2YW5A

Solution structure of the bromodomain from human bromodomain containing protein 3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
138
structure length
138
Chain Sequence
GSSGSSGEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 3
publication title Solution structure of the bromodomain from human bromodomain containing protein 3
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 37
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2007-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2yw5A00
4UIZA 5HLSA 3Q2EA 4IR4A 4QYDA 5FE2A 5EA1A 4O71A 3K2JA 4HXOA 4QEVA 5H1TA 4YYKA 5H85A 3HMHA 5ACYA 4CURA 2R0SA 5CQ6A 4LDFA 3I3JA 5DYCA 4O7AA 5DX4A 4HBWA 2DVQA 5KTWA 5CQAA 4PKLA 5G4RA 4A9EA 5A5PA 5C8GA 3U5LA 5FE3A 5EV9A 5FB1A 4HXKA 2YELA 4TU6A 4YY6A 2GRCA 1X0JA 4ALHA 4A9MA 4O77A 4YYIA 5IGKA 4QY4A 3FKMX 5A85A 5F62A 4CUSA 3LJWA 5E9VA 3DAIA 3UVDA 4CUQA 5E9YA 4TS8A 5D3NA 4QZSA 4Z6HA 5I80A 1N72A 4KV4A 3SVGA 5C7NA 4MR5A 5HEMA 5FE4A 5D3RA 3Q2FA 5A7CA 5EICA 4NQMA 4LZ2A 5E7DA 4A9KA 4LC2A 1E6IA 5CUGA 5CGPA 5H1VA 4TZ8A 5EWWA 3MULA 4PCIA 4A9LA 5KHMA 5E9KA 3MB4A 5HFRA 4A9OA 4IR6A 4TYLA 5BT3A 4QB3A 2R0YA 4UITA 5FH6A 5CQTA 4CUPA 1WUGA 5E9MA 5A5NA 5KTXA 4N4IA 5KU3A 3O34A 5CU8A 5ENCA 4NUDA 4MEQA 2DWWA 4NYVA 3U5PA 4QSUA 4AKNA 5I83A 4MEOA 5A82A 4RVRA 5I29A 4UYEA 5D3HA 3ZYUA 4PY6A 3D7CA 5II2A 4J0SA 2E7NA 2OO1A 4LRGA 4YBMA 5L8TA 5FE8A 4O7EA 5F1HA 3G0JA 4NUCA 4A9IA 5COIA 4CUUA 4N4GA 4QSRA 4QSPA 5CQ5A 5HQ5A 4TU4A 5CP5A 2DKWA 5ENBA 5FB0A 2YYNA 2WP2A 4UIWA 4IOQA 2DVVA 5IGMA 3HMFA 5E74A 4QEWA 5E73A 2RNWA 5FBXA 5DW2A 5F63A 4NUEA 4QSXA 5EP7A 5IIDA 4QNSA 3G0LA 4OGIA 5D7XA 5F1LA 5LJ2A 4KV1A 4Y03A 4O70A 2OSSA 3DWYA 4NRBA 3IU5A 4N4HA 5FH8A 4OGJA 5A83A 3RCWA 4Q0OA 5D0CA 4NR5A 4UYFA 5F5ZA 2YQDA 4YBTA 3MQMA 5H1UA 4CL9A 4NS5A 2DVRA 5E3GA 5AD3A 4BW2A 5FE6A 4Z6IA 3U5MA 5FFWA 2G4AA 4PTBA 5LJ1A 5FE7A 4TZ2A 5CPEA 1WUMA 2YEMA 5EISA 3UV2A 4YAXA 5LVQA 4UYHA 5CUAA 5FFYA 4IR3A 4WIVA 2RS9B 5CUEA 3P1EA 2E3KA 4PS5A 5A81A 5E9IA 4QC1A 5HFQA 1JM4B 2D82A 5CRMA 3HMEA 4QSWA 3UW9A 4UIXA 2RNXA 5TCMA 5L97A 4CUTA 3JVMA 4NRAA 4YYGA 3S92A 5CRZA 4TT2A 4XY9A 4YYNA 5EWCA 5FH7A 5L99A 5IGNA 2L5EA 4QEUA 4QUUA 4J1PA 5A5OA 3AQAA 4O7BA 5E0RA 4UYDA 5J0DA 4HXRA 5FFVA 2H60A 2I8NA 5EGUA 4QR3A 4MEPA 4YYMA 4BW3A 1F68A 4FLPA 4HXPA 3LQIA 4TT4A 4NR4A 5JI8A 4LYSA 5KTUA 5ENFA 5CQ7A 2OUOA 5ETBA 4BJXA 5D3JA 5EWVA 5FE9A 5LKUA 4UIUA 3AADA 3IU6A 5E3DA 5I89A 5F2PA 2MJVB 5D24A 5C4QA 5EI4A 5CUBA 4MR3A 4O76A 3UVXA 3O36A 4O7FA 2I7KA 4YYHA 4YYJA 5JWMA 4N3WA 5EWDA 3QZVA 5DKDA 5DLZA 5FE5A 4YH3A 5CQ4A 5ETDA 5FG4A 4YADA 3O37A 4DONA 3U5JA 5C89A 5ENJA 5DYUA 3U5NA 5EQ1A 3QZTA 4LYIA 4TT6A 2WP1A 3UVYA 4O7CA 5DY7A 5L98A 5IBNA 3O33A 4N4FA 5A5QA 5EU1A 5AMFA 4UYFB 5D25A 3O35A 5I1QA 3P1FA 5HRXA 5LKTA 3MXFA 5D3TA 5L96A 4ZC9A 5BT4A 2N9GA 5DW1A 3MUKA 4QSVA 5IGLA 3JVJA 4NR8A 4LYWA 5D3SA 5FG5A 3P1CA 4QSSA 4HBXA 4YBSA 5DFBA 5F3AA 2RFJA 4NYWA 2YW5A 4NRCA 4XUBA 5EPSA 4BW1A 4CFKA 3ONIA 2L85A 5A5SA 5DBMA 3P5OA 4YYDA 5CUCA 4YC9A 5EPBA 4C66A 1EQFA 5D3LA 4CLBA 4LZRA 4J3IA 4Z1QA 5HCLA 5EVAA 4UIVA 5CY9A 2E7OA 4IORA 4QSTA 2R0VA 4XY8A 4NQNA 4A9FA 4PCEA 4QYLA 5HM0A 5I40A 4QUTA 5LUUA 4F3IA 2LSPB 4NR9A 5I7YA 5LKZA 5I86A 4J0RA 5EPRA 4C67A 3LQJA 5FE0A 5HRWA 5G4SA 5DYAA 1ZS5A 4QSQA 5DFDA 5II1A 4YH4A 2NXBA 2RI7A 4NYXA 5HELA 4QC3A 3MB3A 5AD2A 5F61A 2FSAA 3SVHA 3TLPA 5FE1A 5ENEA 5IG6A 5LVRA 4BHWA 2YEKA 5ENHA 5FDZA 5F36A 4OUFA 4ALGA 4KCXA 5CS8A 4QR4A 3S91A 4QBMA 4NR6A 4NXJA 5HQ6A 4A9NA 3NXBA 4BW4A 3P1DA 4MR6A 5CQ3A 4IOOA 