4NS5A

Crystal structure of human bs69 bromo-zinc finger-pwwp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
185
Chain Sequence
b'QEMGTYLRFIVSRMKEVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger MYND domain-containing protein 11
molecule tags Transcription regulator
source organism Homo sapiens
publication title Crystal structure of human BS69 Bromo-ZnF-PWWP reveals its role in H3K36me3 nucleosome binding.
pubmed doi rcsb
total genus 66
structure length 185
sequence length 209
ec nomenclature
pdb deposition date 2013-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ns5A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ns5A02
1WUGA 4TT2A 3OMGA 5D3TA 5EICA 2JTFA 1G5VA 4QEUA 4NRCA 2YDWA 3DLMA 5I29A 2HQEA 2X4XA 2GRCA 5FE5A 5ETBA 4TT4A 5F61A 4B9XA 4C5EA 4QSVA 3O8VA 2OSSA 2X35A 5D3LA 2DATA 5C0MA 5LKUA 4RVRA 4QR3A 2RHZA 2L5EA 5LKXA 3PMTA 2EKOA 2RO0A 5DW1A 5F62A 4NYXA 2RI3A 1XNIA 3JVLA 5C8GA 4IUUA 2LVMA 2XDPA 4BW3A 4X34A 4A9IA 2JZ2A 2RJFA 3LX7A 2RI2A 5CU8A 2HQXA 4NRAA 5EM3A 2RHIA 4UITA 4NRBA 4QZSA 4YAXA 5FE6A 3O35A 3UV2A 5F1HA 4J3IA 2MWOA 3MB3A 3L2UA 3OYAA 2L84A 3GG3A 5FH7A 3ONIA 3MP6A 2LTOA 3P1CA 5A82A 5TB6A 2E6NA 4BW2A 4UYFA 3MO8A 2R5MA 4A9LA 5AD2A 3C4SA 4UIZA 5H1TA 5C89A 5IAYA 4CUTA 5J39A 3E9GA 3UVDA 3OY9A 4QYDA 4QR5A 3K2JA 4HXKA 5CQ6A 4UIYA 4O75A 5KCHA 5DFDA 3CEYA 5FROA 3HMHA 4O7FA 5D3RA 4PL6A 5EK9A 5HELA 5DYAA 5DKDA 3JVKA 4NYWA 4QSWA 5AMEA 4E7HA 4O70A 2FSAA 4Z1QA 4HBYA 5HRWA 1WJQA 4PY6A 5DFCA 3LYIA 5ENJA 4HXOA 4PCIA 4TT6A 1WGSA 2R0SA 2RJEA 4TQNA 1WJRA 5EPRA 4NR9A 3LQHA 4IOOA 5D3HA 5DKCA 3S3NA 5H85A 5A5NA 3OMCA 4LZSA 5CFWA 3OYHA 3OYGA 2OO1A 4IUVA 2R5AA 2LCCA 5ENIA 3OQ5A 5EWCA 5D3PA 3OYFA 4QC3A 4O7CA 2L3RA 4Z02A 5I7YA 2X4YA 5DW2A 3QZTA 4UYDA 5C6SA 3QBYA 5I80A 5HENA 3U5KA 4L59A 4YYHA 2IG0A 3LQIA 4QSPA 3U5OA 3NTKA 4BJXA 4O7BA 1H3ZA 4IR6A 5I88A 4YC9A 4QSTA 4CL9A 5HRXA 5EU1A 4IOQA 2RI7A 2DIGA 2RS9B 4Y03A 5L96A 