4NS5A

Crystal structure of human bs69 bromo-zinc finger-pwwp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
185
Chain Sequence
QEMGTYLRFIVSRMKEVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger MYND domain-containing protein 11
publication title Crystal structure of human BS69 Bromo-ZnF-PWWP reveals its role in H3K36me3 nucleosome binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 66
structure length 185
sequence length 209
ec nomenclature
pdb deposition date 2013-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ns5A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ns5A02
5CUDA 5D3RA 3Q2FA 5G4SA 3MP8A 2WP1A 3UVDA 4HXOA 5ETDA 5F1HA 4YYMA 5E74A 5LJ0A 3H6ZA 4O70A 4C5GA 3JVJA 3MB4A 2RJCA 4NS5A 4LYSA 4XY9A 3OYNA 4UYGA 4CL9A 4A9LA 2YW5A 4TZ8A 4X2IA 5LJ1A 4NRCA 4UIUA 4A9IA 4O7CA 1WUMA 2RFJA 5L98A 5F63A 2JZ2A 5HJCA 4N4FA 5DKHA 4QVZA 4O7BA 3OYJA 5EA1A 3JVMA 2LVMA 3L42A 5D7XA 5ENHA 4O71A 4IUUA 4YBSA 5A82A 4E7KA 5DKDA 4BE2A 5FG4A 4YC9A 3UWNA 4FU6A 2LTOA 3MEWA 4BDZA 5L96A 5CIUA 5J0DA 5KTWA 2RNXA 2E5QA 5KE2A 1H3ZA 1G5VA 4QYDA 2D9EA 5CZGA 4Z6HA 5FB1A 3ONIA 3O34A 2DVRA 5CQ7A 5DKCA 5D0CA 5EPBA 2YQDA 4NR6A 5FE0A 4QQ6A 3OYFA 2WACA 4WHWA 2R5MA 4HCZA 5I83A 5CPEA 3FC3A 3AADA 4OGIA 3BDLA 3OY9A 4IR4A 3K2JA 3GG3A 4LRGA 3P1DA 4UYDA 2BKDN 2EQUA 4BACA 4LC2A 2R0VA 3Q2EA 5EI4A 5C89A 5EPSA 3QIIA 4J1PA 4EDUA 4QSSA 4ZC9A 4PLLA 4HXMA 4PLIA 1OI1A 3DWYA 3MUKA 5JI8A 3KUFA 3OS1A 3U5PA 3UVXA 4UIZA 2R10A 3QJ6A 5DYCA 3DLMA 4QBMA 1ZS5A 4CUTA 3U5KA 2X4XA 3P8HA 4LYIA 5KTXA 4NYVA 4IUPA 5E9KA 5EK9A 5DFCA 3IU5A 4L59A 4Z1SA 3ZYUA 5AMEA 2QQSA 5ENCA 5DLZA 3TLPA 2RI3A 3MP6A 5D3PA 4BJXA 3DB4A 5EM3A 2L3RA 5E3GA 5II1A 2EQKA 4Z6IA 5FH6A 5HEMA 4UYFA 2I7KA 5HQ7A 4QSXA 2R58A 2H60A 5ENIA 3LJWA 4TQNA 3O35A 4CFKA 3PMIA 2YYNA 4LZRA 4II1A 2P0KA 5A5PA 4NUEA 4A9JA 4ZTFA 4ZQLA 2YEKA 4KV1A 4WIVA 4CRIA 3E9FA 5FRMA 5D3SA 5HELA 4MR6A 1WGSA 2DKWA 2RNYA 5F3AA 4Q5WA 4BW2A 2DATA 2EFIA 3OYHA 4PS5A 1WJQA 4QC3A 4NQNA 2L85A 4BHWA 3MP1A 4NRAA 3RCWA 4C66A 4CLBA 5ENGA 4LDFA 5KHMA 3OMGA 5IIDA 2DAQA 4UYFB 4PTBA 5CUEA 4NQMA 5EWWA 4YYIA 4A9EA 4NXJA 4HXNA 2IG0A 4PKLA 4ALHA 3FDRA 4HXLA 3OYAA 5BT5A 4XY8A 5LVQA 3PFSA 2NXBA 2E6NA 5COIA 5KE3A 3S6WA 4YYNA 2GFUA 3P1EA 3U5NA 2RHIA 2VYTA 2F6NA 4BDYA 3UVWA 4BE1A 5ACYA 1KHCA 5DBMA 2KTBB 2GRCA 4MEOA 5CQ6A 5E9YA 4UIXA 5A5OA 5CQ3A 3OA6A 5CGPA 5CUBA 5E3DA 4BW4A 5LJ2A 5DW2A 3OQ5A 4A4HA 4J0RA 2NLUA 4IORA 5D3NA 4YY6A 5H1UA 5KTUA 5FB0A 5HFQA 2X4WA 5I7XA 3U5MA 4O77A 4O7EA 4YH4A 5IGLA 2RS9B 5DYXA 5KCOA 5I89A 4XUBA 5D26A 5H1VA 2E3KA 4QQGA 5EPRA 4LZSA 3OYLA 4MR3A 2R5AA 5FE3A 2QQRA 5JWMA 4QSWA 5F1LA 3QKJA 3NTIA 4Z93A 4QEVA 5A7CA 2DIQA 4RVRA 5FE7A 5C7NA 5I40A 5KU3A 1E6IA 4QSVA 5I29A 5EISA 2RO0A 5FROA 5FE1A 4CUSA 2G3RA 4LYWA 5F36A 4QEUA 3AQAA 4AKNA 4KV4A 5IBNA 3OMCA 5ENJA 5CUGA 5E9IA 3S92A 4HXKA 3L2UA 4HBXA 4Z1QA 4CFLA 5EGUA 3U5JA 1WJRA 4O72A 4Y03A 5EWVA 3LQJA 4TYLA 2YEMA 3UV2A 5A5NA 2LDMA 3FEOA 3LXJA 5LVRA 4NUDA 4X34A 4MEPA 4QY4A 4XYAA 2RJDA 5FH8A 4IUTA 4IR5A 5DYAA 5A81A 2F5KA 4NR8A 5J39A 4E7IA 4QSUA 4RG2A 4C67A 4LZ2A 2X35A 3O8VA 1MHNA 5ETBA 4LD6A 4YABA 2JTFA 5IGNA 5IAYA 5I7YA 3LX7A 3QZVA 3P5OA 5IGKA 5KH6A 5HLSA 3ZEHA 4Q0OA 4QSPA 2I8NA 4C5EA 3M9QA 5CUCA 2HQXA 4NR7A 5F2PA 3OB9A 5HQ6A 4PL6A 4E96A 4KCXA 2YDWA 3OYBA 3OYIA 3L2VA 4A9HA 5C4QA 5FFWA 3LLRA 3NTHA 4YYJA 3OYEA 4NYWA 3H8ZA 2RI5A 4HXRA 4QYLA 5A5QA 3LGFA 3OYMA 2M0OA 3G0LA 5A85A 3OYCA 2DVSA 3LQIA 3L2RA 5D6WA 5C6SA 5G4RA 3OYKA 1JSPB 5DY7A 4UC4A 5I86A 2RJFA 3S3NA 5E9LA 1X0JA 5FE2A 5LUUA 3SVFA 4UITA 5E73A 4NR9A 3LQHA 5CQTA 2DIGA 1XNIA 2MWPA 4IUVA 2HQEA 4E7JA 2LSPB 5D25A 5CY9A 5BT4A 3MO8A 4A4GA 3O37A 3I3JA 4NRBA 2BUDA 4IKFA 3MEVA 2MWOA 4F3IA 2EKOA 5CQ4A 4YYHA 5ENFA 5CUAA 4YAXA 5EICA 5HRWA 4FL6A 5BT3A 5F5ZA 5HRVA 3D7CA 2B8AA 2RHYA 4BW3A 5FG5A 3UVYA 4E7LA 2L84A 3LH0A 1SSFA 2D9TA 5F60A 5H85A 2E7NA 4YY4A 5C87A 4J3IA 5DLXA 5EWDA 4N3WA 4YH3A 5E0RA 5EP7A 4CURA 2E7OA 4LR6A 5FE6A 2MJVB 1WUGA 2F6JA 5FDZA 4N4GA 3ME9A 5CFWA 4QSQA 4QQDA 5HFRA 1OZ3A 3ASKA 4ALGA 5FE9A 5HM0A 3OS2A 4MR5A 4CUQA 2CKKA 4OUFA 4WHUA 5FG6A 3UV5A 5CP5A 3Q1JA 1N72A 3QZTA 4TT2A 4O7AA 4N4IA 4A9KA 5LKXA 4QW2A 5L8UA 5EWHA 4PCEA 2RO1A 2RI2A 5CQ8A 4YBTA 5CTLA 4IURA 4GPJA 4A9MA 3CEYA 4QSTA 5D3LA 5EU1A 1JM4B 5M9OA 4QR4A 3U5OA 2EQMA 5L99A 5E7DA 4O76A 3LYIA 3UT1A 4O7FA 1OZ2A 3OYDA 2RHUA 1WJSA 2X4YA 3FLGA 4UIVA 2XDPA 3NXBA 4TTEA 4GY5A 4UIYA 1EQFA 4NR5A 4ZTJA 4BD3A 2RNWA 4IR6A 1F68A 4TT6A 4HBWA 5C85A 3SD4A 2G4AA 3DAIA 4UIWA 3S91A 3QZSA 3MB3A 2R57A 5FE4A 2LRQA 4CUUA 4O74A 4TU4A 2GF7A 2L5EA 3P1FA 2DVVA 5CQAA 5EQ1A 2OSSA 5ENBA 3S3MA 1N27A 4J0SA 4TT4A 2O4XA 5D6YA 5LKZA 4YADA 5A5RA 4YK0A 4BW1A 5A5SA 5FE5A 2K3YA 4QUUA 5KCHA 5HENA 2EQJA 4FLPA 4QEWA 4IR3A 4IOQA 5DFBA 3SVGA 2K3XA 5D6XA 4A4FA 5H1TA 5FRNA 3O36A 5L8TA 3HMEA 5CRMA 3PMTA 2R0SA 4TU6A 5C8GA 4E7HA 5D24A 3UW9A 4MEQA 5D3JA 5DW1A 5HRXA 4A9FA 2WP2A 5D3TA 5IG6A 4MR4A 3IU6A 3META 3F70A 2O4XB 3GOXA 4YATA 4A9OA 5LKUA 5DYUA 2D82A 2OUOA 5DFDA 3MEUA 2RJEA 3L2QA 5EVAA 4UYEA 4TS8A 5F25A 2XK0A 3JVLA 2DVQA 4MENA 3FKMX 5AMFA 4PY6A 4OVAA 4IOOA 4C5IA 2PQWA 2R0YA 4O78A 5F62A 3U5LA 5LKTA 2L8DA 2GFAA 4QSRA 2YELA 4YYKA 5IGMA 3DB3A 3C4SA 4YBMA 3O33A 4OGJA 2BIVA 4ZW1A 3MULA 3UV4A 5A83A 3LGLA 2M16A 3OYGA 4HBYA 2N9GA 3JVKA 3S3OA 5L97A 4QNSA 3HMFA 4QC1A 5E9MA 3P8DA 4NYXA 5D3HA 2L89A 4IUQA 3HMHA 5CU8A 4N4HA 5TCMA 4HXSA 3PNWC 5FH7A 3G0JA 3MEAA 5K29A 4PCIA 5HCLA 4QR5A 5II2A 5TB6A 3QBYA 4A9NA 5I1QA 5AD2A 4NUCA 5C0MA 5FE8A 2DWWA 4YYDA 3E9GA 4Z02A 3P1CA 4B9XA 4C5HA 5F61A 5CQ5A 5FFYA 2RHXA 4CUPA 5ENEA 4DONA 4QZSA 4QB3A 2RI7A 5E9VA 1OYXA 2YRVA 1RI0A 5EWCA 4O75A 5FBXA 5I80A 5KO4A 3EAEA 5J26A 2OO1A 3SVHA 5IN1A 3MXFA 5DX4A 4NR4A 4YYGA 3NTKA 5AD3A 4TZ2A 2M1HA 4HBVA 5I88A 2FSAA 3MQMA 5HQ5A 5CS8A 4QR3A 2FHDA 4B9WA 4Q0NA 4QUTA 5CRZA 5EV9A 5FFVA 2RHZA 4A4EA 3OS0A 4UYHA 3L2WA 2LCCA 4HXPA 4XUAA 4BE0A
chains in the Genus database with same CATH superfamily
5CUDA 1D3BA 2RMOA 2J6KA 2WP1A 4HXOA 3H6ZA 4ORZA 1PD1A 2KROA 2RJCA 1UGRB 3OYNA 4UYGA 1IRXA 3X28B 4DBHA 4A9LA 2YW5A 4X2IA 4O7CA 3RESA 1AWXA 5HJCA 3U23A 3CXCA 1JQQA 2DJQA 2HAXA 5D7XA 1M90U 4YBSA 3M56A 4M78G 1WNLA 4A63B 1NYGA 2BTTA 2E10A 2EVRA 1OX8A 5A0LA 1VQLQ 1KQ2A 1UB4A 4FU6A 3MEWA 1CSKA 5IXBA 5J0DA 2PUOB 2QGGA 2E5QA 2COYA 4EMKC 2E41A 1H3ZA 2J6OA 4Y92A 4XTVA 4Z6HA 1AVZC 3ONIA 2P84A 4JJBA 3CCMQ 1PM3A 5FE0A 4NR6A 4XU3A 3CXCS 3OYFA 3VS0A 4HCZA 4JLGA 5I83A 5CPEA 1W70A 3UA6A 1JO8A 3BDLA 3VS2A 1TU0B 3CCJQ 3Q2EA 5EPSA 2MAMA 2NWMA 1D09B 4HXMA 4X1VA 4LUEA 3EG9B 1FXXA 3MUKA 2HBWA 4Z88A 2CH4W 5HKCA 3OS1A 3UVXA 4C92G 4UIZA 4K11A 1GBRA 1GBQA 1YCSB 1E7OA 2EWNA 3OSSC 4CUTA 4ZN3A 2OTLQ 4C8QC 4LYIA 5KTXA 5GANd 1I81A 5E9KA 3SFMA 5DFCA 2QA4Q 4JZ4A 2O88A 3ZYUA 5AMEA 4DEXA 4A53A 1K8AC 1BI2A 3H0HA 5IHKA 4LDXA 3JCMQ 2RI3A 4BJXA 2LNVA 5CO7A 1UFFA 4OMPA 4Z6IA 1NLPC 5FH6A 5HEMA 4LD9K 5HQ7A 4QSXA 2KR3A 1BI0A 2CS7A 4FYVB 4FW1A 4ME7A 3OYYA 4II1A 1OU8A 1VUBA 2ED0A 3FIFA 3CD6T 4ZTFA 4KGXB 1YJ9A 4WIVA 1GRIA 1Q95G 1TTHB 3OBWA 4BW2A 4M4ZA 3OYHA 2XDBA 4DBFA 4QC3A 4NQNA 4BHWA 3PVLA 4M7AE 3MP1A 4R0KA 5ENGA 3RDVA 1SRLA 3CCLQ 5CUEA 2JVVA 4HXNA 4PKLA 4ALHA 2GCXA 5IXFA 1X6GA 5LVQA 4FT2A 5COIA 4J6WA 3I5RA 4YYNA 1D1BA 2ROTA 2VYTA 2F6NA 3UVWA 2PNIA 5ACYA 5DBMA 5E9YA 2GRCA 5CQ3A 5CUBA 4BW4A 2QG9B 5LJ2A 1BIAA 3PVQA 4A4HA 3M4YA 1Z9QA 2NLUA 4RTYA 4HT8A 1ZUKA 1A0NB 5HFQA 3QXEB 2YLBA 3JB9H 4O7EA 1WHGA 3JCMV 4PJJA 3CXCP 4M75E 4LZSA 1ZSZC 1K8AR 5FE3A 1PRLC 1QKWA 1Y0MA 2E3HA 2D8HA 2Y90A 4HVUA 5DM7R 3QPHA 4D6WA 1KQ1A 2AT1B 1X6OA 4QSVA 5GAN3 2RO0A 1PSFA 4CUSA 5GAN6 4MZPA 1QVPA 2FPDA 5F36A 1ABOA 1VQLT 4M7DA 3JB9D 4AKNA 4KV4A 1W2BS 1ZBXA 4DQ2A 5E9IA 3HL8A 2F69A 4CFLA 3J81E 3U5JA 2OAWA 4O72A 5CAIA 1VQ6Q 4J7IA 1VQ8A 2O2OA 3UV2A 5A5NA 3FEOA 1QVFA 3CCMT 1Q81U 1GCQC 1QWFA 2GQVA 4D8KA 4IR5A 2LT4A 4RUGA 3CMAQ 4GLMA 1UGQB 4E7IA 4YTLA 4C67A 4R55A 3JCMd 2X35A 3CCJT 4CC3A 4YABA 3RUXA 5IGNA 3QZVA 3P5OA 2FZCB 3A8OB 4C0ZA 2NUPB 3M0QA 1MNEA 3EGXA 3EGDA 3M9QA 5F2PA 1VQKA 4KCXA 2OTLT 4ESRA 2FL7A 3CCEA 1QVFS 4NYWA 2GBQA 4PJOA 2QA4T 1RAIB 4HXJA 2DE0X 3LGFA 5KYUA 2KRNA 3G0LA 3L2RA 2MIOA 4WF2A 3A8HB 5D6WA 5C6SA 1KHIA 2DZ9A 4JJDA 5DY7A 1M2VB 1KD1U 1X27A 4F7UG 2QQAA 1X0JA 2LJ1A 1VYVA 2CZ0B 3UF4A 3LQHA 2DIGA 1XNIA 4E7JA 5FLXE 2FRYA 2KEAA 2ENMA 2D8JA 2VVKA 4NRBA 3I3JA 2BUDA 3CC2A 4IKFA 1VQNA 3MEVA 3V7CA 4XTXA 3HRTA 5CQ4A 1IGQA 4RMOA 3M0SA 2KK4A 3VS7A 2RHYA 5A2QE 1UHCA 3X20B 4EMKB 3CCLT 2DXCA 1M27C 3UVYA 3LW5E 2DKGA 5F60A 1K9MU 2HKQB 5EWDA 2QEXQ 4N3WA 2CZ6B 2DYBA 5FE6A 4XTZA 3ME9A 5FDZA 4N4GA 3HTRA 3PE0A 1TUCA 3CCQA 4L5GA 3CBOA 3JCMW 2KQWA 3JB9J 4CUQA 2DM1A 2EYYA 3UV5A 2QDYB 2ZCFB 4HVVA 1D0YA 2FO0A 2DFUA 5L8UA 1YHQA 4PCEA 2RO1A 3CCSA 2EJNA 2PZ1A 5CTLA 1D1AA 3CEYA 2KYMA 3D7SB 5EU1A 4OMFB 1YITA 5M9OA 5GANh 4JS4A 2XDDA 4DOVA 3QZ5B 2H3EB 3LYIA 1OZ2A 2EYQA 4FW2A 4J9EA 2CP5A 3FLGA 2F2VA 4UIVA 2L3SA 4J6YA 1VQPA 1O9SA 5LJ5d 5GANf 3CC4A 4ZTJA 4BD3A 3VUZA 1F68A 1W6XA 4OP0A 5IHIA 3CC7A 2G4AA 1SHGA 2F2WA 2VGNA 4X9CA 3PTAA 1UECA 2GF7A 2K2VA 2DVVA 1QVFP 1WHKA 3VRZA 2O4XA 4J0SA 4TT4A 1KG1A 5FE5A 2OAUA 1VQ6T 4QUUA 2COWA 3EG1A 2CZ1B 2LQWA 2EQJA 2YUNA 4FM4B 4FLPA 4QEWA 4IOQA 1UGVA 2RA2A 2K6DA 2MOXA 2BZ8A 4E7HA 1G3TA 4A4KA 3QSUA 3CMAT 3KFVA 1YJ9Q 4JRKA 2PTKA 4HT9A 2MYSA 1VQ4A 1ABQA 2VKNA 4YATA 2CP6A 2YLCA 1VQ7A 2RH2A 1UUEA 3G71A 5GJVB 4TS8A 1KC8C 2DVQA 3VYGA 3FKMX 5AMFA 1OEBA 3TQ7P 1I1JA 4C5IA 2VASA 5LKTA 2QQBA 4YYKA 4F14A 3FB9A 3V7SA 3C4SA 2BIVA 2P4TA 5A83A 4M7DF 1BK2A 3OYGA 2N9GA 5GAOl 1R77A 3M54A 1N6AA 4F7UB 1BYMA 2H8HA 2DEUA 5D3HA 1B34A 5FU6C 5LL6S 3QDRB 3REBB 4D8DA 5GAMe 2DL8A 2LJ3A 4HXSA 2C0IA 4QR5A 5II2A 1FX7A 3P8BB 1QP3A 5GMKi 2DERA 3GIBA 4YYDA 3E9GA 5CCAA 3P1CA 1NJIU 2JT4A 5CQXA 5F61A 5CQ5A 4M7DC 5ENEA 2E64A 3BW1A 1AZGB 4C8QA 1Q7YC 1CKAA 1WXUA 2FB7A 4YYGA 3NTKA 2M1HA 2QEXT 5I88A 2MK5A 3MQMA 3RKXA 4QR3A 4Q0NA 2E3IA 5CRZA 2MPXC 4OGCA 3E2UA 1D0ZA 2KGTA 4OB1B 1AT1B 2RI5A 3JCMh 5D3RA 3Q2FA 5G4SA 4O6JA 3MP8A 2A37A 2MCNA 1RLQC 5E74A 4O70A 4JLIA 3MB4A 1WZOA 1LOJA 5GAN2 3HHTB 1X2KA 2RK1A 1VQ8Q 1SHFA 5LJ1A 3HFOA 3I55Q 4NRCA 1WUMA 5L98A 1IHVA 3CMEA 