5DFCA 5ENGA 5I7XA 5K29A 3U5KA 4YK0A 5BT5A 5D26A 5KO4A 5F60A 4YABA 4QR5A 5LJ0A 4X2IA 5DLXA 4A9HA 2RO1A 3UVWA 4LZSA 5A5RA 5HQ7A 5DYXA 2F6NA 5I88A 2RNYA 3GG3A 5DKCA 5L8UA 5HJCA 5E9LA 4O75A 2L84A 4YY4A 4ZW1A 4HXMA 5EWHA 4WHUA 3SVFA 4ZQLA 5ENIA 5HRVA 4Z1SA 2D9EA 4MR4A 2F6JA 4HBYA 2DATA 4HBVA 4CFLA 4TTEA 3U5OA 2R10A 4NR7A 4YATA 4O72A 5LKXA 4LR6A 2DVSA 5C87A 1JSPB 4HXNA 5CUDA 4HXSA 4Z93A 4XUAA 3LXJA 3QZSA 4XYAA 4TQNA 5FG6A 2YDWA 5EK9A 4O74A 5DKHA 5AMEA 4Q0NA 5HENA 4A9JA 5CFWA 4GPJA 5CTLA 5EM3A 3UV5A 4O78A 4UYGA 5CZGA 3JVLA 4E96A 3UV4A 5C85A 4HXLA 2KTBB 4UIYA 5CQ8A 5TB6A 3JVKA 4WHWA 3LQHA 4MENA 4IR5A 5F25A 5D3PA
chains in the Genus database with same CATH superfamily
4UIZA 5HLSA 3Q2EA 4IR4A 4QYDA 5FE2A 5EA1A 4O71A 3K2JA 4HXOA 3VKGA 4QEVA 5H1TA 4YYKA 5H85A 3HMHA 5ACYA 4CURA 2R0SA 5CQ6A 4LDFA 3I3JA 5DYCA 4O7AA 5DX4A 4HBWA 2DVQA 5KTWA 5CQAA 4PKLA 5G4RA 4A9EA 5A5PA 5C8GA 3U5LA 5FE3A 5EV9A 3VKHA 5FB1A 4HXKA 2YELA 4TU6A 4YY6A 2GRCA 1X0JA 4ALHA 4A9MA 4O77A 4YYIA 5IGKA 4QY4A 3FKMX 5A85A 5F62A 4CUSA 3LJWA 5E9VA 3DAIA 3UVDA 3D1BA 4CUQA 5E9YA 4TS8A 5D3NA 4QZSA 4Z6HA 5I80A 1N72A 4KV4A 3SVGA 5C7NA 4MR5A 5HEMA 5FE4A 5D3RA 3Q2FA 5A7CA 5EICA 4NQMA 4LZ2A 5E7DA 4A9KA 4LC2A 1E6IA 5CUGA 5CGPA 5H1VA 4TZ8A 5EWWA 3MULA 4PCIA 4A9LA 5KHMA 5E9KA 3MB4A 5HFRA 4A9OA 4IR6A 4TYLA 5BT3A 4QB3A 2R0YA 4UITA 5FH6A 5CQTA 4CUPA 1WUGA 5E9MA 5A5NA 5KTXA 4N4IA 5KU3A 3O34A 5CU8A 5ENCA 4NUDA 4MEQA 2DWWA 4NYVA 3U5PA 4QSUA 4AKNA 5I83A 4MEOA 5A82A 4RVRA 5I29A 4UYEA 5D3HA 3ZYUA 4PY6A 3D7CA 5II2A 4J0SA 2E7NA 2OO1A 4LRGA 4YBMA 5L8TA 5FE8A 4O7EA 5F1HA 3G0JA 4NUCA 4A9IA 5COIA 4CUUA 4N4GA 4QSRA 4QSPA 5CQ5A 5HQ5A 4TU4A 5CP5A 2DKWA 5ENBA 5FB0A 2YYNA 2WP2A 4UIWA 4IOQA 2DVVA 5IGMA 3HMFA 5E74A 4QEWA 5E73A 2RNWA 5FBXA 5DW2A 5F63A 4NUEA 4QSXA 5EP7A 5IIDA 4QNSA 3G0LA 4OGIA 5D7XA 5F1LA 5LJ2A 4KV1A 4Y03A 4O70A 2OSSA 3DWYA 4NRBA 3IU5A 4N4HA 5FH8A 4OGJA 5A83A 3RCWA 4Q0OA 5D0CA 4NR5A 4UYFA 5F5ZA 2YQDA 4YBTA 3MQMA 5H1UA 4CL9A 4NS5A 2DVRA 5E3GA 5AD3A 4BW2A 5FE6A 4Z6IA 3U5MA 5FFWA 2G4AA 4PTBA 5LJ1A 5FE7A 4TZ2A 5CPEA 1WUMA 2YEMA 5EISA 3UV2A 4YAXA 5LVQA 4UYHA 5CUAA 5FFYA 4IR3A 4WIVA 2RS9B 5CUEA 3P1EA 2E3KA 4PS5A 5A81A 3ERRA 4QC1A 5E9IA 5HFQA 1JM4B 2D82A 5CRMA 3HMEA 4QSWA 3UW9A 4UIXA 2RNXA 5TCMA 5L97A 4CUTA 3JVMA 4NRAA 4YYGA 3S92A 5CRZA 4TT2A 4XY9A 4YYNA 5EWCA 5FH7A 5L99A 5IGNA 2L5EA 4QEUA 4QUUA 4J1PA 5A5OA 3AQAA 4O7BA 5E0RA 4UYDA 5J0DA 4HXRA 5FFVA 2H60A 2I8NA 5EGUA 4AI6A 4QR3A 4MEPA 4YYMA 4BW3A 1F68A 4FLPA 4HXPA 3LQIA 4TT4A 4NR4A 5JI8A 4LYSA 5KTUA 5ENFA 5CQ7A 2OUOA 5ETBA 4BJXA 5D3JA 5EWVA 5FE9A 5LKUA 4UIUA 3AADA 3IU6A 5E3DA 5I89A 5F2PA 2MJVB 5D24A 5C4QA 5EI4A 5CUBA 4MR3A 4O76A 3UVXA 3O36A 4AKGA 4O7FA 2I7KA 4YYHA 4YYJA 5JWMA 4N3WA 5EWDA 3QZVA 5DKDA 5DLZA 5FE5A 4YH3A 5CQ4A 5ETDA 5FG4A 4YADA 3O37A 4DONA 3U5JA 5C89A 5ENJA 1ZKRA 5DYUA 1PUOA 3U5NA 5EQ1A 3QZTA 4LYIA 4TT6A 2WP1A 3UVYA 4AKIA 4O7CA 2EJNA 5DY7A 5L98A 3D1DA 5IBNA 3O33A 4N4FA 5A5QA 5EU1A 5AMFA 4UYFB 5D25A 3O35A 5I1QA 3P1FA 5HRXA 5LKTA 3MXFA 5D3TA 5L96A 4ZC9A 5BT4A 2N9GA 5DW1A 3MUKA 4QSVA 5IGLA 3JVJA 4NR8A 4LYWA 5D3SA 5FG5A 3P1CA 4QSSA 4HBXA 4YBSA 5DFBA 5F3AA 2RFJA 4NYWA 2YW5A 4NRCA 4XUBA 5EPSA 4BW1A 4CFKA 3ONIA 2L85A 5A5SA 5DBMA 3P5OA 4YYDA 5CUCA 4YC9A 5EPBA 4C66A 1EQFA 5D3LA 4CLBA 4LZRA 4J3IA 4Z1QA 5HCLA 5EVAA 4UIVA 5CY9A 2E7OA 4IORA 4QSTA 2R0VA 4XY8A 4NQNA 4A9FA 4PCEA 4QYLA 5HM0A 5I40A 4QUTA 5LUUA 4F3IA 2LSPB 4NR9A 5I7YA 5LKZA 5I86A 4J0RA 5EPRA 4C67A 3LQJA 5FE0A 5HRWA 5G4SA 5DYAA 1ZS5A 4QSQA 5DFDA 5II1A 4YH4A 2NXBA 2RI7A 