3LQJA 4QUTA 5E9VA 5FE2A 2RFJA 5ACYA 2XK0A 3S6WA 2YRVA 5J0DA 4A9NA 5A5OA 4E7IA 4IKFA 4TZ2A 5L98A 5TCMA 3IU6A 5I89A 4NR4A 5H1VA 5D3NA 5LUUA 2DIQA 1OZ2A 5CUBA 5F1LA 5HFRA 5HLSA 2DAQA 3QKJA 3OYLA 5D25A 5D3JA 5F3AA 4YBSA 4BDZA 2L85A 3U5MA 5CQ3A 4MR3A 5A5QA 5I86A 3S92A 5DYCA 3ZYUA 4CFLA 4CURA 4HXPA 5FE7A 2O4XA 5I83A 4TS8A 4LRGA 2BIVA 4LYWA 4Z6IA 3SVFA 3MEWA 4A9MA 2EQUA 4OVAA 5D7XA 5EVAA 2YW5A 3ME9A 2RJCA 3NTIA 4RG2A 5FG6A 2LRQA 3ZEHA 2EQMA 2RHUA 4HXMA 5A83A 5FFVA 2R0YA 4OGJA 3UV4A 3O36A 2H60A 4A4GA 4YYGA 5E7DA 3LGFA 4A4HA 4BE0A 3MQMA 4A9HA 4LYSA 5A5SA 2P0KA 5I7XA 4QW2A 5A5RA 1OYXA 5KO4A 5FFYA 5ENBA 3O33A 3QZVA 5DLXA 5DBMA 5EPSA 5L99A 5M9OA 4KV4A 3OYKA 2F6JA 4QSUA 3L2RA 2YELA 4C66A 4YYMA 4N3WA 3UVXA 2NXBA 5CP5A 2D82A 4NR6A 3FEOA 5E74A 5AD3A 2EQJA 2YQDA 3U5JA 2F5KA 4J0SA 2O4XB 4PLLA 4O77A 1F68A 3AADA 3UWNA 5ENCA 4TU6A 5FH6A 4J0RA 5FE3A 4MENA 3SD4A 4B9WA 4IORA 4QUUA 2M1HA 3P1EA 5FB0A 3ASKA 5E9MA 2K3XA 4HBVA 4HBXA 4CFKA 5E9IA 3FLGA 4IUPA 5H1UA 4O72A 5CRMA 1X0JA 5IBNA 5FBXA 5EQ1A 1KHCA 4BD3A 5DYXA 4CUUA 5IGMA 4A9OA 5F60A 2YEKA 1MHNA 4MR4A 2CKKA 4O7EA 4QSSA 4A9FA 5FRMA 2RO1A 5FE1A 4UYEA 5CQ7A 3PNWC 5HQ5A 4QVZA 3OYNA 4E7KA 3QIIA 5HM0A 2PQWA 3IU5A 2GFUA 5ENGA 4YABA 5BT4A 5FE0A 2D9TA 2BKDN 3BDLA 3H6ZA 5AMFA 4UYGA 3UV5A 5KTWA 5HRVA 4LZ2A 5CGPA 3DB3A 4QSQA 2BUDA 3E9FA 4ALHA 5EWWA 4ZW1A 5CUDA 5FG4A 4IR4A 4QQGA 3G0LA 4YBTA 3QZSA 2M0OA 5FG5A 2KTBB 4NUCA 4PLIA 5ENFA 2DWWA 5EI4A 5CY9A 5COIA 3P1DA 2RNXA 3P8DA 4XY9A 4UIWA 4OGIA 3OYIA 4QSXA 3H8ZA 4ALGA 4YH3A 5F63A 2EFIA 2MWPA 3FC3A 5FE8A 4N4HA 4E96A 1SSFA 3OYJA 4LYIA 5HFQA 5FRNA 2E7NA 4KV1A 2N9GA 3AQAA 2RHYA 3MULA 3UVWA 4A9KA 4BDYA 2B8AA 4UYHA 2R58A 5I1QA 4AKNA 5CQ4A 5JI8A 4MEOA 5D0CA 4QY4A 5CQ8A 5I40A 4NS5A 4NYVA 4XUAA 5C85A 5KCOA 4A4FA 5G4RA 5FH8A 2WACA 5EISA 5FE4A 5HQ7A 3L2WA 3OYEA 4QC1A 5E9KA 4XY8A 2I8NA 4Q0NA 5F25A 2QQSA 2G4AA 4LR6A 5DKHA 3M9QA 3OS0A 4MR5A 3JVMA 5EP7A 4C5HA 4C5GA 4GPJA 5KU3A 