1Y71A 4QVZA 1SPKA 4O7BA 1X43A 3EG2A 2VGMA 5GMKe 1D3BB 4HCKA 4PJMA 4XTWA 2QK0A 1KK7A 3HRUA 4M77F 2LTOA 1UG1A 5L96A 2HSPA 4JZ3A 2DO3A 4EIKA 1VQKQ 5CZGA 4KT0E 5IHNA 2AKKA 5FB1A 2E65A 5LJ3d 2EW3A 2E70A 4QQ6A 2WACA 4WHWA 2A7YA 3OS5A 1M3AA 3AADA 4IR4A 4PJNA 4M7DG 4BACA 3P1DA 4UYDA 5LJ5g 3CCRA 5C89A 1NM7A 4ZN1A 4XU0A 4LDYA 4QSSA 4M77C 4QKUA 4J9GA 1ZSZA 1MV0B 5JI8A 3U5PA 2JTMA 1YJ9T 2A3LA 2J06A 1X75C 3CC2Q 5KYXA 1VQNQ 1QP2A 4LNPA 2Y4XA 4IUPA 1WLPB 2KE9A 1MMAA 4AG1C 4C0DC 1JBMA 1OPLA 5D3PA 3V8JA 1PUOA 3QWYA 3DB4A 1K0SA 2LMJA 2L3RA 2JMCA 4UYFA 2D1XA 1BCMA 5FW9A 2X4JA 1WHLA 4ZQLA 5IH2A 2E12A 3EHQA 3CCQQ 4KV1A 4PFZA 1QW1A 4J9CA 1Q86C 1GCQA 3GP8A 4PJOG 4Q5WA 1N5ZA 4E7SA 3GF5A 2DNUA 1ARKA 3D1DA 3M0RA 3RCWA 4C66A 1ZSGA 5LJ5h 5LJ5j 1YHQQ 2NUZA 3CCSQ 4M78E 5EWWA 1IB8A 2RQWA 4HXLA 3PFSA 5LJ5f 4ZGDB 4AG2C 1VQ5Q 2E1HA 3S6WA 3AT1B 3U5NA 1QKXA 2RHIA 2KTBB 3JCMJ 1VQPQ 2DTOA 5A5OA 1M5Q1 5E3DA 1F1BB 3QWXX 1M3BA 5DW2A 3OQ5A 3NPFA 3ZBDA 4MMLA 5EG2A 3CC7Q 4J0RA 2XMFA 2CSIA 2XIDA 2EJGA 3HSBA 5D3NA 1JJ2P 1SKUB 5KTUA 5FB0A 2X4WA 1EZZB 5I7XA 2BE9B 2HL3A 4YH4A 5DYXA 1U8RA 5D26A 1M1KC 2BZXA 5EC7A 4NL3A 2NYSA 1VQ8T 2QQRA 4AKGA 1K8AU 5JWMA 2J05A 1TG0A 2ZPFB 4C92E 2CGHA 5GAOn 1AD5A 3I55T 5F1LA 3NTIA 4BY6B 1N8RC 2YHTA 4QT7A 5C7NA 5KU3A 1E6IA 1LPLA 5I29A 5EISA 1QWEA 2JTEA 2GGRA 3I56Q 1VQ4Q 4LYWA 4Z8AA 5GAOp 4GBQA 4DBQA 3AQAA 1Q86R 2L2PA 5CKDA 1VQ7Q 5FU6B 4C8QF 2EQIA 4OB3B 4HXKA 1JRIA 3G71Q 3TVTA 5EGUA 3VU3C 4Y03A 1YIJA 1VQKT 5EWVA 1O75A 2M51A 3CCUA 4FT4A 4TYLA 1OPKA 2LDMA 3VS6A 4NUDA 3G1JA 3UA7A 3UPUA 4XYAA 4CC4B 2LC4A 3BFMA 1X01A 1YN8A 4M7DB 5DYAA 5A81A 4RCBA 1TH7A 5IT9E 4OMMA 4RG2A 3H0IA 5FU7B 3O8VA 2KSSA 5ETBA 2ESWA 2JMAA 4LD6A 2DK3A 5IAYA 5DLOA 4E7ZA 5I7YA 3I9QA 2K5LA 3LX7A 4X9DA 4RTVA 5HLSA 3ZEHA 5LJ3g 1AWOA 1I8FA 4C5EA 1IO6A 2DYIA 5CUCA 2HQXA 3CC2T 1VQNT 4E96A 1WX6A 4KUIA 3L2VA 2K3BA 4A9HA 5FFWA 4YYJA 3RKWA 2IIMA 3H8ZA 3VJPA 5GAOq 1VYUA 1NPRA 2YDLA 3RERA 5A85A 4M7AC 2DVSA 3LQIA 2WSFE 3OYKA 1M90C 2P0PA 5DY9A 5E9LA 1SEMA 2FZKB 3EGDB 3EGXB 5LUUA 4ELYC 1N8RR 4UITA 3JV3A 1RAEB 2QGFB 4LDUA 1NG2A 2MWPA 2RB6A 2E5KA 4IUVA 3CCVA 2F5TX 5A0GA 1XQHA 1HD3A 3CCQT 2LSPB 5D25A 5CY9A 5CKEA 4PJOB 4ANJA 4M75F 3O37A 3JRZA 2MWOA 1RACB 5KYUB 1H3HA 5CUAA 2ZZDA 2ZAEA 8AT1B 2QTXA 3G6EA 1YHQT 3CCST 2FPEA 4E7LA 2QYZA 1NBEB 1B7TA 1SSFA 4LDVA 2D9TA 2K2MA 3SWNA 3CMEQ 1RUWA 5LJ3h 5EP7A 5LJ3j 5GJWB 4CURA 2E7OA 4LR6A 2MJVB 1VQ5T 1ZUUA 1VQ9A 4J6XA 4QSQA 1PKTA 2PVDB 4M75C 5HFRA 3RR6A 3FRNA 1VQPT 1ZBJA 5LJ3f 2CKKA 3EFOA 3SB2A 4WHUA 5FG6A 4C8QG 1TUGB 5CP5A 3Q1JA 3M0TA 3CC7T 4N4IA 4EMGA 1W4SA 1JM4B 3C94A 2EQMA 2O9VA 3GPLA 3UT1A 3CCRQ 1YJNA 5HY6A 1WJSA 2O9SA 2HKNA 2XDPA 4TTEA 2RNWA 4TT6A 4F17A 1QQJA 3SD4A 3I56T 1VQ4T 3DAIA 4XTUA 5ECAA 4UIWA 3S91A 1GCPA 3QZSA 4WTOB 4E47A 2R57A 2DD4A 2LRQA 3TSZA 4TU4A 1K73C 4LN2A 1VQ7T 2L5EA 2OSSA 4F7UE 5ENBA 3G71T 2J7IA 2K4YA 3A8MB 4YADA 4YK0A 2K3YA 2KT8A 4DBRA 2VB6A 1HK9A 1UJYA 4IR3A 2XD0A 5DFBA 3SVGA 1TUDA 2K3XA 2CH4A 5H1TA 2ZPHB 5FRNA 3NFCA 3O36A 5L8TA 3HMEA 1E6HA 1VIEA 4JRIA 5GAN8 3PMTA 4TU6A 5C8GA 2L3PA 4QVCA 3UW9A 1MGQA 5D3JA 5DW1A 5HRXA 4A9FA 2WP2A 4MZMA 5D3TA 1D1CA 3F70A 2O4XB 1KFZA 2HD0A 1MNDA 2LZ6B 1T3SA 4DOWA 2GTJA 3L2QA 4MMKA 3LWHA 2FVUA 4PY6A 4M7DD 4O78A 5F62A 3U5LA 4LXCA 5IGMA 4OGJA 3MULA 3S3OA 4Y91A 4QNSA 3N5BB 3P8DA 4NYXA 1S72A 1RLPC 1YFNA 5J3BA 4OGEA 2A36A 3PIOA 5TCMA 1I5OB 1WQ7A 2ZPGB 4M77A 3PNWC 5FH7A 5HCLA 2DILA 5TB6A 1BI3A 5AD2A 4HA8A 2ZPBB 1K73R 1VQOA 4CUPA 1ZA2B 2DRMA 1K1ZA 1OYXA 2YRVA 1RI0A 5EWCA 1B34B 1S1NA 4LE9A 1QVGA 5FBXA 4P5NA 1SF9A 3M0UA 2VV5A 2OO1A 3CMET 5AD3A 4N0AC 2COZA 4PJOD 5HQ5A 5CS8A 2K57A 3C0CA 1AWWA 1AZEA 4FYYB 4JDSA 4TVRA 2M9UA 2NUTA 5FFVA 2RHZA 4A4EA 2XU8A 2FPFA 3OS0A 3ULRB 4HXPA 4BE0A 1G3YA 4LDWA 1I0CA 4GLKA 4C8QB 2OJ2A 3UVDA 4YYMA 1V76A 3VKIA 5LJ0A 2YUQA 4CC2A 1AEYA 1QCOA 2VUBA 4C5GA 3JVJA 4BUGA 1YIJQ 3A8LB 4M78A 3WXMB 4CL9A 1QVGS 1BCOA 4UIUA 4A9IA 1IREB 2LCSA 2RFJA 5F63A 2JZ2A 5DKHA 5EA1A 5ENHA 4IUUA 5A82A 3VKGA 4E7KA 5DKDA 2O31A 1KD1C 3CCRT 3UWNA 4BDZA 3TREA 5KTWA 2RNXA 3EH2A 2V26A 1WI7A 1JU5C 5KE2A 2HL5C 2CSQA 4RG8A 4QYDA 1WXBA 2D9EA 2LX9A 3O34A 4PFOA 1IHWA 5CQ7A 5DKCA 1Y96B 2LQNA 2R5MA 4ZNXA 3R6OA 3M53A 5CKBA 3X26B 3FC3A 1MUZA 1Q82C 3M57A 1K9MC 4OMOA 4Y28E 4PNOA 3TCJA 4C92A 5I2SA 3QIIA 4ZC9A 2FG0A 4RTXA 2A28A 2HBPA 3CCVQ 3RIRA 3SWNC 3KUFA 2KXDA 4XAXB 5CVIA 5DYCA 3DLMA 4AMCA 1ZS5A 3CQTA 5GAOr 4AFQC 1VQLA 2QTVA 5HCKA 4NYVA 3VUBA 2DMOA 4J8OA 2RK2A 1JXMA 1NEBA 4Z1SA 3G6EQ 5ENCA 1LVKA 4J83A 1NLOC 2W10A 1ZSZB 5E3GA 2EQKA 2I7KA 4J7FA 2WSCE 2R58A 5HK0A 2H60A 1XJWB 4TQNA 3O35A 4CFKA 3OW2A 1HJDA 3PMIA 4LZRA 1YWPA 5KYXB 5A5PA 1VQ9Q 4NUEA 2YEKA 4CRIA 3E9FA 5FRMA 5HELA 1WGSA 2RNYA 2YRCA 4PKCC 2LX7A 2DL5A 2EFIA 1WJQA 2L5QA 2L85A 1OOTA 4NRAA 4LDFA 3OMGA 1CKBA 2DAQA 1U3OA 1X2QA 4UYFB 1NEGA 3J80E 4PTBA 2VXEA 4NQMA 4YYIA 4A9EA 3QYHB 4NXJA 2IG0A 1QVGP 1TS9A 1RADB 1WA7A 4R56A 2NXBA 3OW2S 3HRSA 2E6NA 3RKYA 4JPBW 2MMPA 5GANe 3JCMX 5KE3A 1YJNQ 1Q82R 1G3SA 3NGPA 4BE1A 5CQ6A 4UIXA 1WYXA 3HKSA 1LJOA 2DL7A 4M7AA 5L23A 1FWZA 1FMWA 2CZ7B 2OI3A 1JJ2A 1KC8R 2ATCB 3U5MA 4NL2A 1HXDA 5I89A 1ZKRA 5H1VA 2E3KA 5EPRA 3HPWA 2V8IA 1C1AA 3THKA 1B07A 1YIJT 2AIRB 1BKBA 5DLQE 4QSWA 4KH1B 1WPYA 2VC8A 5I40A 3JB9I 1UJ0A 2JN0A 1TXQA 5FE1A 4C8QD 2HDAA 1U1SA 3DLLA 1RL2A 1JJ2S 2YXYA 4QEUA 2XICA 3CCEQ 5IBNA 1Q86U 1PCXA 2QQ9A 3WVDB 5ENJA 5CUGA 4Z1QA 2DBMA 1YJWA 1PRMC 4M75A 1WJRA 2MI6A 2O01E 2DL3A 3RMQA 3J7AF 2A0FB 2YT6A 2YEMA 4KULA 1Q7YR 4C0FA 4X34A 4PJOE 1BIBA 1GFCA 2ROLA 4HCBA 2F5KA 5J39A 3L1AA 1QMCA 4LZ2A 2AHJB 3NMZC 2PVGB 1S72Q 4BB7A 1MHNA 5KYYA 2JTFA 4M78F 4OMLA 2P4RA 3CCVT 5IGKA 1WDXA 5KH6A 1Z9ZA 2I8NA 1WHMA 3OB9A 4NR7A 1FYNA 3X24B 2YDWA 2FZGB 3LLRA 3OYEA 2XI9A 4F7UA 1VQOQ 3KBGA 1XTDA 1ZLMA 4QYLA 1W1FA 2HQHA 3G6ET 3OW2P 2IVWA 2M0OA 1AWJA 3OYCA 1HSQA 4OF1A 3ZL7C 4UC4A 3S3NA 2RPNA 2OTJA 4M78C 1TOVA 3SVFA 1TSFA 5E73A 1N8RU 3EHRA 5CQTA 4AI6A 1PHTA 2DL4A 2LNHB 2HQEA 1VQ9T 2D0QB 3QZ9B 3MO8A 2KRSA 2X3XD 1OQKA 4A4GA 2AZSA 1OU9A 2FYKA 3JCMe 2YSQA 4C92F 1YITQ 5HRWA 2KT1A 1P92A 4XK8E 5BT3A 5F5ZA 5HRVA 3D7CA 1Y7XA 2EYXA 4BW3A 5GMKl 3JCMP 2CP7A 5H85A 5DLXA 1WQWA 3CC4Q 4YH3A 3PGGA 4JJNK 4M77G 5GAN7 5CFWA 5A0DA 3EFRA 1YJNT 4QQDA 3BE3A 1WHHA 1YP5A 1OZ3A 3A8GB 3OS2A 4C92C 1V1CA 2WSEE 2DXBA 4OUFA 3C12A 3V8KA 1RAFB 3FJPA 2CP0A 2DVEA 4O7AA 3SWNB 4QW2A 3MJXA 5EWHA 4MDWA 2CP2A 1KIKA 1M8VA 4YBTA 2CUDA 4IURA 4GPJA 1KQSA 4A9MA 2JUFA 1GL5A 4QSTA 1M9SA 5I21A 5L99A 2LJ0A 4O76A 4MDXA 5I22A 4O7FA 4EMHA 3OYDA 3EFOB 2HZYA 3MPUB 2X4YA 4GY5A 1YWOA 1YI2A 2PU9B 2QEXA 3SEMA 4OMQA 3JCMc 1EQFA 3VYHB 2YRDA 2JNGA 4IR6A 5FWCA 1U06A 4HBWA 5C85A 3H9NA 4N0AA 2PVOB 2RD1A 4KRTA 3A5ZB 1PWTA 1KQSS 3CCET 4O74A 1VQMA 5CQAA 4FSXA 3S3MA 1N27A 5D6YA 2J6FA 5LKZA 5GAMd 4BW1A 5A5SA 5KCHA 2DZCA 3E19A 5HENA 2JJ9A 4M7AF 5D6XA 2QI2A 5CRMA 3LH5A 2R0SA 3DKMA 1RABB 4MEQA 1R0BG 3O5ZA 1S72T 5IG6A 2EGEA 3G4SA 4A9OA 5DYUA 3QHSA 2D82A 2EYWA 1QCNA 3RBBB 1M30A 3M58A 1UDLA 1PG5B 2D6FA 2XK0A 3JVLA 5LJ5e 4MENA 1M1KR 2KXCA 2VXFA 3CPWA 2XG8D 4IOOA 2KMTA 2PQWA 2L8DA 2GFAA 1VQOT 4QVDA 3DB3A 4ZW1A 3UV4A 1M8MA 3LGLA 4C8QE 3E1SA 1BBZA 4AFSC 3JVKA 1IGUA 3HMFA 5E9MA 1M1GA 1U1TA 2XKOC 4IUQA 4J9FA 3HMHA 1AHJB 1PSEA 1AOJA 2DF6A 5KYWA 1PNJA 3G0JA 3MEAA 4CC7A 5K29A 4PCIA 2RN8A 4B6MA 5CQYA 3CPWS 2CYZB 2I2LA 3QBYA 3BDUA 5C0MA 2DWWA 4Z02A 1MMNA 2GNCA 1YITT 5FFYA 1NZ9A 2E4HA 1K73U 4QZSA 1M3CA 4QB3A 2RI7A 5E9VA 1UTIA 2EIFA 2HMAA 5KO4A 2OX7A 5J26A 2HEQA 3SVHA 5IN1A 3MXFA 2M02A 3IQLA 5DX4A 1UHFA 4NR4A 3CPFA 3MKDA 4TZ2A 2D0NA 1FMKA 4HBVA 4M77B 4HKEA 3CC4T 1UGSB 2FHDA 3A1PA 5EV9A 2SEMA 2QDLA 4F7UF 3WVEB 1C6VX 2A08A 2LCCA 1FMVA 2V1QA 2DA9A 1MMGA 2HSEB 1KQSP 3QG1A 1BU1A 5F1HA 5ETDA 1VA7A 2AZVA 1IZ6A 1YJWQ 3PT9A 4NS5A 4LYSA 1XOVA 4XY9A 3OBYA 2W0ZA 2DX1A 4TZ8A 4C0DB 4E6RA 2QASA 4VUBA 1W2BA 4Z89A 1BB9A 4M7AG 2NUTB 4N4FA 3OYJA 1X6BA 1M90R 4LUDA 3JVMA 2LVMA 3L42A 4CI0C 4O71A 1K76A 5AYFA 2CT3A 5I2MA 3VS3A 3FJ5A 4BE2A 5FG4A 4YC9A 2RQRA 2VWFA 1K0XA 1R0CB 4M78B 5CIUA 1DJ7B 1R8OB 2CUBA 4FCYA 4EPCA 1G5VA 3L2ZA 2RQVA 1KJWA 3EG9A 4XU2A 5CR2A 2HNIA 5CKFA 2DVRA 5D0CA 5EPBA 2YQDA 2EPDA 2FRWA 4DEYA 2EJFA 4OGIA 1UGPB 5AT1B 3OY9A 3K2JA 3GG3A 4LRGA 5D7UA 2BKDN 2EQUA 4LC2A 3I55A 2FEIA 2R0VA 4EDUA 5EI4A 4J1PA 2OTJQ 4ZGEB 4PLLA 2XHCA 1U5SA 4PLIA 2JM8A 4M75G 2ABLA 1OI1A 3D1BA 3DWYA 4V2SA 3LWIA 4FYXB 3URGA 2ZPIB 2R10A 3QJ6A 2DD5A 4QBMA 4J9BA 2KDSA 1QCFA 2QXFA 1ZQ1A 2X9HA 3U5KA 2X4XA 3P8HA 3CPWP 5GAN4 5EK9A 4L59A 3IU5A 3EFSA 5GAMg 4C92B 3X25B 5FWBA 2QQSA 4WCIA 3H41A 1H641 5DLZA 3TLPA 3MP6A 1RAGB 2F2XA 3ER0A 5EM3A 5II1A 2MF2A 1UE9A 2AKLA 4AFUC 1Y07A 5ENIA 1M4ZA 4AFZC 3LJWA 4AT1B 2YYNA 9ATCB 2JW4A 5LJ3e 2P0KA 3CBPA 4XTYA 2RQUA 4A9JA 2LQ8A 1N9RA 3EG3A 4C0GA 2DTIA 3UATA 5D3SA 2DLPA 4MR6A 2DKWA 2JXBA 5F3AA 3TU4K 3VS4A 2DATA 2EGAA 1HYOA 3ZFJA 3M0PA 4PS5A 3M5AA 1I4K1 4CLBA 5KHMA 3BY7A 2PUKB 2V8JA 5IIDA 5GANg 2KRMA 1H8KA 4JRPA 2ED1A 4AKHA 1Q81C 4A54A 3FDRA 3OYAA 5BT5A 4XY8A 4ZGJB 2GTOA 3CD6A 1Q82U 2GFUA 3P1EA 4HVWA 5GAMh 4BDYA 1PD0A 2K79A 1KHCA 5GAMj 4MEOA 1YI2Q 4HCCA 2KYBA 2IPOB 2CREA 3OA6A 5CGPA 1OV3A 4IIMA 2EGCA 4KBMB 2EBPA 4IORA 5GAMf 3CCUQ 3A98A 4YY6A 5H1UA 1KC8U 1VQMQ 4O77A 1W2BP 3H0FA 5IGLA 2RS9B 5KCOA 3JCMb 4XUBA 1YJWT 1T0HA 4QQGA 3OYLA 4MR3A 2DXTA 4M77D 2R5AA 1BI1A 4F04B 3QKJA 4M7AB 5CKHA 5GAOm 4Z93A 2C06A 1EFNA 4QEVA 5A7CA 2DIQA 2EYZA 4RVRA 5FE7A 4OB2B 2BZYA 5GANj 3GNFB 1WXTA 2DBKA 5FROA 2DJZA 4AKIA 1VQ5A 2G3RA 1G2BA 4NOYA 1E6GA 1ZA1B 3G4SQ 1OULA 3VRYA 2LCLA 1JB0E 1G83A 4FYWB 1NPPA 3OMCA 3S92A 3L2UA 4HBXA 3JB9F 1NE8A 4J9IA 3LQJA 3TEEA 2NUPA 3REAB 1ACMB 3LXJA 5LVRA 1Q81R 1Q7YU 4MEPA 1WHJA 4KGVB 2RF0A 4QY4A 2RJDA 2ZPEB 5FH8A 1LCKA 4IUTA 5GMKh 4XU1A 5GMKj 3RNJA 4NR8A 1TWBA 4M78D 4QSUA 2DPPB 3VV0A 2CDTA 2DVJA 2OTJT 5HK3A 4M75B 2V8KA 4FIBA 1M1FA 2SRCA 1G3WA 1M2VA 3MCAB 1EIFA 2Z0WA 1JXOA 4Q0OA 4QSPA 1WFWA 3I56A 3INZA 3QUIA 5HQ6A 4PL6A 3I35A 3OYBA 2LP5A 2HCKA 2KI7A 5C4QA 3OYIA 4JRQA 3VS5A 1M2OA 3NTHA 1J3TA 3CCMA 1K4US 4HXRA 3V8LA 1UEBA 5A5QA 1Y57A 1N9SA 3OYMA 5KYYB 1RAHB 4F16A 4BY6C 5G4RA 1JSPB 2X51A 3CCJA 1KD1R 5I86A 2RJFA 2RNAA 4EMKA 