4NYXA 5HELA 4QC3A 3MB3A 5AD2A 5F61A 2FSAA 3SVHA 3TLPA 5FE1A 5ENEA 5IG6A 5LVRA 4BHWA 2YEKA 5ENHA 5FDZA 5F36A 4OUFA 4ALGA 4KCXA 5CS8A 4QR4A 3S91A 4QBMA 4NR6A 4NXJA 5HQ6A 4A9NA 3NXBA 4BW4A 3P1DA 4MR6A 5CQ3A 4IOOA 5DFCA 5ENGA 5I7XA 5K29A 3U5KA 4YK0A 5BT5A 5D26A 5KO4A 5F60A 4YABA 4QR5A 5LJ0A 4X2IA 5DLXA 4A9HA 2RO1A 3UVWA 4LZSA 5A5RA 5HQ7A 5DYXA 2F6NA 5I88A 2RNYA 3GG3A 5DKCA 5L8UA 5HJCA 5E9LA 4O75A 2L84A 4YY4A 4ZW1A 4HXMA 5EWHA 4WHUA 3SVFA 4ZQLA 5ENIA 5HRVA 4Z1SA 2D9EA 4MR4A 2F6JA 4HBYA 2DATA 4HBVA 4CFLA 4TTEA 3U5OA 2R10A 4NR7A 4YATA 4O72A 5LKXA 4LR6A 2DVSA 5C87A 1JSPB 4HXNA 5CUDA 4HXSA 4Z93A 4AKHA 4XUAA 3LXJA 3QZSA 4XYAA 4TQNA 5FG6A 2YDWA 5EK9A 4O74A 5DKHA 5AMEA 4Q0NA 5HENA 4A9JA 5CFWA 4GPJA 5CTLA 5EM3A 3UV5A 4O78A 4UYGA 5CZGA 3JVLA 4E96A 3UV4A 5C85A 4HXLA 2KTBB 4UIYA 5CQ8A 5TB6A 3JVKA 4WHWA 3LQHA 4MENA 4IR5A 5F25A 5D3PA
chains in the Genus database with same CATH topology
4UIZA 5HLSA 3Q2EA 4IR4A 4QYDA 5FE2A 5EA1A 4O71A 3K2JA 4HXOA 4QEVA 5H1TA 4YYKA 5H85A 3HMHA 5ACYA 4CURA 2R0SA 5CQ6A 4LDFA 3I3JA 5DYCA 4O7AA 5DX4A 4HBWA 2DVQA 5KTWA 5CQAA 4PKLA 5G4RA 4A9EA 5A5PA 5C8GA 3U5LA 5FE3A 5EV9A 5FB1A 4HXKA 2YELA 4TU6A 4YY6A 2GRCA 1X0JA 4ALHA 4A9MA 4O77A 4YYIA 5IGKA 4QY4A 3FKMX 5A85A 5F62A 4CUSA 3LJWA 5E9VA 3DAIA 3UVDA 4CUQA 5E9YA 4TS8A 5D3NA 4QZSA 4Z6HA 5I80A 1N72A 4KV4A 3SVGA 5C7NA 4MR5A 5HEMA 5FE4A 5D3RA 3Q2FA 5A7CA 5EICA 4NQMA 4LZ2A 5E7DA 4A9KA 4LC2A 1E6IA 5CUGA 5CGPA 5H1VA 4TZ8A 5EWWA 3MULA 4PCIA 4A9LA 5KHMA 5E9KA 3MB4A 5HFRA 4A9OA 4IR6A 4TYLA 5BT3A 4QB3A 2R0YA 4UITA 5FH6A 5CQTA 4CUPA 1WUGA 5E9MA 5A5NA 5KTXA 4N4IA 5KU3A 3O34A 5CU8A 5ENCA 4NUDA 4MEQA 2DWWA 4NYVA 3U5PA 4QSUA 4AKNA 5I83A 4MEOA 5A82A 4RVRA 5I29A 4UYEA 5D3HA 3ZYUA 4PY6A 3D7CA 5II2A 4J0SA 2E7NA 2OO1A 4LRGA 4YBMA 5L8TA 5FE8A 4O7EA 5F1HA 3G0JA 4NUCA 4A9IA 5COIA 4CUUA 4N4GA 4QSRA 4QSPA 5CQ5A 5HQ5A 4TU4A 5CP5A 2DKWA 5ENBA 5FB0A 2YYNA 2WP2A 4UIWA 4IOQA 2DVVA 5IGMA 3HMFA 5E74A 4QEWA 5E73A 2RNWA 5FBXA 5DW2A 5F63A 4NUEA 4QSXA 5EP7A 5IIDA 4QNSA 3G0LA 4OGIA 5D7XA 5F1LA 5LJ2A 4KV1A 4Y03A 4O70A 2OSSA 3DWYA 4NRBA 3IU5A 4N4HA 5FH8A 4OGJA 5A83A 3RCWA 4Q0OA 5D0CA 4NR5A 4UYFA 5F5ZA 2YQDA 4YBTA 3MQMA 5H1UA 4CL9A 4NS5A 2DVRA 5E3GA 5AD3A 4BW2A 5FE6A 4Z6IA 3U5MA 5FFWA 2G4AA 4PTBA 5LJ1A 5FE7A 4TZ2A 5CPEA 1WUMA 2YEMA 5EISA 3UV2A 4YAXA 5LVQA 4UYHA 5CUAA 5FFYA 4IR3A 4WIVA 2RS9B 5CUEA 3P1EA 2E3KA 4PS5A 5A81A 5E9IA 4QC1A 5HFQA 1JM4B 2D82A 5CRMA 3HMEA 4QSWA 3UW9A 4UIXA 2RNXA 5TCMA 5L97A 4CUTA 3JVMA 4NRAA 4YYGA 3S92A 5CRZA 4TT2A 4XY9A 4YYNA 5EWCA 5FH7A 5L99A 5IGNA 2L5EA 4QEUA 4QUUA 4J1PA 5A5OA 3AQAA 4O7BA 5E0RA 4UYDA 5J0DA 4HXRA 5FFVA 2H60A 2I8NA 5EGUA 4QR3A 4MEPA 4YYMA 4BW3A 1F68A 4FLPA 4HXPA 3LQIA 4TT4A 4NR4A 5JI8A 4LYSA 5KTUA 5ENFA 5CQ7A 2OUOA 5ETBA 4BJXA 5D3JA 5EWVA 5FE9A 5LKUA 4UIUA 3AADA 3IU6A 5E3DA 5I89A 5F2PA 2MJVB 5D24A 5C4QA 5EI4A 5CUBA 4MR3A 4O76A 3UVXA 3O36A 4O7FA 2I7KA 4YYHA 4YYJA 5JWMA 4N3WA 5EWDA 3QZVA 5DKDA 5DLZA 5FE5A 4YH3A 5CQ4A 5ETDA 5FG4A 4YADA 3O37A 4DONA 3U5JA 5C89A 5ENJA 5DYUA 3U5NA 5EQ1A 3QZTA 4LYIA 4TT6A 2WP1A 3UVYA 4O7CA 5DY7A 5L98A 5IBNA 3O33A 4N4FA 5A5QA 5EU1A 5AMFA 4UYFB 5D25A 3O35A 5I1QA 3P1FA 5HRXA 5LKTA 3MXFA 5D3TA 5L96A 4ZC9A 5BT4A 2N9GA 5DW1A 3MUKA 4QSVA 5IGLA 3JVJA 4NR8A 4LYWA 5D3SA 5FG5A 3P1CA 4QSSA 4HBXA 4YBSA 5DFBA 5F3AA 2RFJA 4NYWA 2YW5A 4NRCA 4XUBA 5EPSA 4BW1A 4CFKA 3ONIA 2L85A 5A5SA 5DBMA 3P5OA 4YYDA 5CUCA 4YC9A 5EPBA 4C66A 1EQFA 5D3LA 4CLBA 4LZRA 4J3IA 4Z1QA 5HCLA 5EVAA 4UIVA 5CY9A 2E7OA 4IORA 4QSTA 2R0VA 4XY8A 4NQNA 4A9FA 4PCEA 4QYLA 5HM0A 