3OYCA 2L89A 4X2IA 3L2QA 4IR5A 2NLUA 4QBMA 3LH0A 4N4GA 4BHWA 5F5ZA 2MJVB 5FDZA 5A7CA 3OS2A 5A85A 4QB3A 5A81A 5C4QA 3LXJA 4ZTJA 2M16A 5KE2A 4Z6HA 3FKMX 3NXBA 2E5QA 3JVJA 4MEPA 4LDFA 5D3SA 5II2A 3O34A 4YYNA 5II1A 3SVHA 1JM4B 4IURA 4QYLA 3Q2EA 5D6WA 4TZ8A 5DYUA 5LVQA 3HMFA 1WJSA 3MEUA 5HQ6A 4XYAA 5IGKA 3Q2FA 1JSPB 5L97A 4A9EA 4BACA 2DVSA 2YYNA 3L42A 4Q5WA 4IR3A 4HXLA 3NTHA 2RNWA 3S3MA 4UIXA 4IUTA 4Q0OA 4XUBA 5CRZA 2D9EA 5EGUA 4PCEA 5BT3A 5HCLA 4YYJA 1RI0A 4NR8A 4NQMA 4HBWA 5DFBA 5IG6A 4EDUA 5D6YA 2RHXA 3OA6A 2RNYA 2DVVA 2LSPB 5ENEA 4UC4A 3U5PA 4PS5A 4BW4A 5E3GA 1WUMA 5D26A 4ZC9A 5ENHA 4UIVA 3I3JA 5D6XA 4QEVA 4YY4A 3Q1JA 4KCXA 5CQ5A 2GFAA 3UT1A 3MXFA 5JWMA 4FLPA 4O76A 4QQDA 2I7KA 4A4EA 4YYKA 5CUEA 2E7OA 2RI5A 5L8TA 5E0RA 4NQNA 4MEQA 3UW9A 3DWYA 5LJ2A 2G3RA 3MP8A 4QNSA 2E3KA 2RJDA 5G4SA 3HMEA 3U5LA 5DLZA 5E9YA 4CUQA 3LGLA 3OYMA 5FE9A 1N72A 2X4WA 3MUKA 5HEMA 3S91A 3MB4A 4J1PA 5KE3A 5LVRA 5F2PA 4E7JA 3META 4NUEA 4N4FA 3OYBA 5IIDA 2R57A 1ZS5A 5EA1A 4LC2A 3U5NA 2QQRA 4NR5A 5BT5A 4TYLA 1EQFA 4NUDA 2DVRA 5ETDA 5EV9A 2GF7A 3P1FA 5E3DA 5CTLA 5EWHA 4YYIA 5DX4A 2K3YA 2LDMA 2YEMA 5C7NA 4Z93A 4NR7A 3OYDA 2EQKA 4YBMA 4LD6A 4TTEA 3PMIA 4CUPA 5E9LA 3O37A 1N27A 4CLBA 4LZRA 4YK0A 4IUQA 4O7AA 3PFSA 3OS1A 3EAEA 2R10A 5LKZA 4UYFB 5LJ1A 3TLPA 3L2VA 4WIVA 4N4IA 4PTBA 5IGLA 5EPBA 4QEWA 5KTUA 5CUCA 4BW1A 4HXRA 3D7CA 5F36A 3P5OA 2R0VA 4NXJA 4O74A 5LJ0A 3QJ6A 4UIUA 4BE1A 4HXSA 3S3OA 5CS8A 5L8UA 4II1A 4C67A 5CUGA 2L8DA 4ZTFA 3G0JA 2F6NA 5CIUA 4FL6A 3DAIA 5C87A 5DY7A 4A9JA 3MEAA 4YATA 4F3IA 4MR6A 3DB4A 3SVGA 5EWDA 5K29A 4Z1SA 3FDRA 4CRIA 2WP1A 4O78A 4BE2A 3RCWA 5FFWA 3LLRA 4WHWA 4HCZA 4ZQLA 4E7LA 5FB1A 4GY5A 4YYDA 4OUFA 3LJWA 4C5IA 5CQTA 1OI1A 3F70A 4TU4A 5HJCA 4QSRA 2FHDA 5CZGA 5A5PA 3GOXA 4YADA 4DONA 3MP1A 5LKTA 3MEVA 5IGNA 5CUAA 3OB9A 2WP2A 5EWVA 4WHUA 1E6IA 4QQ6A 4PKLA 5IN1A 5KH6A 5E73A 4YH4A 4HXNA 4FU6A 4O71A 5D24A 4QR4A 4YY6A 1OZ3A 4CUSA 5J26A 3P8HA 2DKWA 5CQAA 3UVYA 2VYTA 2DVQA 5CPEA 5KHMA 2OUOA 5KTXA 3KUFA