3QJYA 5CK9A 5FE2A 3JCMg 3OSVA 1RAAB 4MZTA 4NR9A 1EX4A 2QAZA 3NHNA 2K5FA 1T0JA 2ECZA 4BI3A 3T9NA 4C92D 4JUVA 2E6ZA 5BT4A 2EJ9A 3G7ZA 1I5LA 1VIFA 4BI4A 1IXDA 2OTLA 4F3IA 2GQIA 7AT1B 2EKOA 4YYHA 5ENFA 4FSSA 2Y4YA 4YAXA 5EICA 2QA4A 3JAME 4FL6A 2RM4A 3R6NA 2JOYA 2B8AA 3M59A 1V29B 3GLXA 5FG5A 2L84A 1ZUYA 3LH0A 3CBMA 1K9MR 2K9GA 2E7NA 4YY4A 5C87A 1LNXA 4J3IA 1SG5A 2YWWA 3TSWA 8ATCB 5E0RA 4KUDK 2LT1A 2C0OA 4RKUE 1WUGA 2F6JA 2JS2A 4J9DA 5FU7C 3GNGA 1KSWA 1WIEA 3VKHA 4KH0B 1MMDA 4E2FB 1YI2T 4M7DE 3ASKA 4ALGA 5FE9A 3HFNA 5HM0A 2KBTA 4MR5A 1QLYA 1YBYA 2L3QA 3EG0A 1NYFA 1N72A 3QZTA 4TT2A 4DA4A 4A9KA 5LKXA 4PJOF 2C0TA 3JB9G 2RI2A 3CCLA 5CQ8A 3CCUT 1SSHA 1VQMT 1ZHIA 5D3LA 4L6V5 1H92A 5I11A 2DTHA 2G6FX 2ZGWA 4QR4A 3U5OA 2CT4A 3GBQA 1YNZA 5E7DA 3PIPA 3V7RA 1YCYA 1MV3A 3QDFA 6AT1B 3JCMf 2RHUA 2KNBB 4RTWA 3NXBA 2KY9A 4UIYA 4PK4A 3QO3A 4NR5A 3JSCA 1OX9A 2M0YA 2YUPA 1Y96A 3M4GA 2L0AA 4PJOC 2H3JA 4J5YA 4O5VA 3G4ST 1NJIC 1ZX6A 2V1RA 3MB3A 5FE4A 4CUUA 3I5SA 3P1FA 5EQ1A 4OMNA 1C0MA 4M7AD 5A5RA 3QYGB 5GMKm 3EH1A 4A4FA 2YUOA 1VYTA 2X3WD 2B86A 2RQTA 2F1LA 2JM9A 5D24A 1B3QA 3EGUA 1T3LA 1D0XA 5L8RE 2AK5A 4KGZB 4MR4A 3IU6A 3META 3GOXA 2KAFA 2DETA 4RCCA 3MHXA 5LKUA 1K9AA 1PKSA 2DXUA 2OUOA 5DFDA 3MEUA 4PFPA 3KXTA 2RJEA 5EVAA 2CP3A 4UYEA 4RTTA 5F25A 3SDZA 4M77E 4OB0B 1M1KU 1VQ6A 4OVAA 1JEGA 3ERRA 2R0YA 4QSRA 2YELA 4YBMA 3O33A 2EKHA 5GAN5 4IIOA 4M75D 2M16A 4XQ3A 3CD6Q 4HBYA 3M55A 3CMAA 2JS0A 5L97A 4QC1A 2L89A 4RTZA 1PC0A 5CU8A 1G8XA 1RI9A 1SRMA 4ATOA 3SHWA 4N4HA 1VOMA 2EAYA 3UDCA 3AHUA 4BI8B 1I07A 2LQKA 4A9NA 5I1QA 4NUCA 1NJIR 5FE8A 4B9XA 4C5HA 2BE7D 4J9HA 4JS5A 3RMSA 2RHXA 2P0QA 2I0NA 4DONA 2DEQA 2K7AA 2K5IA 4PJLA 4O75A 5I80A 3C95A 3EAEA 4ELZC 2KVQG 5KYWB 1GXIE 2FSAA 1GFDA 1X69A 3VS1A 4B9WA 2DRKA 3HP9A 4RTUA 4QUTA 4JJCA 5KYNA 4UYHA 3L2WA 4XUAA
chains in the Genus database with same CATH topology
5CUDA 1D3BA 2WP1A 4HXOA 3H6ZA 2RJCA 1UGRB 3OYNA 4UYGA 3X28B 4A9LA 2YW5A 4X2IA 4O7CA 3RESA 5HJCA 3CXCA 2HAXA 5D7XA 1M90U 4YBSA 3M56A 4M78G 1WNLA 2E10A 5A0LA 1KQ2A 1UB4A 4FU6A 3MEWA 5J0DA 2PUOB 2E5QA 4EMKC 2E41A 1H3ZA 4XTVA 4Z6HA 3ONIA 5FE0A 4NR6A 4XU3A 3CXCS 3OYFA 4HCZA 4JLGA 5I83A 5CPEA 3BDLA 3Q2EA 5EPSA 2MAMA 4HXMA 1FXXA 3MUKA 5HKCA 3OS1A 3UVXA 4C92G 4UIZA 2EWNA 3OSSC 4CUTA 4ZN3A 4C8QC 4LYIA 5KTXA 5GANd 1I81A 5E9KA 3SFMA 5DFCA 3ZYUA 5AMEA 4A53A 1K8AC 1BI2A 4LDXA 3JCMQ 2RI3A 4BJXA 2LNVA 5CO7A 4Z6IA 5FH6A 5HEMA 4LD9K 5HQ7A 4QSXA 1BI0A 2CS7A 4ME7A 3OYYA 4II1A 1VUBA 3FIFA 3CD6T 4ZTFA 1YJ9A 4WIVA 3OBWA 4BW2A 3OYHA 2XDBA 4QC3A 4NQNA 4BHWA 4M7AE 3MP1A 5ENGA 5CUEA 2JVVA 4HXNA 4PKLA 4ALHA 2GCXA 5LVQA 4FT2A 5COIA 4J6WA 4YYNA 2VYTA 2F6NA 3UVWA 5ACYA 5DBMA 5E9YA 2GRCA 5CQ3A 5CUBA 4BW4A 5LJ2A 1BIAA 4A4HA 3M4YA 2NLUA 4HT8A 5HFQA 3QXEB 2YLBA 3JB9H 4O7EA 3JCMV 4M75E 4LZSA 5FE3A 2Y90A 5DM7R 3QPHA 4D6WA 1KQ1A 1X6OA 4QSVA 5GAN3 2RO0A 1PSFA 4CUSA 5GAN6 4MZPA 1QVPA 5F36A 4M7DA 1VQLT 3JB9D 4AKNA 4KV4A 1W2BS 1ZBXA 4DQ2A 5E9IA 3HL8A 2F69A 4CFLA 3J81E 3U5JA 4O72A 5CAIA 4J7IA 1VQ8A 3UV2A 5A5NA 3FEOA 1QVFA 3CCMT 1Q81U 2GQVA 4IR5A 2LT4A 1UGQB 4E7IA 4YTLA 4C67A 4R55A 3JCMd 2X35A 3CCJT 4YABA 3RUXA 5IGNA 3QZVA 3P5OA 3A8OB 4C0ZA 3M9QA 5F2PA 1VQKA 4KCXA 2OTLT 2FL7A 3CCEA 1QVFS 4NYWA 4PJOA 2QA4T 3LGFA 3G0LA 3L2RA 4WF2A 5D6WA 3A8HB 5C6SA 1KHIA 2DZ9A 5DY7A 1KD1U 4F7UG 2QQAA 1X0JA 2CZ0B 3LQHA 2DIGA 1XNIA 4E7JA 5FLXE 4NRBA 3I3JA 2BUDA 3CC2A 4IKFA 1VQNA 3MEVA 3V7CA 4XTXA 3HRTA 5CQ4A 4RMOA 2KK4A 2RHYA 5A2QE 3X20B 4EMKB 3CCLT 2DXCA 3UVYA 3LW5E 2DKGA 5F60A 1K9MU 5EWDA 4N3WA 2CZ6B 5FE6A 4XTZA 3ME9A 5FDZA 4N4GA 3CCQA 4L5GA 3CBOA 3JCMW 2KQWA 3JB9J 4CUQA 3UV5A 2QDYB 2ZCFB 5L8UA 1YHQA 4PCEA 2RO1A 3CCSA 5CTLA 3CEYA 5EU1A 4OMFB 1YITA 5M9OA 5GANh 4JS4A 2XDDA 4DOVA 3QZ5B 3LYIA 1OZ2A 2EYQA 3FLGA 4UIVA 4J6YA 1VQPA 1O9SA 5LJ5d 5GANf 3CC4A 4ZTJA 4BD3A 3VUZA 1F68A 4OP0A 3CC7A 2G4AA 2VGNA 4X9CA 3PTAA 2GF7A 2K2VA 2DVVA 2O4XA 4J0SA 4TT4A 1KG1A 5FE5A 2OAUA 1VQ6T 4QUUA 2CZ1B 2EQJA 4FM4B 4FLPA 4QEWA 4IOQA 2RA2A 4E7HA 1G3TA 4A4KA 3QSUA 3CMAT 4JRKA 4HT9A 1VQ4A 4YATA 2YLCA 1VQ7A 2RH2A 3G71A 4TS8A 1KC8C 2DVQA 3VYGA 3FKMX 5AMFA 4C5IA 5LKTA 2QQBA 4YYKA 3FB9A 3V7SA 3C4SA 2BIVA 2P4TA 5A83A 4M7DF 3OYGA 2N9GA 5GAOl 3M54A 1N6AA 4F7UB 1BYMA 5D3HA 1B34A 5FU6C 5LL6S 3QDRB 5GAMe 4HXSA 4QR5A 5II2A 1FX7A 3P8BB 1QP3A 5GMKi 3GIBA 4YYDA 3E9GA 5CCAA 3P1CA 1NJIU 5CQXA 5F61A 5CQ5A 4M7DC 5ENEA 2E64A 3BW1A 4C8QA 1Q7YC 2FB7A 4YYGA 3NTKA 2M1HA 2QEXT 5I88A 3MQMA 3RKXA 4QR3A 4Q0NA 5CRZA 4OGCA 4OB1B 2RI5A 3JCMh 5D3RA 3Q2FA 5G4SA 4O6JA 3MP8A 5E74A 4O70A 4JLIA 3MB4A 1LOJA 5GAN2 3HHTB 2RK1A 5LJ1A 3HFOA 4NRCA 1WUMA 5L98A 3CMEA 1Y71A 4QVZA 4O7BA 2VGMA 5GMKe 1D3BB 4XTWA 3HRUA 4M77F 2LTOA 5L96A 2DO3A 5CZGA 4KT0E 5FB1A 2E65A 5LJ3d 2E70A 4QQ6A 2WACA 4WHWA 2A7YA 3OS5A 3AADA 4IR4A 4M7DG 4BACA 3P1DA 4UYDA 5LJ5g 3CCRA 5C89A 4ZN1A 4XU0A 4LDYA 4QSSA 4M77C 5JI8A 3U5PA 2JTMA 1YJ9T 2A3LA 1X75C 1QP2A 2Y4XA 4IUPA 4C0DC 1JBMA 5D3PA 3V8JA 3DB4A 2L3RA 4UYFA 2X4JA 4ZQLA 2E12A 4KV1A 1QW1A 1Q86C 3GP8A 4PJOG 4Q5WA 3GF5A 3RCWA 4C66A 5LJ5h 5LJ5j 4M78E 5EWWA 4HXLA 3PFSA 5LJ5f 4ZGDB 2E1HA 3S6WA 3U5NA 2RHIA 2KTBB 3JCMJ 2DTOA 5A5OA 1M5Q1 5E3DA 5DW2A 3OQ5A 3ZBDA 4MMLA 5EG2A 4J0RA 2XIDA 2EJGA 3HSBA 5D3NA 5KTUA 5FB0A 2X4WA 5I7XA 4YH4A 5DYXA 1U8RA 5D26A 1M1KC 4NL3A 1VQ8T 2QQRA 1K8AU 5JWMA 2ZPFB 5GAOn 4C92E 2CGHA 3I55T 5F1LA 3NTIA 4BY6B 1N8RC 2YHTA 5C7NA 5KU3A 1E6IA 5I29A 5EISA 4LYWA 5GAOp 3AQAA 5CKDA 5FU6B 4C8QF 4OB3B 4HXKA 1JRIA 5EGUA 3VU3C 4Y03A 1YIJA 1VQKT 5EWVA 1O75A 3CCUA 4FT4A 4TYLA 2LDMA 4NUDA 3UPUA 4XYAA 2LC4A 3BFMA 1X01A 4M7DB 5DYAA 5A81A 4RCBA 1TH7A 5IT9E 4RG2A 5FU7B 3O8VA 2KSSA 5ETBA 4LD6A 2DK3A 5IAYA 5DLOA 5I7YA 3LX7A 2K5LA 4X9DA 5HLSA 3ZEHA 5LJ3g 1I8FA 4C5EA 5CUCA 2HQXA 3CC2T 1VQNT 4E96A 4KUIA 3L2VA 4A9HA 5FFWA 4YYJA 3RKWA 3H8ZA 3VJPA 5GAOq 1NPRA 3RERA 5A85A 4M7AC 2DVSA 3LQIA 2WSFE 3OYKA 1M90C 2P0PA 5DY9A 5E9LA 4ELYC 5LUUA 4UITA 4LDUA 2MWPA 2RB6A 4IUVA 3CCVA 2F5TX 5A0GA 1XQHA 3CCQT 2LSPB 5D25A 5CY9A 5CKEA 4PJOB 4M75F 3O37A 3JRZA 2MWOA 5CUAA 2ZZDA 2QTXA 3G6EA 1YHQT 3CCST 4E7LA 1SSFA 4LDVA 2D9TA 3SWNA 5LJ3h 5EP7A 5LJ3j 4CURA 2E7OA 4LR6A 2MJVB 1VQ5T 1VQ9A 4J6XA 4QSQA 2PVDB 4M75C 5HFRA 3FRNA 1VQPT 5LJ3f 2CKKA 3SB2A 4WHUA 5FG6A 4C8QG 5CP5A 3Q1JA 3CC7T 4N4IA 4EMGA 1W4SA 1JM4B 3C94A 2EQMA 3GPLA 3UT1A 1YJNA 5HY6A 1WJSA 2XDPA 4TTEA 2RNWA 4TT6A 3SD4A 3I56T 1VQ4T 3DAIA 4XTUA 4UIWA 3S91A 3QZSA 4E47A 2R57A 2DD4A 2LRQA 1K73C 4TU4A 1VQ7T 2L5EA 2OSSA 4F7UE 5ENBA 3G71T 2K4YA 3A8MB 4YADA 4YK0A 2K3YA 1HK9A 4IR3A 2XD0A 5DFBA 3SVGA 2K3XA 5H1TA 2ZPHB 5FRNA 3NFCA 3O36A 5L8TA 3HMEA 1VIEA 4JRIA 5GAN8 3PMTA 4TU6A 5C8GA 4QVCA 3UW9A 1MGQA 5D3JA 5DW1A 5HRXA 4A9FA 2WP2A 4MZMA 5D3TA 3F70A 2O4XB 2HD0A 4DOWA 3L2QA 4MMKA 3LWHA 2FVUA 4PY6A 4M7DD 4O78A 5F62A 3U5LA 5IGMA 4OGJA 3MULA 3S3OA 4Y91A 4QNSA 3N5BB 3P8DA 4NYXA 1S72A 5J3BA 4OGEA 3PIOA 5TCMA 1WQ7A 2ZPGB 4M77A 3PNWC 5FH7A 5HCLA 5TB6A 1BI3A 5AD2A 4HA8A 2ZPBB 1VQOA 4CUPA 1OYXA 2YRVA 1RI0A 5EWCA 1B34B 1QVGA 5FBXA 4P5NA 2VV5A 2OO1A 3CMET 5AD3A 4N0AC 4PJOD 5HQ5A 5CS8A 2K57A 4JDSA 4TVRA 2M9UA 5FFVA 2RHZA 4A4EA 2XU8A 3OS0A 4HXPA 4BE0A 1G3YA 4LDWA 4GLKA 4C8QB 3UVDA 4YYMA 3VKIA 5LJ0A 4C5GA 2VUBA 3JVJA 4BUGA 3A8LB 4M78A 3WXMB 4CL9A 1QVGS 4UIUA 4A9IA 1IREB 2RFJA 5F63A 2JZ2A 5DKHA 5EA1A 5ENHA 4IUUA 5A82A 4E7KA 5DKDA 1KD1C 3CCRT 3UWNA 4BDZA 3TREA 5KTWA 2RNXA 5KE2A 4RG8A 4QYDA 2D9EA 2LX9A 3O34A 5CQ7A 5DKCA 1Y96B 2R5MA 3R6OA 3M53A 5CKBA 3X26B 3FC3A 1Q82C 3M57A 1K9MC 4Y28E 4PNOA 3TCJA 4C92A 5I2SA 3QIIA 4ZC9A 2HBPA 3RIRA 3SWNC 3KUFA 4XAXB 5CVIA 5DYCA 3DLMA 1ZS5A 5GAOr 1VQLA 4NYVA 3VUBA 4J8OA 2RK2A 4Z1SA 5ENCA 4J83A 5E3GA 2EQKA 2I7KA 4J7FA 2WSCE 2R58A 5HK0A 2H60A 4TQNA 3O35A 4CFKA 3OW2A 3PMIA 4LZRA 5A5PA 4NUEA 2YEKA 4CRIA 3E9FA 5FRMA 5HELA 1WGSA 2RNYA 4PKCC 2EFIA 1WJQA 2L5QA 2L85A 4NRAA 4LDFA 3OMGA 2DAQA 3J80E 4UYFB 4PTBA 2VXEA 4NQMA 4YYIA 4A9EA 3QYHB 4NXJA 2IG0A 4R56A 2NXBA 3OW2S 3HRSA 2E6NA 3RKYA 2MMPA 5GANe 3JCMX 5KE3A 1G3SA 4BE1A 5CQ6A 4UIXA 3HKSA 1LJOA 4M7AA 1FWZA 2CZ7B 1JJ2A 3U5MA 4NL2A 1HXDA 5I89A 5H1VA 2E3KA 5EPRA 3HPWA 2V8IA 1YIJT 1BKBA 5DLQE 4QSWA 1WPYA 2VC8A 5I40A 3JB9I 2JN0A 5FE1A 4C8QD 1U1SA 3DLLA 1RL2A 1JJ2S 4QEUA 2XICA 5IBNA 1Q86U 2QQ9A 3WVDB 5ENJA 5CUGA 4Z1QA 1YJWA 4M75A 1WJRA 2MI6A 2O01E 3RMQA 3J7AF 2YEMA 4KULA 4C0FA 4X34A 4PJOE 1BIBA 4HCBA 2F5KA 5J39A 3L1AA 4LZ2A 2AHJB 2PVGB 4BB7A 1MHNA 2JTFA 4M78F 3CCVT 5IGKA 5KH6A 2I8NA 3OB9A 4NR7A 3X24B 2YDWA 3LLRA 3OYEA 2XI9A 4F7UA 3KBGA 1XTDA 4QYLA 3G6ET 2IVWA 2M0OA 3OYCA 4OF1A 4UC4A 3S3NA 2OTJA 4M78C 3SVFA 5E73A 1N8RU 5CQTA 2HQEA 1VQ9T 2D0QB 3QZ9B 3MO8A 4A4GA 2FYKA 3JCMe 4C92F 5HRWA 1P92A 4XK8E 5BT3A 5F5ZA 5HRVA 3D7CA 1Y7XA 4BW3A 5GMKl 3JCMP 5H85A 5DLXA 1WQWA 4JJNK 4YH3A 3PGGA 4M77G 5GAN7 5CFWA 5A0DA 3EFRA 1YJNT 4QQDA 1OZ3A 3A8GB 3OS2A 4C92C 2WSEE 2DXBA 4OUFA 3C12A 3V8KA 3FJPA 2DVEA 4O7AA 3SWNB 4QW2A 5EWHA 4MDWA 1M8VA 4YBTA 4IURA 4GPJA 1KQSA 4A9MA 2JUFA 4QSTA 1M9SA 5I21A 5L99A 4O76A 4MDXA 4O7FA 4EMHA 3OYDA 2X4YA 4GY5A 1YI2A 2PU9B 2QEXA 3JCMc 1EQFA 3VYHB 2JNGA 4IR6A 4HBWA 5C85A 4N0AA 2PVOB 2RD1A 3A5ZB 1KQSS 3CCET 4O74A 1VQMA 5CQAA 4FSXA 3S3MA 1N27A 5D6YA 5LKZA 5GAMd 4BW1A 5A5SA 5KCHA 2DZCA 3E19A 5HENA 4M7AF 5D6XA 2QI2A 5CRMA 2R0SA 3DKMA 4MEQA 1S72T 5IG6A 3G4SA 4A9OA 5DYUA 3QHSA 2D82A 3M58A 2D6FA 2XK0A 3JVLA 5LJ5e 4MENA 2VXFA 3CPWA 2XG8D 4IOOA 2KMTA 2PQWA 2L8DA 2GFAA 1VQOT 4QVDA 3DB3A 4ZW1A 3UV4A 3LGLA 4C8QE 3E1SA 3JVKA 3HMFA 5E9MA 1M1GA 1U1TA 2XKOC 4IUQA 3HMHA 1AHJB 1PSEA 3G0JA 3MEAA 5K29A 4PCIA 5CQYA 3CPWS 2CYZB 2I2LA 3QBYA 3BDUA 5C0MA 2DWWA 4Z02A 1YITT 5FFYA 1NZ9A 1K73U 4QZSA 4QB3A 2RI7A 5E9VA 2EIFA 5KO4A 5J26A 5IN1A 3SVHA 3MXFA 5DX4A 4NR4A 3CPFA 4TZ2A 4HBVA 4M77B 4HKEA 3CC4T 1UGSB 2FHDA 5EV9A 4F7UF 3WVEB 2LCCA 3QG1A 5F1HA 5ETDA 1IZ6A 3PT9A 4NS5A 4LYSA 1XOVA 4XY9A 3OBYA 4TZ8A 4C0DB 1W2BA 4VUBA 4M7AG 4N4FA 3OYJA 3JVMA 2LVMA 3L42A 4CI0C 4O71A 5AYFA 5I2MA 4BE2A 5FG4A 4YC9A 4M78B 5CIUA 1DJ7B 1R8OB 4EPCA 1G5VA 3L2ZA 4XU2A 5CR2A 2HNIA 5CKFA 2DVRA 5D0CA 5EPBA 2YQDA 2EJFA 4OGIA 1UGPB 3OY9A 3K2JA 3GG3A 4LRGA 2BKDN 2EQUA 4LC2A 3I55A 2R0VA 4EDUA 5EI4A 4J1PA 4ZGEB 4PLLA 