5I40A 4QUTA 5LUUA 4F3IA 2LSPB 4NR9A 5I7YA 5LKZA 5I86A 4J0RA 5EPRA 4C67A 3LQJA 5FE0A 5HRWA 5G4SA 5DYAA 1ZS5A 4QSQA 5DFDA 5II1A 4YH4A 2NXBA 2RI7A 4NYXA 5HELA 4QC3A 3MB3A 5AD2A 5F61A 2FSAA 3SVHA 3TLPA 5FE1A 5ENEA 5IG6A 5LVRA 4BHWA 2YEKA 5ENHA 5FDZA 5F36A 4OUFA 4ALGA 4KCXA 5CS8A 4QR4A 3S91A 4QBMA 4NR6A 4NXJA 5HQ6A 4A9NA 3NXBA 4BW4A 3P1DA 4MR6A 5CQ3A 4IOOA 5DFCA 5ENGA 5I7XA 5K29A 3U5KA 4YK0A 5BT5A 5D26A 5KO4A 5F60A 4YABA 4QR5A 5LJ0A 4X2IA 5DLXA 4A9HA 2RO1A 3UVWA 4LZSA 5A5RA 5HQ7A 5DYXA 2F6NA 5I88A 2RNYA 3GG3A 5DKCA 5L8UA 5HJCA 5E9LA 4O75A 2L84A 4YY4A 4ZW1A 4HXMA 5EWHA 4WHUA 3SVFA 4ZQLA 5ENIA 5HRVA 4Z1SA 2D9EA 4MR4A 2F6JA 4HBYA 2DATA 4HBVA 4CFLA 4TTEA 3U5OA 2R10A 4NR7A 4YATA 4O72A 5LKXA 4LR6A 2DVSA 5C87A 1JSPB 4HXNA 5CUDA 4HXSA 4Z93A 4XUAA 3LXJA 3QZSA 4XYAA 4TQNA 5FG6A 2YDWA 5EK9A 4O74A 5DKHA 5AMEA 4Q0NA 5HENA 4A9JA 5CFWA 4GPJA 5CTLA 5EM3A 3UV5A 4O78A 4UYGA 5CZGA 3JVLA 4E96A 3UV4A 5C85A 4HXLA 2KTBB 4UIYA 5CQ8A 5TB6A 3JVKA 4WHWA 3LQHA 4MENA 4IR5A 5F25A 5D3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UIZ A;  5HLS A;  3Q2E A;  4IR4 A;  4QYD A;  5FE2 A;  5EA1 A;  4O71 A;  3K2J A;  4HXO A;  4QEV A;  5H1T A;  4YYK A;  5H85 A;  3HMH A;  5ACY A;  4CUR A;  2R0S A;  5CQ6 A;  4LDF A;  3I3J A;  5DYC A;  4O7A A;  5DX4 A;  4HBW A;  2DVQ A;  5KTW A;  5CQA A;  4PKL A;  5G4R A;  4A9E A;  5A5P A;  5C8G A;  3U5L A;  5FE3 A;  5EV9 A;  5FB1 A;  4HXK A;  2YEL A;  4TU6 A;  4YY6 A;  2GRC A;  1X0J A;  4ALH A;  4A9M A;  4O77 A;  4YYI A;  5IGK A;  4QY4 A;  3FKM X;  5A85 A;  5F62 A;  4CUS A;  3LJW A;  5E9V A;  3DAI A;  3UVD A;  4CUQ A;  5E9Y A;  4TS8 A;  5D3N A;  4QZS A;  4Z6H A;  5I80 A;  1N72 A;  4KV4 A;  3SVG A;  5C7N A;  4MR5 A;  5HEM A;  5FE4 A;  5D3R A;  3Q2F A;  5A7C A;  5EIC A;  4NQM A;  4LZ2 A;  5E7D A;  4A9K A;  4LC2 A;  1E6I A;  5CUG A;  5CGP A;  5H1V A;  4TZ8 A;  5EWW A;  3MUL A;  4PCI A;  4A9L A;  5KHM A;  5E9K A;  3MB4 A;  5HFR A;  4A9O A;  4IR6 A;  4TYL A;  5BT3 A;  4QB3 A;  2R0Y A;  4UIT A;  5FH6 A;  5CQT A;  4CUP A;  1WUG A;  5E9M A;  5A5N A;  5KTX A;  4N4I A;  5KU3 A;  3O34 A;  5CU8 A;  5ENC A;  4NUD A;  4MEQ A;  2DWW A;  4NYV A;  3U5P A;  4QSU A;  4AKN A;  5I83 A;  4MEO A;  5A82 A;  4RVR A;  5I29 A;  4UYE A;  5D3H A;  3ZYU A;  4PY6 A;  3D7C A;  5II2 A;  4J0S A;  2E7N A;  2OO1 A;  4LRG A;  4YBM A;  5L8T A;  5FE8 A;  4O7E A;  5F1H A;  3G0J A;  4NUC A;  4A9I A;  5COI A;  4CUU A;  4N4G A;  4QSR A;  4QSP A;  5CQ5 A;  5HQ5 A;  4TU4 A;  5CP5 A;  2DKW A;  5ENB A;  5FB0 A;  2YYN A;  2WP2 A;  4UIW A;  4IOQ A;  2DVV A;  5IGM A;  3HMF A;  5E74 A;  4QEW A;  5E73 A;  2RNW A;  5FBX A;  5DW2 A;  5F63 A;  4NUE A;  4QSX A;  5EP7 A;  5IID A;  4QNS A;  3G0L A;  4OGI A;  5D7X A;  5F1L A;  5LJ2 A;  4KV1 A;  4Y03 A;  4O70 A;  2OSS A;  3DWY A;  4NRB A;  3IU5 A;  4N4H A;  5FH8 A;  4OGJ A;  5A83 A;  3RCW A;  4Q0O A;  5D0C A;  4NR5 A;  4UYF A;  5F5Z A;  2YQD A;  4YBT A;  3MQM A;  5H1U A;  4CL9 A;  4NS5 A;  2DVR A;  5E3G A;  5AD3 A;  4BW2 A;  5FE6 A;  4Z6I A;  3U5M A;  5FFW A;  2G4A A;  4PTB A;  5LJ1 A;  5FE7 A;  4TZ2 A;  5CPE A;  1WUM A;  2YEM A;  5EIS A;  3UV2 A;  4YAX A;  5LVQ A;  4UYH A;  5CUA A;  5FFY A;  4IR3 A;  4WIV A;  2RS9 B;  5CUE A;  3P1E A;  2E3K A;  4PS5 A;  5A81 A;  5E9I A;  4QC1 A;  5HFQ A;  1JM4 B;  2D82 A;  5CRM A;  3HME A;  4QSW A;  3UW9 A;  4UIX A;  2RNX A;  5TCM A;  5L97 A;  4CUT A;  3JVM A;  4NRA A;  4YYG A;  3S92 A;  5CRZ A;  4TT2 A;  4XY9 A;  4YYN A;  5EWC A;  5FH7 A;  5L99 A;  5IGN A;  2L5E A;  4QEU A;  4QUU