chains in the Genus database with same CATH superfamily
3OBYA 3OMGA 5EICA 3HTRA 4DEXA 2DA9A 1M5Q1 1MGQA 1WQWA 2JMAA 3EG9B 4C0GA 3VS0A 1QKWA 1MV0B 5FE5A 5ETBA 1AZGB 4F7UB 1G2BA 3O8VA 3CPWS 1K73U 5D3LA 2KRMA 3RR6A 3FJ5A 3RDVA 4PJOD 4QR3A 2DBKA 2OTJT 5CKEA 1X27A 2RI3A 1U3OA 5C8GA 3M59A 2DYIA 2MCNA 5FLXE 4DOVA 3ZL7C 2RI2A 1IXDA 3JCMJ 4PJOG 2RQUA 4YAXA 3M55A 4KBMB 5FE6A 2EW3A 4J3IA 3L2UA 5GAN2 2L84A 3GG3A 3ONIA 3MP6A 2CP0A 1YHQQ 2LTOA 1M3AA 5TB6A 1KG1A 1MUZA 1SKUB 4A9LA 1DJ7B 5H1TA 3E9GA 1QVGP 2BZYA 2QQ9A 3OY9A 1QP2A 2CH4W 3VU3C 4QR5A 2CYZB 5FROA 2DX1A 2VGMA 1IRXA 1NE8A 5DYAA 1I1JA 1OPKA 1Q86R 2COWA 2L3SA 5DFCA 5ENJA 2CP2A 2L0AA 1WGSA 5KYXB 3CCUT 5EPRA 4OB3B 5IHKA 4IOOA 4KUDK 3QHSA 2W10A 4XTWA 3OMCA 4LZSA 1SSHA 2EYQA 4IUVA 1WHJA 2R5AA 2DFUA 1VYTA 1ZX6A 2ROLA 2L3RA 3CCLA 5HY6A 2ZPIB 1HD3A 2AKKA 3QBYA 4M75G 5HENA 1BI1A 1QCOA 2IG0A 8ATCB 5LJ3d 1Q86U 1WXTA 3QZ9B 1NLPC 1RAIB 4BY6C 1QVGS 1KD1U 5L96A 2XK0A 5E9VA 5FE2A 4NL3A 5ACYA 2YRVA 3QYGB 1OQKA 3CMAA 5L98A 5TCMA 3IU6A 4D6WA 1WNLA 1YITT 4OGEA 3GP8A 1QW1A 4HT9A 3AT1B 4C8QB 1UGQB 5FU6C 3OYLA 2QEXQ 3U5MA 1MMDA 4OF1A 2SEMA 5I86A 2KEAA 3EG9A 1YI2T 2O4XA 1YNZA 2ZGWA 1K76A 4ELZC 2HNIA 4LYWA 4Z6IA 3SVFA 1IGUA 5EVAA 4OMPA 4XU0A 1UECA 3TSZA 5FG6A 3ZFJA 5A83A 5FFVA 3N5BB 4KH1B 3WVDB 4KULA 3TSWA 2HL5C 4M7DA 4YYGA 1M8VA 5FU7B 1QKXA 2PUKB 2CUDA 1VYVA 2P0KA 1WI7A 5I7XA 3JCMf 2AZSA 1OYXA 4E7SA 2B86A 5FFYA 2HKNA 5EPSA 4AG1C 4KV4A 3OYKA 3SWNB 3UVXA 4JRIA 3CCEQ 4F17A 4EPCA 1N8RC 2D82A 5E74A 5AD3A 2ZAEA 3NGPA 4C8QG 4HCBA 3UWNA 3M5AA 5ENCA 5FH6A 4J0RA 1BB9A 3SD4A 3QXEB 1OULA 4IORA 1YIJA 2Y4YA 3ASKA 2AIRB 1YIJT 2K3XA 2V26A 3PE0A 4CFKA 5E9IA 3JB9D 5H1UA 4O72A 1T0JA 5CRMA 1X0JA 1I81A 3CCSA 1KHCA 2HQHA 4BD3A 1D3BA 4A9OA 5F60A 2FEIA 2CKKA 5FWCA 4A9FA 3BY7A 1Q7YC 4UYEA 1A0NB 1HXDA 1M1GA 1R0CB 5EG2A 3CC2Q 4WCIA 2ZPEB 3H6ZA 4JJCA 1VQ9T 1VQKT 4FYXB 1M3CA 