2XHCA 4PLIA 4M75G 1OI1A 3DWYA 4V2SA 3LWIA 3URGA 2ZPIB 2R10A 3QJ6A 2DD5A 4QBMA 2KDSA 2QXFA 1ZQ1A 3U5KA 2X4XA 3P8HA 5GAN4 5EK9A 4L59A 3IU5A 3EFSA 5GAMg 4C92B 3X25B 2QQSA 1H641 5DLZA 3TLPA 3MP6A 3ER0A 5EM3A 5II1A 2MF2A 1Y07A 5ENIA 1M4ZA 3LJWA 2YYNA 5LJ3e 2P0KA 3CBPA 4XTYA 4A9JA 2LQ8A 1N9RA 4C0GA 2DTIA 5D3SA 4MR6A 2DKWA 5F3AA 3TU4K 2DATA 3ZFJA 4PS5A 3M5AA 1I4K1 4CLBA 5KHMA 3BY7A 2PUKB 2V8JA 5IIDA 5GANg 4JRPA 1Q81C 4A54A 3FDRA 3OYAA 5BT5A 4XY8A 4ZGJB 3CD6A 1Q82U 2GFUA 3P1EA 5GAMh 4BDYA 5GAMj 1KHCA 4HCCA 4MEOA 3OA6A 5CGPA 4KBMB 4IORA 5GAMf 4YY6A 5H1UA 1KC8U 4O77A 5IGLA 2RS9B 5KCOA 3JCMb 4XUBA 1YJWT 4QQGA 3OYLA 4MR3A 2DXTA 4M77D 2R5AA 1BI1A 3QKJA 4M7AB 5CKHA 5GAOm 4Z93A 2C06A 4QEVA 5A7CA 2DIQA 4RVRA 5FE7A 4OB2B 5GANj 3GNFB 5FROA 2DJZA 1VQ5A 2G3RA 4NOYA 2LCLA 1JB0E 1NPPA 3OMCA 3S92A 3L2UA 4HBXA 3JB9F 1NE8A 3LQJA 3TEEA 3LXJA 5LVRA 1Q7YU 4MEPA 4QY4A 2RJDA 2ZPEB 5FH8A 4IUTA 5GMKh 4XU1A 5GMKj 4NR8A 4M78D 4QSUA 2DPPB 3VV0A 2OTJT 5HK3A 4M75B 2V8KA 4FIBA 1M1FA 1G3WA 3MCAB 1EIFA 4Q0OA 4QSPA 3I56A 3INZA 3QUIA 5HQ6A 4PL6A 3OYBA 3OYIA 4JRQA 5C4QA 3NTHA 3CCMA 4HXRA 3V8LA 1UEBA 5A5QA 1N9SA 3OYMA 4BY6C 5G4RA 1JSPB 3CCJA 5I86A 2RJFA 4EMKA 3QJYA 5CK9A 5FE2A 3JCMg 3OSVA 4MZTA 4NR9A 2K5FA 4BI3A 3T9NA 4C92D 4JUVA 2E6ZA 5BT4A 2EJ9A 3G7ZA 1I5LA 1VIFA 4BI4A 2OTLA 4F3IA 2EKOA 4YYHA 5ENFA 2Y4YA 4YAXA 5EICA 2QA4A 3JAME 4FL6A 2RM4A 2JOYA 2B8AA 3M59A 1V29B 3GLXA 5FG5A 2L84A 3LH0A 3CBMA 2E7NA 4YY4A 5C87A 1LNXA 4J3IA 5E0RA 4KUDK 2LT1A 4RKUE 1WUGA 2F6JA 5FU7C 3GNGA 1YI2T 4M7DE 3ASKA 4ALGA 5FE9A 3HFNA 5HM0A 4MR5A 1YBYA 1N72A 3QZTA 4TT2A 4DA4A 4A9KA 5LKXA 4PJOF 3JB9G 2RI2A 3CCLA 5CQ8A 3CCUT 1VQMT 1ZHIA 5D3LA 4L6V5 2DTHA 2ZGWA 4QR4A 3U5OA 5E7DA 3PIPA 3V7RA 1YCYA 3JCMf 2RHUA 3NXBA 2KY9A 4UIYA 3QO3A 4NR5A 3JSCA 1Y96A 3M4GA 4PJOC 2H3JA 4J5YA 4O5VA 3G4ST 1NJIC 3MB3A 5FE4A 4CUUA 3P1FA 5EQ1A 4M7AD 5A5RA 3QYGB 5GMKm 4A4FA 5D24A 5L8RE 4MR4A 3IU6A 3META 3GOXA 2KAFA 4RCCA 3MHXA 5LKUA 2DXUA 2OUOA 5DFDA 3MEUA 3KXTA 2RJEA 5EVAA 4UYEA 5F25A 3SDZA 4M77E 4OB0B 1M1KU 1VQ6A 4OVAA 2R0YA 4QSRA 2YELA 4YBMA 3O33A 5GAN5 4M75D 4XQ3A 2M16A 4HBYA 3M55A 3CMAA 5L97A 4QC1A 2L89A 5CU8A 4ATOA 4N4HA 2EAYA 3UDCA 3AHUA 4BI8B 2LQKA 4A9NA 5I1QA 4NUCA 5FE8A 4B9XA 4C5HA 4JS5A 3RMSA 2RHXA 2P0QA 4DONA 2DEQA 2K5IA 4O75A 5I80A 3C95A 3EAEA 4ELZC 2KVQG 1GXIE 2FSAA 4B9WA 3HP9A 4QUTA 4UYHA 3L2WA 4XUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CUD A;  5D3R A;  3Q2F A;  5G4S A;  3MP8 A;  2WP1 A;  3UVD A;  4HXO A;  5ETD A;  5F1H A;  4YYM A;  5E74 A;  5LJ0 A;  3H6Z A;  4O70 A;  4C5G A;  3JVJ A;  3MB4 A;  2RJC A;  4NS5 A;  4LYS A;  4XY9 A;  3OYN A;  4UYG A;  4CL9 A;  4A9L A;  2YW5 A;  4TZ8 A;  4X2I A;  5LJ1 A;  4NRC A;  4UIU A;  4A9I A;  4O7C A;  1WUM A;  2RFJ A;  5L98 A;  5F63 A;  2JZ2 A;  5HJC A;  4N4F A;  5DKH A;  4QVZ A;  4O7B A;  3OYJ A;  5EA1 A;  3JVM A;  2LVM A;  3L42 A;  5D7X A;  5ENH A;  4O71 A;  4IUU A;  4YBS A;  5A82 A;  4E7K A;  5DKD A;  4BE2 A;  5FG4 A;  4YC9 A;  3UWN A;  4FU6 A;  2LTO A;  3MEW A;  4BDZ A;  5L96 A;  5CIU A;  5J0D A;  5KTW A;  2RNX A;  2E5Q A;  5KE2 A;  1H3Z A;  1G5V A;  4QYD A;  2D9E A;  5CZG A;  4Z6H A;  5FB1 A;  3ONI A;  3O34 A;  2DVR A;  5CQ7 A;  5DKC A;  5D0C A;  5EPB A;  2YQD A;  4NR6 A;  5FE0 A;  4QQ6 A;  3OYF A;  2WAC A;  4WHW A;  2R5M A;  4HCZ A;  5I83 A;  5CPE A;  3FC3 A;  3AAD A;  4OGI A;  3BDL A;  3OY9 A;  4IR4 A;  3K2J A;  3GG3 A;  4LRG A;  3P1D A;  4UYD A;  2BKD N;  2EQU A;  4BAC A;  4LC2 A;  2R0V A;  3Q2E A;  5EI4 A;  5C89 A;  5EPS A;  3QII A;  4J1P A;  4EDU A;  4QSS A;  4ZC9 A;  4PLL A;  4HXM A;  4PLI A;  1OI1 A;  3DWY A;  3MUK A;  5JI8 A;  3KUF A;  3OS1 A;  3U5P A;  3UVX A;  4UIZ A;  2R10 A;  3QJ6 A;  5DYC A;  3DLM A;  4QBM A;  1ZS5 A;  4CUT A;  3U5K A;  2X4X A;  3P8H A;  4LYI A;  5KTX A;  4NYV A;  4IUP A;  5E9K A;  5EK9 A;  5DFC A;  3IU5 A;  4L59 A;  4Z1S A;  3ZYU A;  5AME A;  2QQS A;  5ENC A;  5DLZ A;  3TLP A;  2RI3 A;  3MP6 A;  5D3P A;  4BJX A;  3DB4 A;  5EM3 A;  2L3R A;  5E3G A;  5II1 A;  2EQK A;  4Z6I A;  5FH6 A;  5HEM A;  4UYF A;  2I7K A;  5HQ7 A;  4QSX A;  2R58 A;  2H60 A;  5ENI A;  3LJW A;  4TQN A;  3O35 A;  4CFK A;  3PMI A;  2YYN A;  4LZR A;  4II1 A;  2P0K A;  5A5P A;  4NUE A;  4A9J A;  4ZTF A;  4ZQL A;  2YEK A;  4KV1 A;  4WIV A;  4CRI A;  3E9F A;  5FRM A;  5D3S A;  5HEL A;  4MR6 A;  1WGS A;  2DKW A;  2RNY A;  5F3A A;  4Q5W A;  4BW2 A;  2DAT A;  2EFI A;  3OYH A;  4PS5 A;  1WJQ A;  4QC3 A;  4NQN A;  2L85 A;  4BHW A;  3MP1 A;  4NRA A;  3RCW A;  4C66 A;  4CLB A;  5ENG A;  4LDF A;  5KHM A;  3OMG A;  5IID A;  2DAQ A;  4UYF B;  4PTB A;  5CUE A;  4NQM A;  5EWW A;  4YYI A;  4A9E A;  4NXJ A;  4HXN A;  2IG0 A;  4PKL A;  4ALH A;  3FDR A;  4HXL A;  3OYA A;  5BT5 A;  4XY8 A;  5LVQ A;  3PFS A;  2NXB A;  2E6N A;  5COI A;  5KE3 A;  3S6W A;  4YYN A;  2GFU A;  3P1E A;  3U5N A;  2RHI A;  2VYT A;  2F6N A;  4BDY A;  3UVW A;  4BE1 A;  5ACY A;  1KHC A;  5DBM A;  2KTB B;  2GRC A;  4MEO A;  5CQ6 A;  5E9Y A;  4UIX A;  5A5O A;  5CQ3 A;  3OA6 A;  5CGP A;  5CUB A;  5E3D A;  4BW4 A;  5LJ2 A;  5DW2 A;  3OQ5 A;  4A4H A;  4J0R A;  2NLU A;  4IOR A;  5D3N A;  4YY6 A;  5H1U A;  5KTU A;  5FB0 A;  5HFQ A;  2X4W A;  5I7X A;  3U5M A;  4O77 A;  4O7E A;  4YH4 A;  5IGL A;  2RS9 B;  5DYX A;  5KCO A;  5I89 A;  4XUB A;  5D26 A;  5H1V A;  2E3K A;  4QQG A;  5EPR A;  4LZS A;  3OYL A;  4MR3 A;  2R5A A;  5FE3 A;  2QQR A;  5JWM A;  4QSW A;  5F1L A;  3QKJ A;  3NTI A;  4Z93 A;  4QEV A;  5A7C A;  2DIQ A;  4RVR A;  5FE7 A;  5C7N A;  5I40 A;  5KU3 A;  1E6I A;  4QSV A;  5I29 A;  5EIS A;  2RO0 A;  5FRO A;  5FE1 A;  4CUS A;  2G3R A;  4LYW A;  5F36 A;  4QEU A;  3AQA A;  4AKN A;  4KV4 A;  5IBN A;  3OMC A;  5ENJ A;  5CUG A;  5E9I A;  3S92 A;  4HXK A;  3L2U A;  4HBX A;  4Z1Q A;  4CFL A;  5EGU A;  3U5J A;  1WJR A;  4O72 A;  4Y03 A;  5EWV A;  3LQJ A;  4TYL A;  2YEM A;  3UV2 A;  5A5N A;  2LDM A;  3FEO A;  3LXJ A;  5LVR A;  4NUD A;  4X34 A;  4MEP A;  4QY4 A;  4XYA A;  2RJD A;  5FH8 A;  4IUT A;  4IR5 A;  5DYA A;  5A81 A;  2F5K A;  4NR8 A;  5J39 A;  4E7I A;  4QSU A;  4RG2 A;  4C67 A;  4LZ2 A;  2X35 A;  3O8V A;  1MHN A;  5ETB A;  4LD6 A;  4YAB A;  2JTF A;  5IGN A;  5IAY A;  5I7Y A;  3LX7 A;  3QZV A;  3P5O A;  5IGK A;  5KH6 A;  5HLS A;  3ZEH A;  4Q0O A;  4QSP A;  2I8N A;  4C5E A;  3M9Q A;  5CUC A;  2HQX A;  4NR7 A;  5F2P A;  3OB9 A;  5HQ6 A;  4PL6 A;  4E96 A;  4KCX A;  2YDW A;  3OYB A;  3OYI A;  3L2V A;  4A9H A;  5C4Q A;  5FFW A;  3LLR A;  3NTH A;  4YYJ A;  3OYE A;  4NYW A;  3H8Z A;  2RI5 A;  4HXR A;  4QYL A;  5A5Q A;  3LGF A;  3OYM A;  2M0O A;  3G0L A;  5A85 A;  3OYC A;  2DVS A;  3LQI A;  3L2R A;  5D6W A;  5C6S A;  5G4R A;  3OYK A;  1JSP B;  5DY7 A;  4UC4 A;  5I86 A;  2RJF A;  3S3N A;  5E9L A;  1X0J A;  5FE2 A;  5LUU A;  3SVF A;  4UIT A;  5E73 A;  4NR9 A;  3LQH A;  5CQT A;  2DIG A;  1XNI A;  2MWP A;  4IUV A;  2HQE A;  4E7J A;  2LSP B;  5D25 A;  5CY9 A;  5BT4 A;  3MO8 A;  4A4G A;  3O37 A;  3I3J A;  4NRB A;  2BUD A;  4IKF A;  3MEV A;  2MWO A;  4F3I A;  2EKO A;  5CQ4 A;  4YYH A;  5ENF A;  5CUA A;  4YAX A;  5EIC A;  5HRW A;  4FL6 A;  5BT3 A;  5F5Z A;  5HRV A;  3D7C A;  2B8A A;  2RHY A;  4BW3 A;  5FG5 A;  3UVY A;  4E7L A;  2L84 A;  3LH0 A;  1SSF A;  2D9T A;  5F60 A;  5H85 A;  2E7N A;  4YY4 A;  5C87 A;  4J3I A;  5DLX A;  5EWD A;  4N3W A;  4YH3 A;  5E0R A;  5EP7 A;  4CUR A;  2E7O A;  4LR6 A;  5FE6 A;  2MJV B;  1WUG A;  2F6J A;  5FDZ A;  4N4G A;  3ME9 A;  5CFW A;  4QSQ A;  4QQD A;  5HFR A;  1OZ3 A;  3ASK A;  4ALG A;  5FE9 A;  5HM0 A;  3OS2 A;  4MR5 A;  4CUQ A;  2CKK A;  4OUF A;  4WHU A;  5FG6 A;  3UV5 A;  5CP5 A;  3Q1J A;  1N72 A;  3QZT A;  4TT2 A;  4O7A A;  4N4I A;  4A9K A;  5LKX A;  4QW2 A;  5L8U A;  5EWH A;  4PCE A;  2RO1 A;  2RI2 A;  5CQ8 A;  4YBT A;  5CTL A;  4IUR A;  4GPJ A;  4A9M A;  3CEY A;  4QST A;  5D3L A;  5EU1 A;  1JM4 B;  5M9O A;  4QR4 A;  3U5O A;  2EQM A;  5L99 A;  5E7D A;  4O76 A;  3LYI A;  3UT1 A;  4O7F A;  1OZ2 A;  3OYD A;  2RHU A;  1WJS A;  2X4Y A;  3FLG A;  4UIV A;  2XDP A;  3NXB A;  4TTE A;  4GY5 A;  4UIY A;  1EQF A;  4NR5 A;  4ZTJ A;  4BD3 A;  2RNW A;  4IR6 A;  1F68 A;  4TT6 A;  4HBW A;  5C85 A;  3SD4 A;  2G4A A;  3DAI A;  4UIW A;  3S91 A;  3QZS A;  3MB3 A;  2R57 A;  5FE4 A;  2LRQ A;  4CUU A;  4O74 A;  4TU4 A;  2GF7 A;  2L5E A;  3P1F A;  2DVV A;  5CQA A;  5EQ1 A;  2OSS A;  5ENB A;  3S3M A;  1N27 A;  4J0S A;  4TT4 A;  2O4X A;  5D6Y A;  5LKZ A;  4YAD A;  5A5R A;  4YK0 A;  4BW1 A;  5A5S A;  5FE5 A;  2K3Y A;  4QUU A;  5KCH A;  5HEN A;  2EQJ A;  4FLP A;  4QEW A;  4IR3 A;  4IOQ A;  5DFB A;  3SVG A;  2K3X A;  5D6X A;  4A4F A;  5H1T A;  5FRN A;  3O36 A;  5L8T A;  3HME A;  5CRM A;  3PMT A;  2R0S A;  4TU6 A;  5C8G A;  4E7H A;  5D24 A;  3UW9 A;  4MEQ A;  5D3J A;  5DW1 A;  5HRX A;  4A9F A;  2WP2 A;  5D3T A;  5IG6 A;  4MR4 A;  3IU6 A;  3MET A;  3F70 A;  2O4X B;  3GOX A;  4YAT A;  4A9O A;  5LKU A;  5DYU A;  2D82 A;  2OUO A;  5DFD A;  3MEU A;  2RJE A;  3L2Q A;  5EVA A;  4UYE A;  4TS8 A;  5F25 A;  2XK0 A;  3JVL A;  2DVQ A;  4MEN A;  3FKM X;  5AMF A;  4PY6 A;  4OVA A;  4IOO A;  4C5I A;  2PQW A;  2R0Y A;  4O78 A;  5F62 A;  3U5L A;  5LKT A;  2L8D A;  2GFA A;  4QSR A;  2YEL A;  4YYK A;  5IGM A;  3DB3 A;  3C4S A;  4YBM A;  3O33 A;  4OGJ A;  2BIV A;  4ZW1 A;  3MUL A;  3UV4 A;  5A83 A;  3LGL A;  2M16 A;  3OYG A;  4HBY A;  2N9G A;  3JVK A;  3S3O A;  5L97 A;  4QNS A;  3HMF A;  4QC1 A;  5E9M A;  3P8D A;  4NYX A;  5D3H A;  2L89 A;  4IUQ A;  3HMH A;  5CU8 A;  4N4H A;  5TCM A;  4HXS A;  3PNW C;  5FH7 A;  3G0J A;  3MEA A;  5K29 A;  4PCI A;  5HCL A;  4QR5 A;  5II2 A;  5TB6 A;  3QBY A;  4A9N A;  5I1Q A;  5AD2 A;  4NUC A;  5C0M A;  5FE8 A;  2DWW A;  4YYD A;  3E9G A;  4Z02 A;  3P1C A;  4B9X A;  4C5H A;  5F61 A;  5CQ5 A;  5FFY A;  2RHX A;  4CUP A;  5ENE A;  4DON A;  4QZS A;  4QB3 A;  2RI7 A;  5E9V A;  1OYX A;  2YRV A;  1RI0 A;  5EWC A;  4O75 A;  5FBX A;  5I80 A;  5KO4 A;  3EAE A;  5J26 A;  2OO1 A;  3SVH A;  5IN1 A;  3MXF A;  5DX4 A;  4NR4 A;  4YYG A;  3NTK A;  5AD3 A;  4TZ2 A;  2M1H A;  4HBV A;  5I88 A;  2FSA A;  3MQM A;  5HQ5 A;  5CS8 A;  4QR3 A;  2FHD A;  4B9W A;  4Q0N A;  4QUT A;  5CRZ A;  5EV9 A;  5FFV A;  2RHZ A;  4A4E A;  3OS0 A;  4UYH A;  3L2W A;  2LCC A;  4HXP A;  4XUA A;  4BE0 A; 