A;  4J1P A;  5A5O A;  3AQA A;  4O7B A;  5E0R A;  4UYD A;  5J0D A;  4HXR A;  5FFV A;  2H60 A;  2I8N A;  5EGU A;  4QR3 A;  4MEP A;  4YYM A;  4BW3 A;  1F68 A;  4FLP A;  4HXP A;  3LQI A;  4TT4 A;  4NR4 A;  5JI8 A;  4LYS A;  5KTU A;  5ENF A;  5CQ7 A;  2OUO A;  5ETB A;  4BJX A;  5D3J A;  5EWV A;  5FE9 A;  5LKU A;  4UIU A;  3AAD A;  3IU6 A;  5E3D A;  5I89 A;  5F2P A;  2MJV B;  5D24 A;  5C4Q A;  5EI4 A;  5CUB A;  4MR3 A;  4O76 A;  3UVX A;  3O36 A;  4O7F A;  2I7K A;  4YYH A;  4YYJ A;  5JWM A;  4N3W A;  5EWD A;  3QZV A;  5DKD A;  5DLZ A;  5FE5 A;  4YH3 A;  5CQ4 A;  5ETD A;  5FG4 A;  4YAD A;  3O37 A;  4DON A;  3U5J A;  5C89 A;  5ENJ A;  5DYU A;  3U5N A;  5EQ1 A;  3QZT A;  4LYI A;  4TT6 A;  2WP1 A;  3UVY A;  4O7C A;  5DY7 A;  5L98 A;  5IBN A;  3O33 A;  4N4F A;  5A5Q A;  5EU1 A;  5AMF A;  4UYF B;  5D25 A;  3O35 A;  5I1Q A;  3P1F A;  5HRX A;  5LKT A;  3MXF A;  5D3T A;  5L96 A;  4ZC9 A;  5BT4 A;  2N9G A;  5DW1 A;  3MUK A;  4QSV A;  5IGL A;  3JVJ A;  4NR8 A;  4LYW A;  5D3S A;  5FG5 A;  3P1C A;  4QSS A;  4HBX A;  4YBS A;  5DFB A;  5F3A A;  2RFJ A;  4NYW A;  2YW5 A;  4NRC A;  4XUB A;  5EPS A;  4BW1 A;  4CFK A;  3ONI A;  2L85 A;  5A5S A;  5DBM A;  3P5O A;  4YYD A;  5CUC A;  4YC9 A;  5EPB A;  4C66 A;  1EQF A;  5D3L A;  4CLB A;  4LZR A;  4J3I A;  4Z1Q A;  5HCL A;  5EVA A;  4UIV A;  5CY9 A;  2E7O A;  4IOR A;  4QST A;  2R0V A;  4XY8 A;  4NQN A;  4A9F A;  4PCE A;  4QYL A;  5HM0 A;  5I40 A;  4QUT A;  5LUU A;  4F3I A;  2LSP B;  4NR9 A;  5I7Y A;  5LKZ A;  5I86 A;  4J0R A;  5EPR A;  4C67 A;  3LQJ A;  5FE0 A;  5HRW A;  5G4S A;  5DYA A;  1ZS5 A;  4QSQ A;  5DFD A;  5II1 A;  4YH4 A;  2NXB A;  2RI7 A;  4NYX A;  5HEL A;  4QC3 A;  3MB3 A;  5AD2 A;  5F61 A;  2FSA A;  3SVH A;  3TLP A;  5FE1 A;  5ENE A;  5IG6 A;  5LVR A;  4BHW A;  2YEK A;  5ENH A;  5FDZ A;  5F36 A;  4OUF A;  4ALG A;  4KCX A;  5CS8 A;  4QR4 A;  3S91 A;  4QBM A;  4NR6 A;  4NXJ A;  5HQ6 A;  4A9N A;  3NXB A;  4BW4 A;  3P1D A;  4MR6 A;  5CQ3 A;  4IOO A;  5DFC A;  5ENG A;  5I7X A;  5K29 A;  3U5K A;  4YK0 A;  5BT5 A;  5D26 A;  5KO4 A;  5F60 A;  4YAB A;  4QR5 A;  5LJ0 A;  4X2I A;  5DLX A;  4A9H A;  2RO1 A;  3UVW A;  4LZS A;  5A5R A;  5HQ7 A;  5DYX A;  2F6N A;  5I88 A;  2RNY A;  3GG3 A;  5DKC A;  5L8U A;  5HJC A;  5E9L A;  4O75 A;  2L84 A;  4YY4 A;  4ZW1 A;  4HXM A;  5EWH A;  4WHU A;  3SVF A;  4ZQL A;  5ENI A;  5HRV A;  4Z1S A;  2D9E A;  4MR4 A;  2F6J A;  4HBY A;  2DAT A;  4HBV A;  4CFL A;  4TTE A;  3U5O A;  2R10 A;  4NR7 A;  4YAT A;  4O72 A;  5LKX A;  4LR6 A;  2DVS A;  5C87 A;  1JSP B;  4HXN A;  5CUD A;  4HXS A;  4Z93 A;  4XUA A;  3LXJ A;  3QZS A;  4XYA A;  4TQN A;  5FG6 A;  2YDW A;  5EK9 A;  4O74 A;  5DKH A;  5AME A;  4Q0N A;  5HEN A;  4A9J A;  5CFW A;  4GPJ A;  5CTL A;  5EM3 A;  3UV5 A;  4O78 A;  4UYG A;  5CZG A;  3JVL A;  4E96 A;  3UV4 A;  5C85 A;  4HXL A;  2KTB B;  4UIY A;  5CQ8 A;  5TB6 A;  3JVK A;  4WHW A;  3LQH A;  4MEN A;  4IR5 A;  5F25 A;  5D3P A; 
#chains in the Genus database with same CATH topology
