4UIU A;  5KTW A;  4LYI A;  4CUQ A;  2H60 A;  4ZQL A;  2N9G A;  5ENG A;  5EU1 A;  2RNX A;  5D24 A;  4NR4 A;  3SVG A;  4PS5 A;  5F2P A;  5FDZ A;  5FE7 A;  2YEK A;  2YEL A;  5E0R A;  5DYX A;  5CUC A;  5EWV A;  4YK0 A;  4NR5 A;  5AD3 A;  5A5Q A;  4UYG A;  3SVH A;  5DYC A;  4A9E A;  4BW2 A;  4A9M A;  3QZV A;  4HXR A;  5FE6 A;  5ETB A;  2E3K A;  4KV4 A;  5HEM A;  5FE8 A;  4HXK A;  5CQ4 A;  4QSP A;  5EWC A;  3P1D A;  5CZG A;  2GRC A;  4YH3 A;  5FFY A;  2E7O A;  3MB4 A;  4N4I A;  4TT4 A;  4NR7 A;  5CFW A;  4QY4 A;  4QYD A;  5C7N A;  5D3N A;  1EQF A;  2DVV A;  2KTB B;  3UVW A;  4NUC A;  5G4R A;  4TU6 A;  5CQ6 A;  3HMF A;  4QBM A;  5HFQ A;  4YY6 A;  4J0R A;  4MR3 A;  4AKN A;  3JVK A;  5FE0 A;  4HXL A;  4O7C A;  5A5N A;  4ALH A;  4OGI A;  4NUE A;  4O75 A;  4HXP A;  5HRX A;  5DYA A;  4LC2 A;  3O36 A;  4HXN A;  4C66 A;  4CUT A;  4HBW A;  4PCI A;  2YQD A;  3U5M A;  5L8T A;  4YBM A;  3HMH A;  4KV1 A;  4QSQ A;  5DFC A;  5CQT A;  5D26 A;  4O72 A;  4A9I A;  4O7B A;  5DKD A;  4LZS A;  2FSA A;  5AMF A;  4QSU A;  2L85 A;  4XY8 A;  4MR4 A;  4LYW A;  5CRM A;  5F36 A;  2DVS A;  4HBX A;  2OO1 A;  5EP7 A;  1ZS5 A;  3UV5 A;  4YYK A;  5E9V A;  3AQA A;  5DKH A;  5E9M A;  5E9I A;  4Z6I A;  3U5K A;  3AAD A;  5COI A;  5TCM A;  3G0L A;  5ENI A;  4WHU A;  5L97 A;  2YYN A;  4IR5 A;  4TU4 A;  4O77 A;  5G4S A;  4X2I A;  5D3J A;  3DWY A;  3LQH A;  5CUG A;  3U5L A;  1F68 A;  5DW1 A;  4A9L A;  4ZW1 A;  5II2 A;  5FH6 A;  2DVR A;  4LZ2 A;  4Z93 A;  4MEN A;  3O34 A;  5LVR A;  5EA1 A;  5H1U A;  5I88 A;  5I1Q A;  5FE1 A;  5F62 A;  3Q2E A;  5HJC A;  1X0J A;  4QR3 A;  4TTE A;  3ZYU A;  4BW3 A;  5D7X A;  4YYN A;  4KCX A;  5EVA A;  3MUK A;  4YYJ A;  3DAI A;  4YAB A;  5D3S A;  4TT6 A;  3JVJ A;  2RO1 A;  5IGM A;  5E3D A;  2YDW A;  4YYM A;  4UIT A;  4A9N A;  2DKW A;  4UIV A;  4UIZ A;  5D25 A;  3UV2 A;  4HXS A;  2F6N A;  5L99 A;  5FB1 A;  4A9H A;  5I40 A;  3RCW A;  5E74 A;  5D3P A;  5F63 A;  3UW9 A;  4A9O A;  4O7E A;  4PTB A;  4Q0N A;  5CUB A;  4QYL A;  4YYG A;  2YEM A;  5D3R A;  4QC3 A;  4HXO A;  5I86 A;  5CTL A;  3O35 A;  4NUD A;  5C89 A;  5I29 A;  5I80 A;  2I8N A;  4TZ2 A;  4CUP A;  5ENB A;  