#chains in the Genus database with same CATH topology
 5CUD A;  1D3B A;  2RMO A;  2J6K A;  2WP1 A;  4HXO A;  3H6Z A;  4ORZ A;  1PD1 A;  2KRO A;  2RJC A;  1UGR B;  3OYN A;  4UYG A;  1IRX A;  3X28 B;  4DBH A;  4A9L A;  2YW5 A;  4X2I A;  4O7C A;  3RES A;  1AWX A;  5HJC A;  3U23 A;  3CXC A;  1JQQ A;  2DJQ A;  2HAX A;  5D7X A;  1M90 U;  4YBS A;  3M56 A;  4M78 G;  1WNL A;  4A63 B;  1NYG A;  2BTT A;  2E10 A;  2EVR A;  1OX8 A;  5A0L A;  1VQL Q;  1KQ2 A;  1UB4 A;  4FU6 A;  3MEW A;  1CSK A;  5IXB A;  5J0D A;  2PUO B;  2QGG A;  2E5Q A;  2COY A;  4EMK C;  2E41 A;  1H3Z A;  2J6O A;  4Y92 A;  4XTV A;  4Z6H A;  1AVZ C;  3ONI A;  2P84 A;  4JJB A;  3CCM Q;  1PM3 A;  5FE0 A;  4NR6 A;  4XU3 A;  3CXC S;  3OYF A;  3VS0 A;  4HCZ A;  4JLG A;  5I83 A;  5CPE A;  1W70 A;  3UA6 A;  1JO8 A;  3BDL A;  3VS2 A;  1TU0 B;  3CCJ Q;  3Q2E A;  5EPS A;  2MAM A;  2NWM A;  1D09 B;  4HXM A;  4X1V A;  4LUE A;  3EG9 B;  1FXX A;  3MUK A;  2HBW A;  4Z88 A;  2CH4 W;  5HKC A;  3OS1 A;  3UVX A;  4C92 G;  4UIZ A;  4K11 A;  1GBR A;  1GBQ A;  1YCS B;  1E7O A;  2EWN A;  3OSS C;  4CUT A;  4ZN3 A;  2OTL Q;  4C8Q C;  4LYI A;  5KTX A;  5GAN d;  1I81 A;  5E9K A;  3SFM A;  5DFC A;  2QA4 Q;  4JZ4 A;  2O88 A;  3ZYU A;  5AME A;  4DEX A;  4A53 A;  1K8A C;  1BI2 A;  3H0H A;  5IHK A;  4LDX A;  3JCM Q;  2RI3 A;  4BJX A;  2LNV A;  5CO7 A;  1UFF A;  4OMP A;  4Z6I A;  1NLP C;  5FH6 A;  5HEM A;  4LD9 K;  5HQ7 A;  4QSX A;  2KR3 A;  1BI0 A;  2CS7 A;  4FYV B;  4FW1 A;  4ME7 A;  3OYY A;  4II1 A;  1OU8 A;  1VUB A;  2ED0 A;  3FIF A;  3CD6 T;  4ZTF A;  4KGX B;  1YJ9 A;  4WIV A;  1GRI A;  1Q95 G;  1TTH B;  3OBW A;  4BW2 A;  4M4Z A;  3OYH A;  2XDB A;  4DBF A;  4QC3 A;  4NQN A;  4BHW A;  3PVL A;  4M7A E;  3MP1 A;  4R0K A;  5ENG A;  3RDV A;  1SRL A;  3CCL Q;  5CUE A;  2JVV A;  4HXN A;  4PKL A;  4ALH A;  2GCX A;  5IXF A;  1X6G A;  5LVQ A;  4FT2 A;  5COI A;  4J6W A;  3I5R A;  4YYN A;  1D1B A;  2ROT A;  2VYT A;  2F6N A;  3UVW A;  2PNI A;  5ACY A;  5DBM A;  5E9Y A;  2GRC A;  5CQ3 A;  5CUB A;  4BW4 A;  2QG9 B;  5LJ2 A;  1BIA A;  3PVQ A;  4A4H A;  3M4Y A;  1Z9Q A;  2NLU A;  4RTY A;  4HT8 A;  1ZUK A;  1A0N B;  5HFQ A;  3QXE B;  2YLB A;  3JB9 H;  4O7E A;  1WHG A;  3JCM V;  4PJJ A;  3CXC P;  4M75 E;  4LZS A;  1ZSZ C;  1K8A R;  5FE3 A;  1PRL C;  1QKW A;  1Y0M A;  2E3H A;  2D8H A;  2Y90 A;  4HVU A;  5DM7 R;  3QPH A;  4D6W A;  1KQ1 A;  2AT1 B;  1X6O A;  4QSV A;  5GAN 3;  2RO0 A;  1PSF A;  4CUS A;  5GAN 6;  4MZP A;  1QVP A;  2FPD A;  5F36 A;  1ABO A;  1VQL T;  4M7D A;  3JB9 D;  4AKN A;  4KV4 A;  1W2B S;  1ZBX A;  4DQ2 A;  5E9I A;  3HL8 A;  2F69 A;  4CFL A;  3J81 E;  3U5J A;  2OAW A;  4O72 A;  5CAI A;  1VQ6 Q;  4J7I A;  1VQ8 A;  2O2O A;  3UV2 A;  5A5N A;  3FEO A;  1QVF A;  3CCM T;  1Q81 U;  1GCQ C;  1QWF A;  2GQV A;  4D8K A;  4IR5 A;  2LT4 A;  4RUG A;  3CMA Q;  4GLM A;  1UGQ B;  4E7I A;  4YTL A;  4C67 A;  4R55 A;  3JCM d;  2X35 A;  3CCJ T;  4CC3 A;  4YAB A;  3RUX A;  5IGN A;  3QZV A;  3P5O A;  2FZC B;  3A8O B;  4C0Z A;  2NUP B;  3M0Q A;  1MNE A;  3EGX A;  3EGD A;  3M9Q A;  5F2P A;  1VQK A;  4KCX A;  2OTL T;  4ESR A;  2FL7 A;  3CCE A;  1QVF S;  4NYW A;  2GBQ A;  4PJO A;  2QA4 T;  1RAI B;  4HXJ A;  2DE0 X;  3LGF A;  5KYU A;  2KRN A;  3G0L A;  3L2R A;  2MIO A;  4WF2 A;  3A8H B;  5D6W A;  5C6S A;  1KHI A;  2DZ9 A;  4JJD A;  5DY7 A;  1M2V B;  1KD1 U;  1X27 A;  4F7U G;  2QQA A;  1X0J A;  2LJ1 A;  1VYV A;  2CZ0 B;  3UF4 A;  3LQH A;  2DIG A;  1XNI A;  4E7J A;  5FLX E;  2FRY A;  2KEA A;  2ENM A;  2D8J A;  2VVK A;  4NRB A;  3I3J A;  2BUD A;  3CC2 A;  4IKF A;  1VQN A;  3MEV A;  3V7C A;  4XTX A;  3HRT A;  5CQ4 A;  1IGQ A;  4RMO A;  3M0S A;  2KK4 A;  3VS7 A;  2RHY A;  5A2Q E;  1UHC A;  3X20 B;  4EMK B;  3CCL T;  2DXC A;  1M27 C;  3UVY A;  3LW5 E;  2DKG A;  5F60 A;  1K9M U;  2HKQ B;  5EWD A;  2QEX Q;  4N3W A;  2CZ6 B;  2DYB A;  5FE6 A;  4XTZ A;  3ME9 A;  5FDZ A;  4N4G A;  3HTR A;  3PE0 A;  1TUC A;  3CCQ A;  4L5G A;  3CBO A;  3JCM W;  2KQW A;  3JB9 J;  4CUQ A;  2DM1 A;  2EYY A;  3UV5 A;  2QDY B;  2ZCF B;  4HVV A;  1D0Y A;  2FO0 A;  2DFU A;  5L8U A;  1YHQ A;  4PCE A;  2RO1 A;  3CCS A;  2EJN A;  2PZ1 A;  5CTL A;  1D1A A;  3CEY A;  2KYM A;  3D7S B;  5EU1 A;  4OMF B;  1YIT A;  5M9O A;  5GAN h;  4JS4 A;  2XDD A;  4DOV A;  3QZ5 B;  2H3E B;  3LYI A;  1OZ2 A;  2EYQ A;  4FW2 A;  4J9E A;  2CP5 A;  3FLG A;  2F2V A;  4UIV A;  2L3S A;  4J6Y A;  1VQP A;  1O9S A;  5LJ5 d;  5GAN f;  3CC4 A;  4ZTJ A;  4BD3 A;  3VUZ A;  1F68 A;  1W6X A;  4OP0 A;  5IHI A;  3CC7 A;  2G4A A;  1SHG A;  2F2W A;  2VGN A;  4X9C A;  3PTA A;  1UEC A;  2GF7 A;  2K2V A;  2DVV A;  1QVF P;  1WHK A;  3VRZ A;  2O4X A;  4J0S A;  4TT4 A;  1KG1 A;  5FE5 A;  2OAU A;  1VQ6 T;  4QUU A;  2COW A;  3EG1 A;  2CZ1 B;  2LQW A;  2EQJ A;  2YUN A;  4FM4 B;  4FLP A;  4QEW A;  4IOQ A;  1UGV A;  2RA2 A;  2K6D A;  2MOX A;  2BZ8 A;  4E7H A;  1G3T A;  4A4K A;  3QSU A;  3CMA T;  3KFV A;  1YJ9 Q;  4JRK A;  2PTK A;  4HT9 A;  2MYS A;  1VQ4 A;  1ABQ A;  2VKN A;  4YAT A;  2CP6 A;  2YLC A;  1VQ7 A;  2RH2 A;  1UUE A;  3G71 A;  5GJV B;  4TS8 A;  1KC8 C;  2DVQ A;  3VYG A;  3FKM X;  5AMF A;  1OEB A;  3TQ7 P;  1I1J A;  4C5I A;  2VAS A;  5LKT A;  2QQB A;  4YYK A;  4F14 A;  3FB9 A;  3V7S A;  3C4S A;  2BIV A;  2P4T A;  5A83 A;  4M7D F;  1BK2 A;  3OYG A;  2N9G A;  5GAO l;  1R77 A;  3M54 A;  1N6A A;  4F7U B;  1BYM A;  2H8H A;  2DEU A;  5D3H A;  1B34 A;  5FU6 C;  5LL6 S;  3QDR B;  3REB B;  4D8D A;  5GAM e;  2DL8 A;  2LJ3 A;  4HXS A;  2C0I A;  4QR5 A;  5II2 A;  1FX7 A;  3P8B B;  1QP3 A;  5GMK i;  2DER A;  3GIB A;  4YYD A;  3E9G A;  5CCA A;  3P1C A;  1NJI U;  2JT4 A;  5CQX A;  5F61 A;  5CQ5 A;  4M7D C;  5ENE A;  2E64 A;  3BW1 A;  1AZG B;  4C8Q A;  1Q7Y C;  1CKA A;  1WXU A;  2FB7 A;  4YYG A;  3NTK A;  2M1H A;  2QEX T;  5I88 A;  2MK5 A;  3MQM A;  3RKX A;  4QR3 A;  4Q0N A;  2E3I A;  5CRZ A;  2MPX C;  4OGC A;  3E2U A;  1D0Z A;  2KGT A;  4OB1 B;  1AT1 B;  2RI5 A;  3JCM h;  5D3R A;  3Q2F A;  5G4S A;  4O6J A;  3MP8 A;  2A37 A;  2MCN A;  1RLQ C;  5E74 A;  4O70 A;  4JLI A;  3MB4 A;  1WZO A;  1LOJ A;  5GAN 2;  3HHT B;  1X2K A;  2RK1 A;  1VQ8 Q;  1SHF A;  5LJ1 A;  3HFO A;  3I55 Q;  4NRC A;  1WUM A;  5L98 A;  1IHV A;  3CME A;  1Y71 A;  4QVZ A;  1SPK A;  4O7B A;  1X43 A;  3EG2 A;  2VGM A;  5GMK e;  1D3B B;  4HCK A;  4PJM A;  4XTW A;  2QK0 A;  1KK7 A;  3HRU A;  4M77 F;  2LTO A;  1UG1 A;  5L96 A;  2HSP A;  4JZ3 A;  2DO3 A;  4EIK A;  1VQK Q;  5CZG A;  4KT0 E;  5IHN A;  2AKK A;  5FB1 A;  2E65 A;  5LJ3 d;  2EW3 A;  2E70 A;  4QQ6 A;  2WAC A;  4WHW A;  2A7Y A;  3OS5 A;  1M3A A;  3AAD A;  4IR4 A;  4PJN A;  4M7D G;  4BAC A;  3P1D A;  4UYD A;  5LJ5 g;  3CCR A;  5C89 A;  1NM7 A;  4ZN1 A;  4XU0 A;  4LDY A;  4QSS A;  4M77 C;  4QKU A;  4J9G A;  1ZSZ A;  1MV0 B;  5JI8 A;  3U5P A;  2JTM A;  1YJ9 T;  2A3L A;  2J06 A;  1X75 C;  3CC2 Q;  5KYX A;  1VQN Q;  1QP2 A;  4LNP A;  2Y4X A;  4IUP A;  1WLP B;  2KE9 A;  1MMA A;  4AG1 C;  4C0D C;  1JBM A;  1OPL A;  5D3P A;  3V8J A;  1PUO A;  3QWY A;  3DB4 A;  1K0S A;  2LMJ A;  2L3R A;  2JMC A;  4UYF A;  2D1X A;  1BCM A;  5FW9 A;  2X4J A;  1WHL A;  4ZQL A;  5IH2 A;  2E12 A;  3EHQ A;  3CCQ Q;  4KV1 A;  4PFZ A;  1QW1 A;  4J9C A;  1Q86 C;  1GCQ A;  3GP8 A;  4PJO G;  4Q5W A;  1N5Z A;  4E7S A;  3GF5 A;  2DNU A;  1ARK A;  3D1D A;  3M0R A;  3RCW A;  4C66 A;  1ZSG A;  5LJ5 h;  5LJ5 j;  1YHQ Q;  2NUZ A;  3CCS Q;  4M78 E;  5EWW A;  1IB8 A;  2RQW A;  4HXL A;  3PFS A;  5LJ5 f;  4ZGD B;  4AG2 C;  1VQ5 Q;  2E1H A;  3S6W A;  3AT1 B;  3U5N A;  1QKX A;  2RHI A;  2KTB B;  3JCM J;  1VQP Q;  2DTO A;  5A5O A;  1M5Q 1;  5E3D A;  1F1B B;  3QWX X;  1M3B A;  5DW2 A;  3OQ5 A;  3NPF A;  3ZBD A;  4MML A;  5EG2 A;  3CC7 Q;  4J0R A;  2XMF A;  2CSI A;  2XID A;  2EJG A;  3HSB A;  5D3N A;  1JJ2 P;  1SKU B;  5KTU A;  5FB0 A;  2X4W A;  1EZZ B;  5I7X A;  2BE9 B;  2HL3 A;  4YH4 A;  5DYX A;  1U8R A;  5D26 A;  1M1K C;  2BZX A;  5EC7 A;  4NL3 A;  2NYS A;  1VQ8 T;  2QQR A;  4AKG A;  1K8A U;  5JWM A;  2J05 A;  1TG0 A;  2ZPF B;  4C92 E;  2CGH A;  5GAO n;  1AD5 A;  3I55 T;  5F1L A;  3NTI A;  4BY6 B;  1N8R C;  2YHT A;  4QT7 A;  5C7N A;  5KU3 A;  1E6I A;  1LPL A;  5I29 A;  5EIS A;  1QWE A;  2JTE A;  2GGR A;  3I56 Q;  1VQ4 Q;  4LYW A;  4Z8A A;  5GAO p;  4GBQ A;  4DBQ A;  3AQA A;  1Q86 R;  2L2P A;  5CKD A;  1VQ7 Q;  5FU6 B;  4C8Q F;  2EQI A;  4OB3 B;  4HXK A;  1JRI A;  3G71 Q;  3TVT A;  5EGU A;  3VU3 C;  4Y03 A;  1YIJ A;  1VQK T;  5EWV A;  1O75 A;  2M51 A;  3CCU A;  4FT4 A;  4TYL A;  1OPK A;  2LDM A;  3VS6 A;  4NUD A;  3G1J A;  3UA7 A;  3UPU A;  4XYA A;  4CC4 B;  2LC4 A;  3BFM A;  1X01 A;  1YN8 A;  4M7D B;  5DYA A;  5A81 A;  4RCB A;  1TH7 A;  5IT9 E;  4OMM A;  4RG2 A;  3H0I A;  5FU7 B;  3O8V A;  2KSS A;  5ETB A;  2ESW A;  2JMA A;  4LD6 A;  2DK3 A;  5IAY A;  5DLO A;  4E7Z A;  5I7Y A;  3I9Q A;  2K5L A;  3LX7 A;  4X9D A;  4RTV A;  5HLS A;  3ZEH A;  5LJ3 g;  1AWO A;  1I8F A;  4C5E A;  1IO6 A;  2DYI A;  5CUC A;  2HQX A;  3CC2 T;  1VQN T;  4E96 A;  1WX6 A;  4KUI A;  3L2V A;  2K3B A;  4A9H A;  5FFW A;  4YYJ A;  3RKW A;  2IIM A;  3H8Z A;  3VJP A;  5GAO q;  1VYU A;  1NPR A;  2YDL A;  3RER A;  5A85 A;  4M7A C;  2DVS A;  3LQI A;  2WSF E;  3OYK A;  1M90 C;  2P0P A;  5DY9 A;  5E9L A;  1SEM A;  2FZK B;  3EGD B;  3EGX B;  5LUU A;  4ELY C;  1N8R R;  4UIT A;  3JV3 A;  1RAE B;  2QGF B;  4LDU A;  1NG2 A;  2MWP A;  2RB6 A;  2E5K A;  4IUV A;  3CCV A;  2F5T X;  5A0G A;  1XQH A;  1HD3 A;  3CCQ T;  2LSP B;  5D25 A;  5CY9 A;  5CKE A;  4PJO B;  4ANJ A;  4M75 F;  3O37 A;  3JRZ A;  2MWO A;  1RAC B;  5KYU B;  1H3H A;  5CUA A;  2ZZD A;  2ZAE A;  8AT1 B;  2QTX A;  3G6E A;  1YHQ T;  3CCS T;  2FPE A;  4E7L A;  2QYZ A;  1NBE B;  1B7T A;  1SSF A;  4LDV A;  2D9T A;  2K2M A;  3SWN A;  3CME Q;  1RUW A;  5LJ3 h;  5EP7 A;  5LJ3 j;  5GJW B;  