 4UIZ A;  5HLS A;  3Q2E A;  4IR4 A;  4QYD A;  5FE2 A;  5EA1 A;  4O71 A;  3K2J A;  4HXO A;  3VKG A;  4QEV A;  5H1T A;  4YYK A;  5H85 A;  3HMH A;  5ACY A;  4CUR A;  2R0S A;  5CQ6 A;  4LDF A;  3I3J A;  5DYC A;  4O7A A;  5DX4 A;  4HBW A;  2DVQ A;  5KTW A;  5CQA A;  4PKL A;  5G4R A;  4A9E A;  5A5P A;  5C8G A;  3U5L A;  5FE3 A;  5EV9 A;  3VKH A;  5FB1 A;  4HXK A;  2YEL A;  4TU6 A;  4YY6 A;  2GRC A;  1X0J A;  4ALH A;  4A9M A;  4O77 A;  4YYI A;  5IGK A;  4QY4 A;  3FKM X;  5A85 A;  5F62 A;  4CUS A;  3LJW A;  5E9V A;  3DAI A;  3UVD A;  3D1B A;  4CUQ A;  5E9Y A;  4TS8 A;  5D3N A;  4QZS A;  4Z6H A;  5I80 A;  1N72 A;  4KV4 A;  3SVG A;  5C7N A;  4MR5 A;  5HEM A;  5FE4 A;  5D3R A;  3Q2F A;  5A7C A;  5EIC A;  4NQM A;  4LZ2 A;  5E7D A;  4A9K A;  4LC2 A;  1E6I A;  5CUG A;  5CGP A;  5H1V A;  4TZ8 A;  5EWW A;  3MUL A;  4PCI A;  4A9L A;  5KHM A;  5E9K A;  3MB4 A;  5HFR A;  4A9O A;  4IR6 A;  4TYL A;  5BT3 A;  4QB3 A;  2R0Y A;  4UIT A;  5FH6 A;  5CQT A;  4CUP A;  1WUG A;  5E9M A;  5A5N A;  5KTX A;  4N4I A;  5KU3 A;  3O34 A;  5CU8 A;  5ENC A;  4NUD A;  4MEQ A;  2DWW A;  4NYV A;  3U5P A;  4QSU A;  4AKN A;  5I83 A;  4MEO A;  5A82 A;  4RVR A;  5I29 A;  4UYE A;  5D3H A;  3ZYU A;  4PY6 A;  3D7C A;  5II2 A;  4J0S A;  2E7N A;  2OO1 A;  4LRG A;  4YBM A;  5L8T A;  5FE8 A;  4O7E A;  5F1H A;  3G0J A;  4NUC A;  4A9I A;  5COI A;  4CUU A;  4N4G A;  4QSR A;  4QSP A;  5CQ5 A;  5HQ5 A;  4TU4 A;  5CP5 A;  2DKW A;  5ENB A;  5FB0 A;  2YYN A;  2WP2 A;  4UIW A;  4IOQ A;  2DVV A;  5IGM A;  3HMF A;  5E74 A;  4QEW A;  5E73 A;  2RNW A;  5FBX A;  5DW2 A;  5F63 A;  4NUE A;  4QSX A;  5EP7 A;  5IID A;  4QNS A;  3G0L A;  4OGI A;  5D7X A;  5F1L A;  5LJ2 A;  4KV1 A;  4Y03 A;  4O70 A;  2OSS A;  3DWY A;  4NRB A;  3IU5 A;  4N4H A;  5FH8 A;  4OGJ A;  5A83 A;  3RCW A;  4Q0O A;  5D0C A;  4NR5 A;  4UYF A;  5F5Z A;  2YQD A;  4YBT A;  3MQM A;  5H1U A;  4CL9 A;  4NS5 A;  2DVR A;  5E3G A;  5AD3 A;  4BW2 A;  5FE6 A;  4Z6I A;  3U5M A;  5FFW A;  2G4A A;  4PTB A;  5LJ1 A;  5FE7 A;  4TZ2 A;  5CPE A;  1WUM A;  2YEM A;  5EIS A;  3UV2 A;  4YAX A;  5LVQ A;  4UYH A;  5CUA A;  5FFY A;  4IR3 A;  4WIV A;  2RS9 B;  5CUE A;  3P1E A;  2E3K A;  4PS5 A;  5A81 A;  3ERR A;  4QC1 A;  5E9I A;  5HFQ A;  1JM4 B;  2D82 A;  5CRM A;  3HME A;  4QSW A;  3UW9 A;  4UIX A;  2RNX A;  5TCM A;  5L97 A;  4CUT A;  3JVM A;  4NRA A;  4YYG A;  3S92 A;  5CRZ A;  4TT2 A;  4XY9 A;  4YYN A;  5EWC A;  5FH7 A;  5L99 A;  5IGN A;  2L5E A;  4QEU A;  4QUU A;  4J1P A;  5A5O A;  3AQA A;  4O7B A;  5E0R A;  4UYD A;  5J0D A;  4HXR A;  5FFV A;  2H60 A;  2I8N A;  5EGU A;  4AI6 A;  4QR3 A;  4MEP A;  4YYM A;  4BW3 A;  1F68 A;  4FLP A;  4HXP A;  3LQI A;  4TT4 A;  4NR4 A;  5JI8 A;  4LYS A;  5KTU A;  5ENF A;  5CQ7 A;  2OUO A;  5ETB A;  4BJX A;  5D3J A;  5EWV A;  5FE9 A;  5LKU A;  4UIU A;  3AAD A;  3IU6 A;  5E3D A;  5I89 A;  5F2P A;  2MJV B;  5D24 A;  5C4Q A;  5EI4 A;  5CUB A;  4MR3 A;  4O76 A;  3UVX A;  3O36 A;  4AKG A;  4O7F A;  2I7K A;  4YYH A;  4YYJ A;  5JWM A;  4N3W A;  5EWD A;  3QZV A;  5DKD A;  5DLZ A;  5FE5 A;  4YH3 A;  5CQ4 A;  5ETD A;  5FG4 A;  4YAD A;  3O37 A;  4DON A;  3U5J A;  5C89 A;  5ENJ A;  1ZKR A;  5DYU A;  1PUO A;  3U5N A;  5EQ1 A;  3QZT A;  4LYI A;  4TT6 A;  2WP1 A;  3UVY A;  4AKI A;  4O7C A;  2EJN A;  5DY7 A;  5L98 A;  3D1D A;  5IBN A;  3O33 A;  4N4F A;  5A5Q A;  5EU1 A;  5AMF A;  4UYF B;  5D25 A;  3O35 A;  5I1Q A;  3P1F A;  5HRX A;  5LKT A;  3MXF A;  5D3T A;  5L96 A;  4ZC9 A;  5BT4 A;  2N9G A;  5DW1 A;  3MUK A;  4QSV A;  5IGL A;  3JVJ A;  4NR8 A;  4LYW A;  5D3S A;  5FG5 A;  3P1C A;  4QSS A;  4HBX A;  4YBS A;  5DFB A;  5F3A A;  2RFJ A;  4NYW A;  2YW5 A;  4NRC A;  4XUB A;  5EPS A;  4BW1 A;  4CFK A;  3ONI A;  2L85 A;  5A5S A;  5DBM A;  3P5O A;  4YYD A;  5CUC A;  4YC9 A;  5EPB A;  4C66 A;  1EQF A;  5D3L A;  4CLB A;  4LZR A;  4J3I A;  4Z1Q A;  5HCL A;  5EVA A;  4UIV A;  5CY9 A;  2E7O A;  4IOR A;  4QST A;  2R0V A;  4XY8 A;  4NQN A;  4A9F A;  4PCE A;  4QYL A;  5HM0 A;  5I40 A;  4QUT