4A9K A;  4QSX A;  4MR5 A;  2RS9 B;  4O78 A;  5HFR A;  5F1H A;  4A9F A;  3U5P A;  5D3H A;  5ENC A;  5HEL A;  4QSV A;  2DWW A;  2DAT A;  4YH4 A;  1N72 A;  2R10 A;  5A5O A;  3I3J A;  4HXM A;  5I83 A;  4O70 A;  5A5R A;  5CQ8 A;  3GG3 A;  5AD2 A;  4IR6 A;  3LQI A;  4N4F A;  5BT4 A;  5LJ0 A;  5C8G A;  5BT3 A;  4QZS A;  3S91 A;  5LVQ A;  5EGU A;  2R0V A;  4OUF A;  3MQM A;  3JVL A;  4NQM A;  4QEU A;  4TZ8 A;  5II1 A;  2WP2 A;  5CGP A;  4PY6 A;  4PKL A;  4NQN A;  5EK9 A;  5CQ5 A;  5FBX A;  4CUR A;  4NR9 A;  5LJ1 A;  2L84 A;  5A85 A;  4UYF B;  5HQ7 A;  5KHM A;  5A5S A;  4J0S A;  4IR4 A;  5IGL A;  3MXF A;  3UV4 A;  5EWD A;  5H1V A;  4LZR A;  4CFK A;  3P1F A;  4TT2 A;  3JVM A;  4N4H A;  5DKC A;  1JM4 B;  4NRC A;  3Q2F A;  4YYH A;  5ACY A;  5HCL A;  4MEQ A;  5IGK A;  4QUU A;  4IR3 A;  4QST A;  5FB0 A;  5FG5 A;  4YBS A;  4N3W A;  5FFW A;  4TQN A;  5AME A;  4QR4 A;  4NYX A;  5LKZ A;  5HRW A;  5BT5 A;  4BW4 A;  2RFJ A;  5FFV A;  5EIS A;  5CQA A;  2RI7 A;  4O74 A;  5EIC A;  3P1E A;  4MEO A;  4QSR A;  5EPB A;  2OUO A;  4IOQ A;  4UYH A;  4XYA A;  5KU3 A;  5DFD A;  1WUG A;  5KTU A;  3MUL A;  4TS8 A;  3QZT A;  5D3L A;  5IID A;  3O37 A;  4UYF A;  4O76 A;  5HQ5 A;  2D82 A;  5DLZ A;  5E9L A;  2RNW A;  4A9J A;  4O71 A;  3UVD A;  5CU8 A;  5ETD A;  5A5P A;  4Z6H A;  5K29 A;  4CL9 A;  2R0S A;  4XUB A;  2D9E A;  5CS8 A;  5F25 A;  3U5J A;  5CQ3 A;  2OSS A;  5CUE A;  3LQJ A;  5I7Y A;  4J3I A;  5ENE A;  5I89 A;  5ENH A;  5JI8 A;  4MEP A;  4UIW A;  4C67 A;  5A7C A;  5EV9 A;  4HBY A;  5LKT A;  5F61 A;  4NS5 A;  5CP5 A;  4N4G A;  3O33 A;  4GPJ A;  5FG4 A;  3U5N A;  4Z1S A;  2G4A A;  4YY4 A;  5FG6 A;  4QNS A;  4NRB A;  3UVX A;  4O7A A;  5JWM A;  3NXB A;  5HQ6 A;  5HRV A;  5DX4 A;  4WHW A;  4UIY A;  5FH8 A;  3K2J A;  2I7K A;  4DON A;  4Z1Q A;  4HBV A;  5LKU A;  4TYL A;  4NRA A;  4QSS A;  5EPR A;  4OGJ A;  2MJV B;  5H85 A;  4YAD A;  4YAT A;  4YC9 A;  5LKX A;  5C87 A;  5TB6 A;  5C4Q A;  4XY9 A;  4YYI A;  4ALG A;  4UIX A;  5L98 A;  5CRZ A;  5IGN A;  4QC1 A;  5FE9 A;  3U5O A;  4WIV A;  4BHW A;  3P5O A;  4J1P A;  4QB3 A;  1E6I A;  4BJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...