4CUR A;  2E7O A;  4LR6 A;  2MJV B;  1VQ5 T;  1ZUU A;  1VQ9 A;  4J6X A;  4QSQ A;  1PKT A;  2PVD B;  4M75 C;  5HFR A;  3RR6 A;  3FRN A;  1VQP T;  1ZBJ A;  5LJ3 f;  2CKK A;  3EFO A;  3SB2 A;  4WHU A;  5FG6 A;  4C8Q G;  1TUG B;  5CP5 A;  3Q1J A;  3M0T A;  3CC7 T;  4N4I A;  4EMG A;  1W4S A;  1JM4 B;  3C94 A;  2EQM A;  2O9V A;  3GPL A;  3UT1 A;  3CCR Q;  1YJN A;  5HY6 A;  1WJS A;  2O9S A;  2HKN A;  2XDP A;  4TTE A;  2RNW A;  4TT6 A;  4F17 A;  1QQJ A;  3SD4 A;  3I56 T;  1VQ4 T;  3DAI A;  4XTU A;  5ECA A;  4UIW A;  3S91 A;  1GCP A;  3QZS A;  4WTO B;  4E47 A;  2R57 A;  2DD4 A;  2LRQ A;  3TSZ A;  4TU4 A;  1K73 C;  4LN2 A;  1VQ7 T;  2L5E A;  2OSS A;  4F7U E;  5ENB A;  3G71 T;  2J7I A;  2K4Y A;  3A8M B;  4YAD A;  4YK0 A;  2K3Y A;  2KT8 A;  4DBR A;  2VB6 A;  1HK9 A;  1UJY A;  4IR3 A;  2XD0 A;  5DFB A;  3SVG A;  1TUD A;  2K3X A;  2CH4 A;  5H1T A;  2ZPH B;  5FRN A;  3NFC A;  3O36 A;  5L8T A;  3HME A;  1E6H A;  1VIE A;  4JRI A;  5GAN 8;  3PMT A;  4TU6 A;  5C8G A;  2L3P A;  4QVC A;  3UW9 A;  1MGQ A;  5D3J A;  5DW1 A;  5HRX A;  4A9F A;  2WP2 A;  4MZM A;  5D3T A;  1D1C A;  3F70 A;  2O4X B;  1KFZ A;  2HD0 A;  1MND A;  2LZ6 B;  1T3S A;  4DOW A;  2GTJ A;  3L2Q A;  4MMK A;  3LWH A;  2FVU A;  4PY6 A;  4M7D D;  4O78 A;  5F62 A;  3U5L A;  4LXC A;  5IGM A;  4OGJ A;  3MUL A;  3S3O A;  4Y91 A;  4QNS A;  3N5B B;  3P8D A;  4NYX A;  1S72 A;  1RLP C;  1YFN A;  5J3B A;  4OGE A;  2A36 A;  3PIO A;  5TCM A;  1I5O B;  1WQ7 A;  2ZPG B;  4M77 A;  3PNW C;  5FH7 A;  5HCL A;  2DIL A;  5TB6 A;  1BI3 A;  5AD2 A;  4HA8 A;  2ZPB B;  1K73 R;  1VQO A;  4CUP A;  1ZA2 B;  2DRM A;  1K1Z A;  1OYX A;  2YRV A;  1RI0 A;  5EWC A;  1B34 B;  1S1N A;  4LE9 A;  1QVG A;  5FBX A;  4P5N A;  1SF9 A;  3M0U A;  2VV5 A;  2OO1 A;  3CME T;  5AD3 A;  4N0A C;  2COZ A;  4PJO D;  5HQ5 A;  5CS8 A;  2K57 A;  3C0C A;  1AWW A;  1AZE A;  4FYY B;  4JDS A;  4TVR A;  2M9U A;  2NUT A;  5FFV A;  2RHZ A;  4A4E A;  2XU8 A;  2FPF A;  3OS0 A;  3ULR B;  4HXP A;  4BE0 A;  1G3Y A;  4LDW A;  1I0C A;  4GLK A;  4C8Q B;  2OJ2 A;  3UVD A;  4YYM A;  1V76 A;  3VKI A;  5LJ0 A;  2YUQ A;  4CC2 A;  1AEY A;  1QCO A;  2VUB A;  4C5G A;  3JVJ A;  4BUG A;  1YIJ Q;  3A8L B;  4M78 A;  3WXM B;  4CL9 A;  1QVG S;  1BCO A;  4UIU A;  4A9I A;  1IRE B;  2LCS A;  2RFJ A;  5F63 A;  2JZ2 A;  5DKH A;  5EA1 A;  5ENH A;  4IUU A;  5A82 A;  3VKG A;  4E7K A;  5DKD A;  2O31 A;  1KD1 C;  3CCR T;  3UWN A;  4BDZ A;  3TRE A;  5KTW A;  2RNX A;  3EH2 A;  2V26 A;  1WI7 A;  1JU5 C;  5KE2 A;  2HL5 C;  2CSQ A;  4RG8 A;  4QYD A;  1WXB A;  2D9E A;  2LX9 A;  3O34 A;  4PFO A;  1IHW A;  5CQ7 A;  5DKC A;  1Y96 B;  2LQN A;  2R5M A;  4ZNX A;  3R6O A;  3M53 A;  5CKB A;  3X26 B;  3FC3 A;  1MUZ A;  1Q82 C;  3M57 A;  1K9M C;  4OMO A;  4Y28 E;  4PNO A;  3TCJ A;  4C92 A;  5I2S A;  3QII A;  4ZC9 A;  2FG0 A;  4RTX A;  2A28 A;  2HBP A;  3CCV Q;  3RIR A;  3SWN C;  3KUF A;  2KXD A;  4XAX B;  5CVI A;  5DYC A;  3DLM A;  4AMC A;  1ZS5 A;  3CQT A;  5GAO r;  4AFQ C;  1VQL A;  2QTV A;  5HCK A;  4NYV A;  3VUB A;  2DMO A;  4J8O A;  2RK2 A;  1JXM A;  1NEB A;  4Z1S A;  3G6E Q;  5ENC A;  1LVK A;  4J83 A;  1NLO C;  2W10 A;  1ZSZ B;  5E3G A;  2EQK A;  2I7K A;  4J7F A;  2WSC E;  2R58 A;  5HK0 A;  2H60 A;  1XJW B;  4TQN A;  3O35 A;  4CFK A;  3OW2 A;  1HJD A;  3PMI A;  4LZR A;  1YWP A;  5KYX B;  5A5P A;  1VQ9 Q;  4NUE A;  2YEK A;  4CRI A;  3E9F A;  5FRM A;  5HEL A;  1WGS A;  2RNY A;  2YRC A;  4PKC C;  2LX7 A;  2DL5 A;  2EFI A;  1WJQ A;  2L5Q A;  2L85 A;  1OOT A;  4NRA A;  4LDF A;  3OMG A;  1CKB A;  2DAQ A;  1U3O A;  1X2Q A;  4UYF B;  1NEG A;  3J80 E;  4PTB A;  2VXE A;  4NQM A;  4YYI A;  4A9E A;  3QYH B;  4NXJ A;  2IG0 A;  1QVG P;  1TS9 A;  1RAD B;  1WA7 A;  4R56 A;  2NXB A;  3OW2 S;  3HRS A;  2E6N A;  3RKY A;  4JPB W;  2MMP A;  5GAN e;  3JCM X;  5KE3 A;  1YJN Q;  1Q82 R;  1G3S A;  3NGP A;  4BE1 A;  5CQ6 A;  4UIX A;  1WYX A;  3HKS A;  1LJO A;  2DL7 A;  4M7A A;  5L23 A;  1FWZ A;  1FMW A;  2CZ7 B;  2OI3 A;  1JJ2 A;  1KC8 R;  2ATC B;  3U5M A;  4NL2 A;  1HXD A;  5I89 A;  1ZKR A;  5H1V A;  2E3K A;  5EPR A;  3HPW A;  2V8I A;  1C1A A;  3THK A;  1B07 A;  1YIJ T;  2AIR B;  1BKB A;  5DLQ E;  4QSW A;  4KH1 B;  1WPY A;  2VC8 A;  5I40 A;  3JB9 I;  1UJ0 A;  2JN0 A;  1TXQ A;  5FE1 A;  4C8Q D;  2HDA A;  1U1S A;  3DLL A;  1RL2 A;  1JJ2 S;  2YXY A;  4QEU A;  2XIC A;  3CCE Q;  5IBN A;  1Q86 U;  1PCX A;  2QQ9 A;  3WVD B;  5ENJ A;  5CUG A;  4Z1Q A;  2DBM A;  1YJW A;  1PRM C;  4M75 A;  1WJR A;  2MI6 A;  2O01 E;  2DL3 A;  3RMQ A;  3J7A F;  2A0F B;  2YT6 A;  2YEM A;  4KUL A;  1Q7Y R;  4C0F A;  4X34 A;  4PJO E;  1BIB A;  1GFC A;  2ROL A;  4HCB A;  2F5K A;  5J39 A;  3L1A A;  1QMC A;  4LZ2 A;  2AHJ B;  3NMZ C;  2PVG B;  1S72 Q;  4BB7 A;  1MHN A;  5KYY A;  2JTF A;  4M78 F;  4OML A;  2P4R A;  3CCV T;  5IGK A;  1WDX A;  5KH6 A;  1Z9Z A;  2I8N A;  1WHM A;  3OB9 A;  4NR7 A;  1FYN A;  3X24 B;  2YDW A;  2FZG B;  3LLR A;  3OYE A;  2XI9 A;  4F7U A;  1VQO Q;  3KBG A;  1XTD A;  1ZLM A;  4QYL A;  1W1F A;  2HQH A;  3G6E T;  3OW2 P;  2IVW A;  2M0O A;  1AWJ A;  3OYC A;  1HSQ A;  4OF1 A;  3ZL7 C;  4UC4 A;  3S3N A;  2RPN A;  2OTJ A;  4M78 C;  1TOV A;  3SVF A;  1TSF A;  5E73 A;  1N8R U;  3EHR A;  5CQT A;  4AI6 A;  1PHT A;  2DL4 A;  2LNH B;  2HQE A;  1VQ9 T;  2D0Q B;  3QZ9 B;  3MO8 A;  2KRS A;  2X3X D;  1OQK A;  4A4G A;  2AZS A;  1OU9 A;  2FYK A;  3JCM e;  2YSQ A;  4C92 F;  1YIT Q;  5HRW A;  2KT1 A;  1P92 A;  4XK8 E;  5BT3 A;  5F5Z A;  5HRV A;  3D7C A;  1Y7X A;  2EYX A;  4BW3 A;  5GMK l;  3JCM P;  2CP7 A;  5H85 A;  5DLX A;  1WQW A;  3CC4 Q;  4YH3 A;  3PGG A;  4JJN K;  4M77 G;  5GAN 7;  5CFW A;  5A0D A;  3EFR A;  1YJN T;  4QQD A;  3BE3 A;  1WHH A;  1YP5 A;  1OZ3 A;  3A8G B;  3OS2 A;  4C92 C;  1V1C A;  2WSE E;  2DXB A;  4OUF A;  3C12 A;  3V8K A;  1RAF B;  3FJP A;  2CP0 A;  2DVE A;  4O7A A;  3SWN B;  4QW2 A;  3MJX A;  5EWH A;  4MDW A;  2CP2 A;  1KIK A;  1M8V A;  4YBT A;  2CUD A;  4IUR A;  4GPJ A;  1KQS A;  4A9M A;  2JUF A;  1GL5 A;  4QST A;  1M9S A;  5I21 A;  5L99 A;  2LJ0 A;  4O76 A;  4MDX A;  5I22 A;  4O7F A;  4EMH A;  3OYD A;  3EFO B;  2HZY A;  3MPU B;  2X4Y A;  4GY5 A;  1YWO A;  1YI2 A;  2PU9 B;  2QEX A;  3SEM A;  4OMQ A;  3JCM c;  1EQF A;  3VYH B;  2YRD A;  2JNG A;  4IR6 A;  5FWC A;  1U06 A;  4HBW A;  5C85 A;  3H9N A;  4N0A A;  2PVO B;  2RD1 A;  4KRT A;  3A5Z B;  1PWT A;  1KQS S;  3CCE T;  4O74 A;  1VQM A;  5CQA A;  4FSX A;  3S3M A;  1N27 A;  5D6Y A;  2J6F A;  5LKZ A;  5GAM d;  4BW1 A;  5A5S A;  5KCH A;  2DZC A;  3E19 A;  5HEN A;  2JJ9 A;  4M7A F;  5D6X A;  2QI2 A;  5CRM A;  3LH5 A;  2R0S A;  3DKM A;  1RAB B;  4MEQ A;  1R0B G;  3O5Z A;  1S72 T;  5IG6 A;  2EGE A;  3G4S A;  4A9O A;  5DYU A;  3QHS A;  2D82 A;  2EYW A;  1QCN A;  3RBB B;  1M30 A;  3M58 A;  1UDL A;  1PG5 B;  2D6F A;  2XK0 A;  3JVL A;  5LJ5 e;  4MEN A;  1M1K R;  2KXC A;  2VXF A;  3CPW A;  2XG8 D;  4IOO A;  2KMT A;  2PQW A;  2L8D A;  2GFA A;  1VQO T;  4QVD A;  3DB3 A;  4ZW1 A;  3UV4 A;  1M8M A;  3LGL A;  4C8Q E;  3E1S A;  1BBZ A;  4AFS C;  3JVK A;  1IGU A;  3HMF A;  5E9M A;  1M1G A;  1U1T A;  2XKO C;  4IUQ A;  4J9F A;  3HMH A;  1AHJ B;  1PSE A;  1AOJ A;  2DF6 A;  5KYW A;  1PNJ A;  3G0J A;  3MEA A;  4CC7 A;  5K29 A;  4PCI A;  2RN8 A;  4B6M A;  5CQY A;  3CPW S;  2CYZ B;  2I2L A;  3QBY A;  3BDU A;  5C0M A;  2DWW A;  4Z02 A;  1MMN A;  2GNC A;  1YIT T;  5FFY A;  1NZ9 A;  2E4H A;  1K73 U;  4QZS A;  1M3C A;  4QB3 A;  2RI7 A;  5E9V A;  1UTI A;  2EIF A;  2HMA A;  5KO4 A;  2OX7 A;  5J26 A;  2HEQ A;  3SVH A;  5IN1 A;  3MXF A;  2M02 A;  3IQL A;  5DX4 A;  1UHF A;  4NR4 A;  3CPF A;  3MKD A;  4TZ2 A;  2D0N A;  1FMK A;  4HBV A;  4M77 B;  4HKE A;  3CC4 T;  1UGS B;  2FHD A;  3A1P A;  5EV9 A;  2SEM A;  2QDL A;  4F7U F;  3WVE B;  1C6V X;  2A08 A;  2LCC A;  1FMV A;  2V1Q A;  2DA9 A;  1MMG A;  2HSE B;  1KQS P;  3QG1 A;  1BU1 A;  5F1H A;  5ETD A;  1VA7 A;  2AZV A;  1IZ6 A;  1YJW Q;  3PT9 A;  4NS5 A;  4LYS A;  1XOV A;  4XY9 A;  3OBY A;  2W0Z A;  2DX1 A;  4TZ8 A;  4C0D B;  4E6R A;  2QAS A;  4VUB A;  1W2B A;  4Z89 A;  1BB9 A;  4M7A G;  2NUT B;  4N4F A;  3OYJ A;  1X6B A;  1M90 R;  4LUD A;  3JVM A;  2LVM A;  3L42 A;  4CI0 C;  4O71 A;  1K76 A;  5AYF A;  2CT3 A;  5I2M A;  3VS3 A;  3FJ5 A;  4BE2 A;  5FG4 A;  4YC9 A;  2RQR A;  2VWF A;  1K0X A;  1R0C B;  4M78 B;  5CIU A;  1DJ7 B;  1R8O B;  2CUB A;  4FCY A;  4EPC A;  1G5V A;  3L2Z A;  2RQV A;  1KJW A;  3EG9 A;  4XU2 A;  5CR2 A;  2HNI A;  5CKF A;  2DVR A;  5D0C A;  5EPB A;  2YQD A;  2EPD A;  2FRW A;  4DEY A;  2EJF A;  4OGI A;  1UGP B;  5AT1 B;  3OY9 A;  3K2J A;  3GG3 A;  4LRG A;  5D7U A;  2BKD N;  2EQU A;  4LC2 A;  3I55 A;  2FEI A;  2R0V A;  4EDU A;  5EI4 A;  4J1P A;  2OTJ Q;  4ZGE B;  4PLL A;  2XHC A;  1U5S A;  4PLI A;  2JM8 A;  4M75 G;  2ABL A;  1OI1 A;  3D1B A;  3DWY A;  4V2S A;  3LWI A;  4FYX B;  3URG A;  2ZPI B;  2R10 A;  3QJ6 A;  2DD5 A;  4QBM A;  4J9B A;  2KDS A;  1QCF A;  2QXF A;  1ZQ1 A;  2X9H A;  3U5K A;  2X4X A;  3P8H A;  3CPW P;  5GAN 4;  5EK9 A;  4L59 A;  3IU5 A;  3EFS A;  5GAM g;  4C92 B;  3X25 B;  5FWB A;  2QQS A;  4WCI A;  3H41 A;  1H64 1;  5DLZ A;  3TLP A;  3MP6 A;  1RAG B;  2F2X A;  3ER0 A;  5EM3 A;  5II1 A;  2MF2 A;  1UE9 A;  2AKL A;  4AFU C;  1Y07 A;  5ENI A;  1M4Z A;  4AFZ C;  3LJW A;  4AT1 B;  2YYN A;  9ATC B;  2JW4 A;  5LJ3 e;  2P0K A;  3CBP A;  4XTY A;  2RQU A;  4A9J A;  2LQ8 A;  1N9R A;  3EG3 A;  4C0G A;  2DTI A;  3UAT A;  5D3S A;  2DLP A;  4MR6 A;  2DKW A;  2JXB A;  5F3A A;  3TU4 K;  3VS4 A;  2DAT A;  2EGA A;  1HYO A;  3ZFJ A;  3M0P A;  4PS5 A;  3M5A A;  1I4K 1;  4CLB A;  5KHM A;  3BY7 A;  2PUK B;  2V8J A;  5IID A;  5GAN g;  2KRM A;  1H8K A;  4JRP A;  2ED1 A;  4AKH A;  1Q81 C;  4A54 A;  3FDR A;  3OYA A;  5BT5 A;  4XY8 A;  4ZGJ B;  2GTO A;  3CD6 A;  1Q82 U;  2GFU A;  3P1E A;  4HVW A;  5GAM h;  4BDY A;  1PD0 A;  2K79 A;  1KHC A;  5GAM j;  4MEO A;  1YI2 Q;  4HCC A;  2KYB A;  2IPO B;  2CRE A;  3OA6 A;  5CGP A;  1OV3 A;  4IIM A;  2EGC A;  4KBM B;  2EBP A;  4IOR A;  5GAM f;  3CCU