A;  5LUU A;  4F3I A;  2LSP B;  4NR9 A;  5I7Y A;  5LKZ A;  5I86 A;  4J0R A;  5EPR A;  4C67 A;  3LQJ A;  5FE0 A;  5HRW A;  5G4S A;  5DYA A;  1ZS5 A;  4QSQ A;  5DFD A;  5II1 A;  4YH4 A;  2NXB A;  2RI7 A;  4NYX A;  5HEL A;  4QC3 A;  3MB3 A;  5AD2 A;  5F61 A;  2FSA A;  3SVH A;  3TLP A;  5FE1 A;  5ENE A;  5IG6 A;  5LVR A;  4BHW A;  2YEK A;  5ENH A;  5FDZ A;  5F36 A;  4OUF A;  4ALG A;  4KCX A;  5CS8 A;  4QR4 A;  3S91 A;  4QBM A;  4NR6 A;  4NXJ A;  5HQ6 A;  4A9N A;  3NXB A;  4BW4 A;  3P1D A;  4MR6 A;  5CQ3 A;  4IOO A;  5DFC A;  5ENG A;  5I7X A;  5K29 A;  3U5K A;  4YK0 A;  5BT5 A;  5D26 A;  5KO4 A;  5F60 A;  4YAB A;  4QR5 A;  5LJ0 A;  4X2I A;  5DLX A;  4A9H A;  2RO1 A;  3UVW A;  4LZS A;  5A5R A;  5HQ7 A;  5DYX A;  2F6N A;  5I88 A;  2RNY A;  3GG3 A;  5DKC A;  5L8U A;  5HJC A;  5E9L A;  4O75 A;  2L84 A;  4YY4 A;  4ZW1 A;  4HXM A;  5EWH A;  4WHU A;  3SVF A;  4ZQL A;  5ENI A;  5HRV A;  4Z1S A;  2D9E A;  4MR4 A;  2F6J A;  4HBY A;  2DAT A;  4HBV A;  4CFL A;  4TTE A;  3U5O A;  2R10 A;  4NR7 A;  4YAT A;  4O72 A;  5LKX A;  4LR6 A;  2DVS A;  5C87 A;  1JSP B;  4HXN A;  5CUD A;  4HXS A;  4Z93 A;  4AKH A;  4XUA A;  3LXJ A;  3QZS A;  4XYA A;  4TQN A;  5FG6 A;  2YDW A;  5EK9 A;  4O74 A;  5DKH A;  5AME A;  4Q0N A;  5HEN A;  4A9J A;  5CFW A;  4GPJ A;  5CTL A;  5EM3 A;  3UV5 A;  4O78 A;  4UYG A;  5CZG A;  3JVL A;  4E96 A;  3UV4 A;  5C85 A;  4HXL A;  2KTB B;  4UIY A;  5CQ8 A;  5TB6 A;  3JVK A;  4WHW A;  3LQH A;  4MEN A;  4IR5 A;  5F25 A;  5D3P A; 
#chains in the Genus database with same CATH homology
 4UIZ A;  5HLS A;  3Q2E A;  4IR4 A;  4QYD A;  5FE2 A;  5EA1 A;  4O71 A;  3K2J A;  4HXO A;  4QEV A;  5H1T A;  4YYK A;  5H85 A;  3HMH A;  5ACY A;  4CUR A;  2R0S A;  5CQ6 A;  4LDF A;  3I3J A;  5DYC A;  4O7A A;  5DX4 A;  4HBW A;  2DVQ A;  5KTW A;  5CQA A;  4PKL A;  5G4R A;  4A9E A;  5A5P A;  5C8G A;  3U5L A;  5FE3 A;  5EV9 A;  5FB1 A;  4HXK A;  2YEL A;  4TU6 A;  4YY6 A;  2GRC A;  1X0J A;  4ALH A;  4A9M A;  4O77 A;  4YYI A;  5IGK A;  4QY4 A;  3FKM X;  5A85 A;  5F62 A;  4CUS A;  3LJW A;  5E9V A;  3DAI A;  3UVD A;  4CUQ A;  5E9Y A;  4TS8 A;  5D3N A;  4QZS A;  4Z6H A;  5I80 A;  1N72 A;  4KV4 A;  3SVG A;  5C7N A;  4MR5 A;  5HEM A;  5FE4 A;  5D3R A;  3Q2F A;  5A7C A;  5EIC A;  4NQM A;  4LZ2 A;  5E7D A;  4A9K A;  4LC2 A;  1E6I A;  5CUG A;  5CGP A;  5H1V A;  4TZ8 A;  5EWW A;  3MUL A;  4PCI A;  4A9L A;  5KHM A;  5E9K A;  3MB4 A;  5HFR A;  4A9O A;  4IR6 A;  4TYL A;  5BT3 A;  4QB3 A;  2R0Y A;  4UIT A;  5FH6 A;  5CQT A;  4CUP A;  1WUG A;  5E9M A;  5A5N A;  5KTX A;  4N4I A;  5KU3 A;  3O34 A;  5CU8 A;  5ENC A;  4NUD A;  4MEQ A;  2DWW A;  4NYV A;  3U5P A;  4QSU A;  4AKN A;  5I83 A;  4MEO A;  5A82 A;  4RVR A;  5I29 A;  4UYE A;  5D3H A;  3ZYU A;  4PY6 A;  3D7C A;  5II2 A;  4J0S A;  2E7N A;  2OO1 A;  4LRG A;  4YBM A;  5L8T A;  5FE8 A;  4O7E A;  5F1H A;  3G0J A;  4NUC A;  4A9I A;  5COI A;  4CUU A;  4N4G A;  4QSR A;  4QSP A;  5CQ5 A;  5HQ5 A;  4TU4 A;  5CP5 A;  2DKW A;  5ENB A;  5FB0 A;  2YYN A;  2WP2 A;  4UIW A;  4IOQ A;  2DVV A;  5IGM A;  3HMF A;  5E74 A;  4QEW A;  5E73 A;  2RNW A;  5FBX A;  5DW2 A;  5F63 A;  4NUE A;  4QSX A;  5EP7 A;  5IID A;  4QNS A;  3G0L A;  4OGI A;  5D7X A;  5F1L A;  5LJ2 A;  4KV1 A;  4Y03 A;  4O70 A;  2OSS A;  3DWY A;  4NRB A;  3IU5 A;  4N4H A;  5FH8 A;  4OGJ A;  5A83 A;  3RCW A;  4Q0O A;  5D0C A;  4NR5 A;  4UYF A;  5F5Z A;  2YQD A;  4YBT A;  3MQM A;  5H1U A;  4CL9 A;  4NS5 A;  2DVR A;  5E3G A;  5AD3 A;  4BW2 A;  5FE6 A;  4Z6I A;  