Q;  3A98 A;  4YY6 A;  5H1U A;  1KC8 U;  1VQM Q;  4O77 A;  1W2B P;  3H0F A;  5IGL A;  2RS9 B;  5KCO A;  3JCM b;  4XUB A;  1YJW T;  1T0H A;  4QQG A;  3OYL A;  4MR3 A;  2DXT A;  4M77 D;  2R5A A;  1BI1 A;  4F04 B;  3QKJ A;  4M7A B;  5CKH A;  5GAO m;  4Z93 A;  2C06 A;  1EFN A;  4QEV A;  5A7C A;  2DIQ A;  2EYZ A;  4RVR A;  5FE7 A;  4OB2 B;  2BZY A;  5GAN j;  3GNF B;  1WXT A;  2DBK A;  5FRO A;  2DJZ A;  4AKI A;  1VQ5 A;  2G3R A;  1G2B A;  4NOY A;  1E6G A;  1ZA1 B;  3G4S Q;  1OUL A;  3VRY A;  2LCL A;  1JB0 E;  1G83 A;  4FYW B;  1NPP A;  3OMC A;  3S92 A;  3L2U A;  4HBX A;  3JB9 F;  1NE8 A;  4J9I A;  3LQJ A;  3TEE A;  2NUP A;  3REA B;  1ACM B;  3LXJ A;  5LVR A;  1Q81 R;  1Q7Y U;  4MEP A;  1WHJ A;  4KGV B;  2RF0 A;  4QY4 A;  2RJD A;  2ZPE B;  5FH8 A;  1LCK A;  4IUT A;  5GMK h;  4XU1 A;  5GMK j;  3RNJ A;  4NR8 A;  1TWB A;  4M78 D;  4QSU A;  2DPP B;  3VV0 A;  2CDT A;  2DVJ A;  2OTJ T;  5HK3 A;  4M75 B;  2V8K A;  4FIB A;  1M1F A;  2SRC A;  1G3W A;  1M2V A;  3MCA B;  1EIF A;  2Z0W A;  1JXO A;  4Q0O A;  4QSP A;  1WFW A;  3I56 A;  3INZ A;  3QUI A;  5HQ6 A;  4PL6 A;  3I35 A;  3OYB A;  2LP5 A;  2HCK A;  2KI7 A;  5C4Q A;  3OYI A;  4JRQ A;  3VS5 A;  1M2O A;  3NTH A;  1J3T A;  3CCM A;  1K4U S;  4HXR A;  3V8L A;  1UEB A;  5A5Q A;  1Y57 A;  1N9S A;  3OYM A;  5KYY B;  1RAH B;  4F16 A;  4BY6 C;  5G4R A;  1JSP B;  2X51 A;  3CCJ A;  1KD1 R;  5I86 A;  2RJF A;  2RNA A;  4EMK A;  3QJY A;  5CK9 A;  5FE2 A;  3JCM g;  3OSV A;  1RAA B;  4MZT A;  4NR9 A;  1EX4 A;  2QAZ A;  3NHN A;  2K5F A;  1T0J A;  2ECZ A;  4BI3 A;  3T9N A;  4C92 D;  4JUV A;  2E6Z A;  5BT4 A;  2EJ9 A;  3G7Z A;  1I5L A;  1VIF A;  4BI4 A;  1IXD A;  2OTL A;  4F3I A;  2GQI A;  7AT1 B;  2EKO A;  4YYH A;  5ENF A;  4FSS A;  2Y4Y A;  4YAX A;  5EIC A;  2QA4 A;  3JAM E;  4FL6 A;  2RM4 A;  3R6N A;  2JOY A;  2B8A A;  3M59 A;  1V29 B;  3GLX A;  5FG5 A;  2L84 A;  1ZUY A;  3LH0 A;  3CBM A;  1K9M R;  2K9G A;  2E7N A;  4YY4 A;  5C87 A;  1LNX A;  4J3I A;  1SG5 A;  2YWW A;  3TSW A;  8ATC B;  5E0R A;  4KUD K;  2LT1 A;  2C0O A;  4RKU E;  1WUG A;  2F6J A;  2JS2 A;  4J9D A;  5FU7 C;  3GNG A;  1KSW A;  1WIE A;  3VKH A;  4KH0 B;  1MMD A;  4E2F B;  1YI2 T;  4M7D E;  3ASK A;  4ALG A;  5FE9 A;  3HFN A;  5HM0 A;  2KBT A;  4MR5 A;  1QLY A;  1YBY A;  2L3Q A;  3EG0 A;  1NYF A;  1N72 A;  3QZT A;  4TT2 A;  4DA4 A;  4A9K A;  5LKX A;  4PJO F;  2C0T A;  3JB9 G;  2RI2 A;  3CCL A;  5CQ8 A;  3CCU T;  1SSH A;  1VQM T;  1ZHI A;  5D3L A;  4L6V 5;  1H92 A;  5I11 A;  2DTH A;  2G6F X;  2ZGW A;  4QR4 A;  3U5O A;  2CT4 A;  3GBQ A;  1YNZ A;  5E7D A;  3PIP A;  3V7R A;  1YCY A;  1MV3 A;  3QDF A;  6AT1 B;  3JCM f;  2RHU A;  2KNB B;  4RTW A;  3NXB A;  2KY9 A;  4UIY A;  4PK4 A;  3QO3 A;  4NR5 A;  3JSC A;  1OX9 A;  2M0Y A;  2YUP A;  1Y96 A;  3M4G A;  2L0A A;  4PJO C;  2H3J A;  4J5Y A;  4O5V A;  3G4S T;  1NJI C;  1ZX6 A;  2V1R A;  3MB3 A;  5FE4 A;  4CUU A;  3I5S A;  3P1F A;  5EQ1 A;  4OMN A;  1C0M A;  4M7A D;  5A5R A;  3QYG B;  5GMK m;  3EH1 A;  4A4F A;  2YUO A;  1VYT A;  2X3W D;  2B86 A;  2RQT A;  2F1L A;  2JM9 A;  5D24 A;  1B3Q A;  3EGU A;  1T3L A;  1D0X A;  5L8R E;  2AK5 A;  4KGZ B;  4MR4 A;  3IU6 A;  3MET A;  3GOX A;  2KAF A;  2DET A;  4RCC A;  3MHX A;  5LKU A;  1K9A A;  1PKS A;  2DXU A;  2OUO A;  5DFD A;  3MEU A;  4PFP A;  3KXT A;  2RJE A;  5EVA A;  2CP3 A;  4UYE A;  4RTT A;  5F25 A;  3SDZ A;  4M77 E;  4OB0 B;  1M1K U;  1VQ6 A;  4OVA A;  1JEG A;  3ERR A;  2R0Y A;  4QSR A;  2YEL A;  4YBM A;  3O33 A;  2EKH A;  5GAN 5;  4IIO A;  4M75 D;  2M16 A;  4XQ3 A;  3CD6 Q;  4HBY A;  3M55 A;  3CMA A;  2JS0 A;  5L97 A;  4QC1 A;  2L89 A;  4RTZ A;  1PC0 A;  5CU8 A;  1G8X A;  1RI9 A;  1SRM A;  4ATO A;  3SHW A;  4N4H A;  1VOM A;  2EAY A;  3UDC A;  3AHU A;  4BI8 B;  1I07 A;  2LQK A;  4A9N A;  5I1Q A;  4NUC A;  1NJI R;  5FE8 A;  4B9X A;  4C5H A;  2BE7 D;  4J9H A;  4JS5 A;  3RMS A;  2RHX A;  2P0Q A;  2I0N A;  4DON A;  2DEQ A;  2K7A A;  2K5I A;  4PJL A;  4O75 A;  5I80 A;  3C95 A;  3EAE A;  4ELZ C;  2KVQ G;  5KYW B;  1GXI E;  2FSA A;  1GFD A;  1X69 A;  3VS1 A;  4B9W A;  2DRK A;  3HP9 A;  4RTU A;  4QUT A;  4JJC A;  5KYN A;  4UYH A;  3L2W A;  4XUA A; 
#chains in the Genus database with same CATH homology
 5CUD A;  1D3B A;  2WP1 A;  4HXO A;  3H6Z A;  2RJC A;  1UGR B;  3OYN A;  4UYG A;  3X28 B;  4A9L A;  2YW5 A;  4X2I A;  4O7C A;  3RES A;  5HJC A;  3CXC A;  2HAX A;  5D7X A;  1M90 U;  4YBS A;  3M56 A;  4M78 G;  1WNL A;  2E10 A;  5A0L A;  1KQ2 A;  1UB4 A;  4FU6 A;  3MEW A;  5J0D A;  2PUO B;  2E5Q A;  4EMK C;  2E41 A;  1H3Z A;  4XTV A;  4Z6H A;  3ONI A;  5FE0 A;  4NR6 A;  4XU3 A;  3CXC S;  3OYF A;  4HCZ A;  4JLG A;  5I83 A;  5CPE A;  3BDL A;  3Q2E A;  5EPS A;  2MAM A;  4HXM A;  1FXX A;  3MUK A;  5HKC A;  3OS1 A;  3UVX A;  4C92 G;  4UIZ A;  2EWN A;  3OSS C;  4CUT A;  4ZN3 A;  4C8Q C;  4LYI A;  5KTX A;  5GAN d;  1I81 A;  5E9K A;  3SFM A;  5DFC A;  3ZYU A;  5AME A;  4A53 A;  1K8A C;  1BI2 A;  4LDX A;  3JCM Q;  2RI3 A;  4BJX A;  2LNV A;  5CO7 A;  4Z6I A;  5FH6 A;  5HEM A;  4LD9 K;  5HQ7 A;  4QSX A;  1BI0 A;  2CS7 A;  4ME7 A;  3OYY A;  4II1 A;  1VUB A;  3FIF A;  3CD6 T;  4ZTF A;  1YJ9 A;  4WIV A;  3OBW A;  4BW2 A;  3OYH A;  2XDB A;  4QC3 A;  4NQN A;  4BHW A;  4M7A E;  3MP1 A;  5ENG A;  5CUE A;  2JVV A;  4HXN A;  4PKL A;  4ALH A;  2GCX A;  5LVQ A;  4FT2 A;  5COI A;  4J6W A;  4YYN A;  2VYT A;  2F6N A;  3UVW A;  5ACY A;  5DBM A;  5E9Y A;  2GRC A;  5CQ3 A;  5CUB A;  4BW4 A;  5LJ2 A;  1BIA A;  4A4H A;  3M4Y A;  2NLU A;  4HT8 A;  5HFQ A;  3QXE B;  2YLB A;  3JB9 H;  4O7E A;  3JCM V;  4M75 E;  4LZS A;  5FE3 A;  2Y90 A;  5DM7 R;  3QPH A;  4D6W A;  1KQ1 A;  1X6O A;  4QSV A;  5GAN 3;  2RO0 A;  1PSF A;  4CUS A;  5GAN 6;  4MZP A;  1QVP A;  5F36 A;  4M7D A;  1VQL T;  3JB9 D;  4AKN A;  4KV4 A;  1W2B S;  1ZBX A;  4DQ2 A;  5E9I A;  3HL8 A;  2F69 A;  4CFL A;  3J81 E;  3U5J A;  4O72 A;  5CAI A;  4J7I A;  1VQ8 A;  3UV2 A;  5A5N A;  3FEO A;  1QVF A;  3CCM T;  1Q81 U;  2GQV A;  4IR5 A;  2LT4 A;  1UGQ B;  4E7I A;  4YTL A;  4C67 A;  4R55 A;  3JCM d;  2X35 A;  3CCJ T;  4YAB A;  3RUX A;  5IGN A;  3QZV A;  3P5O A;  3A8O B;  4C0Z A;  3M9Q A;  5F2P A;  1VQK A;  4KCX A;  2OTL T;  2FL7 A;  3CCE A;  1QVF S;  4NYW A;  4PJO A;  2QA4 T;  3LGF A;  3G0L A;  3L2R A;  4WF2 A;  5D6W A;  3A8H B;  5C6S A;  1KHI A;  2DZ9 A;  5DY7 A;  1KD1 U;  4F7U G;  2QQA A;  1X0J A;  2CZ0 B;  3LQH A;  2DIG A;  1XNI A;  4E7J A;  5FLX E;  4NRB A;  3I3J A;  2BUD A;  3CC2 A;  4IKF A;  1VQN A;  3MEV A;  3V7C A;  4XTX A;  3HRT A;  5CQ4 A;  4RMO A;  2KK4 A;  2RHY A;  5A2Q E;  3X20 B;  4EMK B;  3CCL T;  2DXC A;  3UVY A;  3LW5 E;  2DKG A;  5F60 A;  1K9M U;  5EWD A;  4N3W A;  2CZ6 B;  5FE6 A;  4XTZ A;  3ME9 A;  5FDZ A;  4N4G A;  3CCQ A;  4L5G A;  3CBO A;  3JCM W;  2KQW A;  3JB9 J;  4CUQ A;  3UV5 A;  2QDY B;  2ZCF B;  5L8U A;  1YHQ A;  4PCE A;  2RO1 A;  3CCS A;  5CTL A;  3CEY A;  5EU1 A;  4OMF B;  1YIT A;  5M9O A;  5GAN h;  4JS4 A;  2XDD A;  4DOV A;  3QZ5 B;  3LYI A;  1OZ2 A;  2EYQ A;  3FLG A;  4UIV A;  4J6Y A;  1VQP A;  1O9S A;  5LJ5 d;  5GAN f;  3CC4 A;  4ZTJ A;  4BD3 A;  3VUZ A;  1F68 A;  4OP0 A;  3CC7 A;  2G4A A;  2VGN A;  4X9C A;  3PTA A;  2GF7 A;  2K2V A;  2DVV A;  2O4X A;  4J0S A;  4TT4 A;  1KG1 A;  5FE5 A;  2OAU A;  1VQ6 T;  4QUU A;  2CZ1 B;  2EQJ A;  4FM4 B;  4FLP A;  4QEW A;  4IOQ A;  2RA2 A;  4E7H A;  1G3T A;  4A4K A;  3QSU A;  3CMA T;  4JRK A;  4HT9 A;  1VQ4 A;  4YAT A;  2YLC A;  1VQ7 A;  2RH2 A;  3G71 A;  4TS8 A;  1KC8 C;  2DVQ A;  3VYG A;  3FKM X;  5AMF A;  4C5I A;  5LKT A;  2QQB A;  4YYK A;  3FB9 A;  3V7S A;  3C4S A;  2BIV A;  2P4T A;  5A83 A;  4M7D F;  3OYG A;  2N9G A;  5GAO l;  3M54 A;  1N6A A;  4F7U B;  1BYM A;  5D3H A;  1B34 A;  5FU6 C;  5LL6 S;  3QDR B;  5GAM e;  4HXS A;  4QR5 A;  5II2 A;  1FX7 A;  3P8B B;  1QP3 A;  5GMK i;  3GIB A;  4YYD A;  3E9G A;  5CCA A;  3P1C A;  1NJI U;  5CQX A;  5F61 A;  5CQ5 A;  4M7D C;  5ENE A;  2E64 A;  3BW1 A;  4C8Q A;  1Q7Y C;  2FB7 A;  4YYG A;  3NTK A;  2M1H A;  2QEX T;  5I88 A;  3MQM A;  3RKX A;  4QR3 A;  4Q0N A;  5CRZ A;  4OGC A;  4OB1 B;  2RI5 A;  3JCM h;  5D3R A;  3Q2F A;  5G4S A;  4O6J A;  3MP8 A;  5E74 A;  4O70 A;  4JLI A;  3MB4 A;  1LOJ A;  5GAN 2;  3HHT B;  2RK1 A;  5LJ1 A;  3HFO A;  4NRC A;  1WUM A;  5L98 A;  3CME A;  1Y71 A;  4QVZ A;  4O7B A;  2VGM A;  5GMK e;  1D3B B;  4XTW A;  3HRU A;  4M77 F;  2LTO A;  5L96 A;  2DO3 A;  5CZG A;  4KT0 E;  5FB1 A;  2E65 A;  5LJ3 d;  2E70 A;  4QQ6 A;  2WAC A;  4WHW A;  2A7Y A;  3OS5 A;  3AAD A;  4IR4 A;  4M7D G;  4BAC A;  3P1D A;  4UYD A;  5LJ5 g;  3CCR A;  5C89 A;  4ZN1 A;  4XU0 A;  4LDY A;  4QSS A;  4M77 C;  5JI8 A;  3U5P A;  2JTM A;  1YJ9 T;  2A3L A;  1X75 C;  1QP2 A;  2Y4X A;  4IUP A;  4C0D C;  1JBM A;  5D3P A;  3V8J A;  3DB4 A;  2L3R A;  4UYF A;  2X4J A;  4ZQL A;  2E12 A;  4KV1 A;  1QW1 A;  1Q86 C;  3GP8 A;  4PJO G;  4Q5W A;  3GF5 A;  3RCW A;  4C66 A;  5LJ5 h;  5LJ5 j;  4M78 E;  5EWW A;  4HXL A;  3PFS A;  5LJ5 f;  4ZGD B;  2E1H A;  3S6W A;  3U5N A;  2RHI A;  2KTB B;  3JCM J;  2DTO A;  5A5O A;  1M5Q 1;  5E3D A;  5DW2 A;  3OQ5 A;  3ZBD A;  4MML A;  5EG2 A;  4J0R A;  2XID A;  2EJG A;  3HSB A;  5D3N A;  5KTU A;  5FB0 A;  2X4W A;  5I7X A;  4YH4 A;  5DYX A;  1U8R A;  5D26 A;  1M1K C;  4NL3 A;  1VQ8 T;  2QQR A;  1K8A U;  5JWM A;  2ZPF B;  5GAO n;  4C92 E;  2CGH A;  3I55 T;  5F1L A;  3NTI A;  4BY6 B;  1N8R C;  2YHT A;  5C7N A;  5KU3 A;  1E6I A;  5I29 A;  5EIS A;  4LYW A;  5GAO p;  3AQA A;  5CKD A;  5FU6 B;  4C8Q F;  4OB3 B;  4HXK A;  1JRI A;  5EGU A;  3VU3 C;  4Y03 A;  1YIJ A;  1VQK T;  5EWV A;  1O75 A;  3CCU A;  4FT4 A;  4TYL A;  2LDM A;  4NUD A;  3UPU A;  4XYA A;  2LC4 A;  3BFM A;  1X01 A;  4M7D B;  5DYA A;  5A81 A;  4RCB A;  1TH7 A;  5IT9 E;  4RG2 A;  5FU7 B;  3O8V A;  2KSS A;  5ETB A;  4LD6 A;  2DK3 A;  5IAY A;  5DLO A;  5I7Y A;  3LX7 A;  2K5L A;  4X9D A;  5HLS A;  3ZEH A;  5LJ3 g;  1I8F A;  4C5E A;  5CUC A;  2HQX A;  3CC2 T;  1VQN T;  4E96 A;  4KUI A;  3L2V A;  4A9H A;  5FFW A;  4YYJ A;  3RKW A;  3H8Z A;  3VJP A;  5GAO q;  1NPR A;  3RER A;  5A85 A;  4M7A C;  2DVS A;  3LQI A;  2WSF E;  3OYK A;  1M90 C;  2P0P A;  5DY9 A;  5E9L A;  4ELY C;  5LUU A;  4UIT A;  4LDU A;  2MWP A;  2RB6 A;  4IUV A;  3CCV A;  2F5T X;  5A0G A;  1XQH A;  3CCQ T;  2LSP B;  5D25 A;  5CY9 A;  5CKE A;  4PJO B;  4M75 F;  3O37 A;  3JRZ A;  2MWO A;  5CUA A;  2ZZD A;  2QTX A;  3G6E A;  1YHQ T;  3CCS T;  4E7L A;  1SSF A;  4LDV A;  2D9T A;  3SWN A;  5LJ3 h;  5EP7 A;  5LJ3 j;  4CUR A;  2E7O A;  4LR6 A;  2MJV B;  1VQ5 T;  1VQ9 A;  4J6X A;  4QSQ A;  2PVD B;  4M75 C;  5HFR A;  3FRN A;  1VQP T;  5LJ3 f;  2CKK A;  3SB2 A;  4WHU A;  5FG6 A;  4C8Q G;  5CP5 A;  3Q1J A;  3CC7 T;  4N4I A;  4EMG A;  1W4S A;  1JM4 B;  3C94 A;  2EQM A;  3GPL A;  3UT1 A;  1YJN A;  5HY6 A;  1WJS A;  2XDP A;  4TTE A;  2RNW A;  4TT6 A;  3SD4 A;  3I56 T;  1VQ4 T;  3DAI A;  4XTU A;  4UIW A;  3S91 A;  3QZS A;  4E47 A;  2R57 A;  2DD4 A;  2LRQ A;  1K73 C;  4TU4 A;  1VQ7 T;  2L5E A;  2OSS A;  4F7U E;  5ENB A;  3G71 T;  2K4Y A;  3A8M B;  4YAD A;  4YK0 A;  2K3Y A;  1HK9 A;  4IR3 A;  2XD0 A;  5DFB A;  3SVG A;  2K3X A;  5H1T A;  2ZPH B;  5FRN A;  3NFC A;  3O36 A;  5L8T A;  3HME A;  1VIE A;  4JRI A;  5GAN 8;  3PMT A;  4TU6 A;  5C8G A;  4QVC A;  3UW9 A;  1MGQ A;  5D3J A;  5DW1 A;  5HRX A;  4A9F A;  2WP2 A;  4MZM A;  5D3T A;  3F70 A;  2O4X B;  2HD0 A;  4DOW A;  3L2Q A;  4MMK A;  3LWH A;  2FVU A;  4PY6 A;  4M7D D;  4O78 A;  5F62 A;  3U5L A;  5IGM A;  4OGJ A;  3MUL A;  3S3O A;  4Y91 A;  4QNS A;  3N5B B;  3P8D A;  4NYX A;  1S72 A;  5J3B A;  4OGE A;  3PIO A;  5TCM A;  1WQ7 A;  2ZPG B;  4M77 A;  3PNW C;  5FH7 A;  5HCL A;  5TB6 A;  1BI3 A;  5AD2 A;  4HA8 A;  2ZPB B;  1VQO A;  4CUP A;  1OYX A;  2YRV A;  1RI0 A;  5EWC A;  1B34 B;  1QVG A;  5FBX A;  4P5N A;  2VV5 A;  2OO1 A;  3CME T;  5AD3 A;  4N0A C;  4PJO D;  5HQ5 A;  5CS8 A;  2K57 A;  4JDS A;  4TVR A;  2M9U A;  5FFV A;  2RHZ A;  4A4E A;  2XU8 A;  3OS0 A;  4HXP A;  4BE0 A;  1G3Y A;  4LDW A;  4GLK A;  4C8Q B;  3UVD A;  4YYM A;  3VKI A;  5LJ0 A;  4C5G A;  2VUB A;  3JVJ A;  4BUG A;  3A8L B;  4M78 A;  3WXM B;  4CL9 A;  1QVG S;  4UIU A;  4A9I A;  1IRE B;  2RFJ A;  5F63 A;  2JZ2 A;  5DKH A;  5EA1 A;  5ENH A;  4IUU A;  5A82 A;  4E7K A;  5DKD A;  1KD1 C;  3CCR T;  3UWN A;  4BDZ A;  3TRE A;  5KTW A;  2RNX A;  5KE2 A;  4RG8 A;  4QYD A;  2D9E A;  2LX9 A;  3O34 A;  5CQ7 A;  5DKC A;  1Y96 B;  2R5M A;  3R6O A;  3M53 A;  5CKB A;  3X26 B;  3FC3 A;  1Q82 C;  3M57 A;  1K9M C;  4Y28 E;  4PNO A;  3TCJ A;  4C92 A;  5I2S A;  3QII A;  4ZC9 A;  2HBP A;  3RIR A;  3SWN C;  3KUF A;  4XAX B;  5CVI A;  5DYC A;  3DLM A;  1ZS5 A;  5GAO r;  1VQL A;  4NYV A;  3VUB A;  4J8O A;  2RK2 A;  4Z1S A;  5ENC A;  4J83 A;  5E3G A;  2EQK A;  2I7K A;  4J7F A;  2WSC E;  2R58 A;  5HK0 A;  2H60 A;  4TQN A;  3O35 A;  4CFK A;  3OW2 A;  3PMI A;  4LZR A;  5A5P A;  4NUE A;  2YEK A;  4CRI A;  3E9F A;  5FRM A;  5HEL A;  1WGS A;  2RNY A;  4PKC C;  2EFI A;  1WJQ A;  2L5Q A;  2L85 A;  4NRA A;  4LDF A;  3OMG A;  2DAQ A;  3J80 E;  4UYF B;  4PTB A;  2VXE A;  4NQM A;  4YYI A;  4A9E A;  3QYH B;  4NXJ A;  2IG0 A;  4R56 A;  2NXB A;  3OW2 S;  3HRS A;  2E6N A;  3RKY A;  2MMP A;  5GAN e;  3JCM X;  5KE3 A;  1G3S A;  4BE1 A;  5CQ6 A;  4UIX A;  3HKS A;  1LJO A;  4M7A A;  1FWZ A;  2CZ7 B;  1JJ2 A;  3U5M A;  4NL2 A;  1HXD A;  5I89 A;  5H1V A;  2E3K A;  5EPR A;  3HPW A;  2V8I A;  1YIJ T;  1BKB A;  5DLQ E;  4QSW A;  1WPY A;  2VC8 A;  5I40 A;  3JB9 I;  2JN0 A;  5FE1 A;  4C8Q D;  1U1S A;  3DLL A;  1RL2 A;  1JJ2 S;  4QEU A;  2XIC A;  5IBN A;  1Q86 U;  2QQ9 A;  3WVD B;  5ENJ A;  5CUG A;  4Z1Q A;  1YJW A;  4M75 A;  1WJR A;  2MI6 A;  2O01 E;  3RMQ A;  3J7A F;  2YEM A;  4KUL A;  4C0F A;  4X34 A;  4PJO E;  1BIB A;  4HCB A;  2F5K A;  5J39 A;  3L1A A;  4LZ2 A;  2AHJ B;  2PVG B;  4BB7 A;  1MHN A;  2JTF A;  4M78 F;  3CCV T;  5IGK A;  5KH6 A;  2I8N A;  3OB9 A;  4NR7 A;  3X24 B;  2YDW A;  3LLR A;  3OYE A;  2XI9 A;  4F7U A;  3KBG A;  1XTD A;  4QYL A;  3G6E T;  2IVW A;  2M0O A;  3OYC A;  4OF1 A;  4UC4 A;  3S3N A;  2OTJ A;  4M78 C;  3SVF A;  5E73 A;  1N8R U;  5CQT A;  2HQE A;  1VQ9 T;  2D0Q B;  3QZ9 B;  3MO8 A;  4A4G A;  2FYK A;  3JCM e;  4C92 F;  5HRW A;  1P92 A;  4XK8 E;  5BT3 A;  5F5Z A;  5HRV A;  3D7C A;  1Y7X A;  4BW3 A;  5GMK l;  3JCM P;  5H85 A;  5DLX A;  1WQW A;  4JJN K;  4YH3 A;  3PGG A;  4M77 G;  5GAN 7;  5CFW A;  5A0D A;  3EFR A;  1YJN T;  4QQD A;  1OZ3 A;  3A8G B;  3OS2 A;  4C92 C;  2WSE E;  2DXB A;  4OUF A;  3C12 A;  3V8K A;  3FJP A;  2DVE A;  4O7A A;  3SWN B;  4QW2 A;  5EWH A;  4MDW A;  1M8V A;  4YBT A;  4IUR A;  4GPJ A;  1KQS A;  4A9M A;  2JUF A;  4QST A;  1M9S A;  5I21 A;  5L99 A;  4O76 A;  4MDX A;  4O7F A;  4EMH A;  3OYD A;  2X4Y A;  4GY5 A;  1YI2 A;  2PU9 B;  2QEX A;  3JCM c;  1EQF A;  3VYH B;  2JNG A;  4IR6 A;  4HBW A;  5C85 A;  4N0A A;  2PVO B;  2RD1 A;  3A5Z B;  1KQS S;  3CCE T;  4O74 A;  1VQM A;  5CQA A;  4FSX A;  3S3M A;  1N27 A;  5D6Y A;  5LKZ A;  5GAM d;  4BW1 A;  5A5S A;  5KCH A;  2DZC A;  3E19 A;  5HEN A;  4M7A F;  5D6X A;  2QI2 A;  5CRM A;  2R0S A;  3DKM A;  4MEQ A;  1S72 T;  5IG6 A;  3G4S A;  4A9O A;  5DYU A;  3QHS A;  2D82 A;  3M58 A;  2D6F A;  2XK0 A;  3JVL A;  5LJ5 e;  4MEN A;  2VXF A;  3CPW A;  2XG8 D;  4IOO A;  2KMT A;  2PQW A;  2L8D A;  2GFA A;  1VQO T;  4QVD A;  3DB3 A;  4ZW1 A;  3UV4 A;  3LGL A;  4C8Q E;  3E1S A;  3JVK A;  3HMF A;  5E9M A;  1M1G A;  1U1T A;  2XKO C;  4IUQ A;  3HMH A;  1AHJ B;  1PSE A;  3G0J A;  3MEA A;  5K29 A;  4PCI A;  5CQY A;  3CPW S;  2CYZ B;  2I2L A;  3QBY A;  3BDU A;  5C0M A;  2DWW A;  4Z02 A;  1YIT T;  5FFY A;  1NZ9 A;  1K73 U;  4QZS A;  4QB3 A;  2RI7 A;  5E9V A;  2EIF A;  5KO4 A;  5J26 A;  5IN1 A;  3SVH A;  3MXF A;  5DX4 A;  4NR4 A;  3CPF A;  4TZ2 A;  4HBV A;  4M77 B;  4HKE A;  3CC4 T;  1UGS B;  2FHD A;  5EV9 A;  4F7U F;  3WVE B;  2LCC A;  3QG1 A;  5F1H A;  5ETD A;  1IZ6 A;  3PT9 A;  4NS5 A;  4LYS A;  1XOV A;  4XY9 A;  3OBY A;  4TZ8 A;  4C0D B;  1W2B A;  4VUB A;  4M7A G;  4N4F A;  3OYJ A;  3JVM A;  2LVM A;  3L42 A;  4CI0 C;  4O71 A;  5AYF A;  5I2M A;  4BE2 A;  5FG4 A;  4YC9 A;  4M78 B;  5CIU A;  1DJ7 B;  1R8O B;  4EPC A;  1G5V A;  3L2Z A;  4XU2 A;  5CR2 A;  2HNI A;  5CKF A;  2DVR A;  5D0C A;  5EPB A;  2YQD A;  2EJF A;  4OGI A;  1UGP B;  3OY9 A;  3K2J A;  3GG3 A;  4LRG A;  2BKD N;  2EQU A;  4LC2 A;  3I55 A;  2R0V A;  4EDU A;  5EI4 A;  4J1P A;  4ZGE B;  4PLL A;  2XHC A;  4PLI A;  4M75 G;  1OI1 A;  3DWY A;  4V2S A;  3LWI A;  3URG A;  2ZPI B;  2R10 A;  3QJ6 A;  2DD5 A;  4QBM A;  2KDS A;  2QXF A;  1ZQ1 A;  3U5K A;  2X4X A;  3P8H A;  5GAN 4;  5EK9 A;  4L59 A;  3IU5 A;  3EFS A;  5GAM g;  4C92 B;  3X25 B;  2QQS A;  1H64 1;  5DLZ A;  3TLP A;  3MP6 A;  3ER0 A;  5EM3 A;  5II1 A;  2MF2 A;  1Y07 A;  5ENI A;  1M4Z A;  3LJW A;  2YYN A;  5LJ3 e;  2P0K A;  3CBP A;  4XTY A;  4A9J A;  2LQ8 A;  1N9R A;  4C0G A;  2DTI A;  5D3S A;  4MR6 A;  2DKW A;  5F3A A;  3TU4 K;  2DAT A;  3ZFJ A;  4PS5 A;  3M5A A;  1I4K 1;  4CLB A;  5KHM A;  3BY7 A;  2PUK B;  2V8J A;  5IID A;  5GAN g;  4JRP A;  1Q81 C;  4A54 A;  3FDR A;  3OYA A;  5BT5 A;  4XY8 A;  4ZGJ B;  3CD6 A;  1Q82 U;  2GFU A;  3P1E A;  5GAM h;  4BDY A;  5GAM j;  1KHC A;  4HCC A;  4MEO A;  3OA6 A;  5CGP A;  4KBM B;  4IOR A;  5GAM f;  4YY6 A;  5H1U A;  1KC8 U;  4O77 A;  5IGL A;  2RS9 B;  5KCO A;  3JCM b;  4XUB A;  1YJW T;  4QQG A;  3OYL A;  4MR3 A;  2DXT A;  4M77 D;  2R5A A;  1BI1 A;  3QKJ A;  4M7A B;  5CKH A;  5GAO m;  4Z93 A;  2C06 A;  4QEV A;  5A7C A;  2DIQ A;  4RVR A;  5FE7 A;  4OB2 B;  5GAN j;  3GNF B;  5FRO A;  2DJZ A;  1VQ5 A;  2G3R A;  4NOY A;  2LCL A;  1JB0 E;  1NPP A;  3OMC A;  3S92 A;  3L2U A;  4HBX A;  3JB9 F;  1NE8 A;  3LQJ A;  3TEE A;  3LXJ A;  5LVR A;  1Q7Y U;  4MEP A;  4QY4 A;  2RJD A;  2ZPE B;  5FH8 A;  4IUT A;  5GMK h;  4XU1 A;  5GMK j;  4NR8 A;  4M78 D;  4QSU A;  2DPP B;  3VV0 A;  2OTJ T;  5HK3 A;  4M75 B;  2V8K A;  4FIB A;  1M1F A;  1G3W A;  3MCA B;  1EIF A;  4Q0O A;  4QSP A;  3I56 A;  3INZ A;  3QUI A;  5HQ6 A;  4PL6 A;  3OYB A;  3OYI A;  4JRQ A;  5C4Q A;  3NTH A;  3CCM A;  4HXR A;  3V8L A;  1UEB A;  5A5Q A;  1N9S A;  3OYM A;  4BY6 C;  5G4R A;  1JSP B;  3CCJ A;  5I86 A;  2RJF A;  4EMK A;  3QJY A;  5CK9 A;  5FE2 A;  3JCM g;  3OSV A;  4MZT A;  4NR9 A;  2K5F A;  4BI3 A;  3T9N A;  4C92 D;  4JUV A;  2E6Z A;  5BT4 A;  2EJ9 A;  3G7Z A;  1I5L A;  1VIF A;  4BI4 A;  2OTL A;  4F3I A;  2EKO A;  4YYH A;  5ENF A;  2Y4Y A;  4YAX A;  5EIC A;  2QA4 A;  3JAM E;  4FL6 A;  2RM4 A;  2JOY A;  2B8A A;  3M59 A;  1V29 B;  3GLX A;  5FG5 A;  2L84 A;  3LH0 A;  3CBM A;  2E7N A;  4YY4 A;  5C87 A;  1LNX A;  4J3I A;  5E0R A;  4KUD K;  2LT1 A;  4RKU E;  1WUG A;  2F6J A;  5FU7 C;  3GNG A;  1YI2 T;  4M7D E;  3ASK A;  4ALG A;  5FE9 A;  3HFN A;  5HM0 A;  4MR5 A;  1YBY A;  1N72 A;  3QZT A;  4TT2 A;  4DA4 A;  4A9K A;  5LKX A;  4PJO F;  3JB9 G;  2RI2 A;  3CCL A;  5CQ8 A;  3CCU T;  1VQM T;  1ZHI A;  5D3L A;  4L6V 5;  2DTH A;  2ZGW A;  4QR4 A;  3U5O A;  5E7D A;  3PIP A;  3V7R A;  1YCY A;  3JCM f;  2RHU A;  3NXB A;  2KY9 A;  4UIY A;  3QO3 A;  4NR5 A;  3JSC A;  1Y96 A;  3M4G A;  4PJO C;  2H3J A;  4J5Y A;  4O5V A;  3G4S T;  1NJI C;  3MB3 A;  5FE4 A;  4CUU A;  3P1F A;  5EQ1 A;  4M7A D;  5A5R A;  3QYG B;  5GMK m;  4A4F A;  5D24 A;  5L8R E;  4MR4 A;  3IU6 A;  3MET A;  3GOX A;  2KAF A;  4RCC A;  3MHX A;  5LKU A;  2DXU A;  2OUO A;  5DFD A;  3MEU A;  3KXT A;  2RJE A;  5EVA A;  4UYE A;  5F25 A;  3SDZ A;  4M77 E;  4OB0 B;  1M1K U;  1VQ6 A;  4OVA A;  2R0Y A;  4QSR A;  2YEL A;  4YBM A;  3O33 A;  5GAN 5;  4M75 D;  4XQ3 A;  2M16 A;  4HBY A;  3M55 A;  3CMA A;  5L97 A;  4QC1 A;  2L89 A;  5CU8 A;  4ATO A;  4N4H A;  2EAY A;  3UDC A;  3AHU A;  4BI8 B;  2LQK A;  4A9N A;  5I1Q A;  4NUC A;  5FE8 A;  4B9X A;  4C5H A;  4JS5 A;  3RMS A;  2RHX A;  2P0Q A;  4DON A;  2DEQ A;  2K5I A;  4O75 A;  5I80 A;  3C95 A;  3EAE A;  4ELZ C;  2KVQ G;  1GXI E;  2FSA A;  4B9W A;  3HP9 A;  4QUT A;  4UYH A;  3L2W A;  4XUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...