3U5M A;  5FFW A;  2G4A A;  4PTB A;  5LJ1 A;  5FE7 A;  4TZ2 A;  5CPE A;  1WUM A;  2YEM A;  5EIS A;  3UV2 A;  4YAX A;  5LVQ A;  4UYH A;  5CUA A;  5FFY A;  4IR3 A;  4WIV A;  2RS9 B;  5CUE A;  3P1E A;  2E3K A;  4PS5 A;  5A81 A;  5E9I A;  4QC1 A;  5HFQ A;  1JM4 B;  2D82 A;  5CRM A;  3HME A;  4QSW A;  3UW9 A;  4UIX A;  2RNX A;  5TCM A;  5L97 A;  4CUT A;  3JVM A;  4NRA A;  4YYG A;  3S92 A;  5CRZ A;  4TT2 A;  4XY9 A;  4YYN A;  5EWC A;  5FH7 A;  5L99 A;  5IGN A;  2L5E A;  4QEU A;  4QUU A;  4J1P A;  5A5O A;  3AQA A;  4O7B A;  5E0R A;  4UYD A;  5J0D A;  4HXR A;  5FFV A;  2H60 A;  2I8N A;  5EGU A;  4QR3 A;  4MEP A;  4YYM A;  4BW3 A;  1F68 A;  4FLP A;  4HXP A;  3LQI A;  4TT4 A;  4NR4 A;  5JI8 A;  4LYS A;  5KTU A;  5ENF A;  5CQ7 A;  2OUO A;  5ETB A;  4BJX A;  5D3J A;  5EWV A;  5FE9 A;  5LKU A;  4UIU A;  3AAD A;  3IU6 A;  5E3D A;  5I89 A;  5F2P A;  2MJV B;  5D24 A;  5C4Q A;  5EI4 A;  5CUB A;  4MR3 A;  4O76 A;  3UVX A;  3O36 A;  4O7F A;  2I7K A;  4YYH A;  4YYJ A;  5JWM A;  4N3W A;  5EWD A;  3QZV A;  5DKD A;  5DLZ A;  5FE5 A;  4YH3 A;  5CQ4 A;  5ETD A;  5FG4 A;  4YAD A;  3O37 A;  4DON A;  3U5J A;  5C89 A;  5ENJ A;  5DYU A;  3U5N A;  5EQ1 A;  3QZT A;  4LYI A;  4TT6 A;  2WP1 A;  3UVY A;  4O7C A;  5DY7 A;  5L98 A;  5IBN A;  3O33 A;  4N4F A;  5A5Q A;  5EU1 A;  5AMF A;  4UYF B;  5D25 A;  3O35 A;  5I1Q A;  3P1F A;  5HRX A;  5LKT A;  3MXF A;  5D3T A;  5L96 A;  4ZC9 A;  5BT4 A;  2N9G A;  5DW1 A;  3MUK A;  4QSV A;  5IGL A;  3JVJ A;  4NR8 A;  4LYW A;  5D3S A;  5FG5 A;  3P1C A;  4QSS A;  4HBX A;  4YBS A;  5DFB A;  5F3A A;  2RFJ A;  4NYW A;  2YW5 A;  4NRC A;  4XUB A;  5EPS A;  4BW1 A;  4CFK A;  3ONI A;  2L85 A;  5A5S A;  5DBM A;  3P5O A;  4YYD A;  5CUC A;  4YC9 A;  5EPB A;  4C66 A;  1EQF A;  5D3L A;  4CLB A;  4LZR A;  4J3I A;  4Z1Q A;  5HCL A;  5EVA A;  4UIV A;  5CY9 A;  2E7O A;  4IOR A;  4QST A;  2R0V A;  4XY8 A;  4NQN A;  4A9F A;  4PCE A;  4QYL A;  5HM0 A;  5I40 A;  4QUT A;  5LUU A;  4F3I A;  2LSP B;  4NR9 A;  5I7Y A;  5LKZ A;  5I86 A;  4J0R A;  5EPR A;  4C67 A;  3LQJ A;  5FE0 A;  5HRW A;  5G4S A;  5DYA A;  1ZS5 A;  4QSQ A;  5DFD A;  5II1 A;  4YH4 A;  2NXB A;  2RI7 A;  4NYX A;  5HEL A;  4QC3 A;  3MB3 A;  5AD2 A;  5F61 A;  2FSA A;  3SVH A;  3TLP A;  5FE1 A;  5ENE A;  5IG6 A;  5LVR A;  4BHW A;  2YEK A;  5ENH A;  5FDZ A;  5F36 A;  4OUF A;  4ALG A;  4KCX A;  5CS8 A;  4QR4 A;  3S91 A;  4QBM A;  4NR6 A;  4NXJ A;  5HQ6 A;  4A9N A;  3NXB A;  4BW4 A;  3P1D A;  4MR6 A;  5CQ3 A;  4IOO A;  5DFC A;  5ENG A;  5I7X A;  5K29 A;  3U5K A;  4YK0 A;  5BT5 A;  5D26 A;  5KO4 A;  5F60 A;  4YAB A;  4QR5 A;  5LJ0 A;  4X2I A;  5DLX A;  4A9H A;  2RO1 A;  3UVW A;  4LZS A;  5A5R A;  5HQ7 A;  5DYX A;  2F6N A;  5I88 A;  2RNY A;  3GG3 A;  5DKC A;  5L8U A;  5HJC A;  5E9L A;  4O75 A;  2L84 A;  4YY4 A;  4ZW1 A;  4HXM A;  5EWH A;  4WHU A;  3SVF A;  4ZQL A;  5ENI A;  5HRV A;  4Z1S A;  2D9E A;  4MR4 A;  2F6J A;  4HBY A;  2DAT A;  4HBV A;  4CFL A;  4TTE A;  3U5O A;  2R10 A;  4NR7 A;  4YAT A;  4O72 A;  5LKX A;  4LR6 A;  2DVS A;  5C87 A;  1JSP B;  4HXN A;  5CUD A;  4HXS A;  4Z93 A;  4XUA A;  3LXJ A;  3QZS A;  4XYA A;  4TQN A;  5FG6 A;  2YDW A;  5EK9 A;  4O74 A;  5DKH A;  5AME A;  4Q0N A;  5HEN A;  4A9J A;  5CFW A;  4GPJ A;  5CTL A;  5EM3 A;  3UV5 A;  4O78 A;  4UYG A;  5CZG A;  3JVL A;  4E96 A;  3UV4 A;  5C85 A;  4HXL A;  2KTB B;  4UIY A;  5CQ8 A;  5TB6 A;  3JVK A;  4WHW A;  3LQH A;  4MEN A;  4IR5 A;  5F25 A;  5D3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...