4LZ2A 2DBMA 3DB3A 4LUDA 5CUDA 3TREA 5FG4A 2DVJA 5KYUB 4YBTA 1YI2Q 2M0OA 5FG5A 4PLIA 1MV3A 3E19A 2DWWA 5EI4A 1MNDA 1UHCA 2RNXA 4OGIA 1I0CA 4ZGDB 1KC8C 5FRNA 4N4HA 9ATCB 3OYJA 4LYIA 1W4SA 2E7NA 4M78C 2MI6A 1TSFA 2C0TA 2L3PA 1UEBA 4XTZA 4JDSA 5KYUA 4LD9K 3CCJA 4UYHA 2K2VA 4M7DB 2R58A 3ULRB 5L23A 2DL4A 2MAMA 2FPFA 4C8QA 5GAMh 5JI8A 4J7IA 2D8JA 2PUOB 2YT6A 1K8AU 4AFUC 3L2WA 1B34A 2O9SA 1SG5A 2FPEA 5GAOq 1BBZA 3JV3A 1EZZB 1OX8A 4PJOE 1OOTA 1D0YA 2QQSA 1X75C 5DKHA 3RERA 3M9QA 2XD0A 3JVMA 5KU3A 2ESWA 3LH0A 4BHWA 5F5ZA 2E3HA 5A85A 4XTXA 5C4QA 3LXJA 1EIFA 4ZTJA 3EGDA 1NG2A 2OTLT 1YJNQ 5D3SA 1YFNA 2ZZDA 5II2A 3HRSA 1KFZA 4YYNA 2MOXA 5II1A 3JCMc 1WYXA 5DYUA 5D6WA 3CQTA 5HQ6A 3MEUA 4XYAA 5IGKA 2FVUA 4M78D 1VQMA 5L97A 2P0PA 2HBPA 4A9EA 1D1BA 1W70A 3L42A 4Q5WA 4HXLA 3GNGA 4EMKA 1VQ7A 3J80E 1WA7A 3OSSC 1NYFA 3M54A 1BCOA 5CRZA 1ZKRA 2D9EA 1VYUA 1W2BS 4PJOB 1VQ6A 1K0SA 2F69A 4ESRA 1S72T 3OYYA 1WX6A 5ENEA 3CCLQ 1VQOQ 4M75A 4PS5A 1UUEA 4M78F 5ENHA 2LQWA 4QEVA 5GAMg 3Q1JA 5CQ5A 2RQTA 3I55A 1RUWA 3E1SA 4A4EA 4YYKA 2O2OA 3C95A 5L8TA 5E0RA 4NQNA 3LW5E 1BCMA 2NYSA 3MP8A 2M51A 2E3KA 1NEBA 2PNIA 5E9YA 4CUQA 3OYMA 4PKCC 3G4SQ 5KYXA 3MUKA 2XDDA 4J1PA 2VV5A 4E7JA 2QTVA 3L1AA 1XTDA 1ZS5A 3M0TA 3U5NA 2QQRA 2WSFE 4TYLA 1B34B 1EQFA 4M7AE 1T3LA 2QDYB 2LX7A 5EWHA 2GNCA 2K3YA 1VQ8Q 2YEMA 4YBMA 1VQ6Q 4TTEA 3QWXX 1AWJA 1ZSZC 4YK0A 4O7AA 2YXYA 2KYBA 3EG2A 5LJ1A 3TLPA 4JRQA 1E7OA 2KT8A 2CDTA 3T9NA 4R55A 2LQKA 4QEWA 4PJLA 4HXRA 5F36A 3A5ZB 4NXJA 3JSCA 1TU0B 2DRMA 1QVFA 1VQNQ 5LJ0A 1H92A 2P4RA 4UIUA 2JS2A 3G6ET 3S3OA 2KROA 2CZ7B 3VV0A 1O75A 4C67A 2L8DA 1T0HA 1T3SA 4ZTFA 3M58A 3SHWA 3VS3A 1IB8A 2F2VA 4A9JA 4FM4B 3SVGA 4Z1SA 2DF6A 3CCMA 1IREB 2FZCB 3V7CA 5FFWA 3PVQA 3LLRA 5LJ5g 2XDBA 4C5IA 4KH0B 1ARKA 5HJCA 1S72A 2HL3A 5CZGA 2V8IA 2JJ9A 3G71T 1BI0A 5IGNA 5CUAA 4JLIA 1NYGA 2E4HA 2NUTA 3NMZC 3CMET 5D24A 4AMCA 5J26A 4M7AA 4NL2A 1G3WA 2DVQA 5CPEA 2ED0A 3M4YA 2OUOA 1NJIU 2KAFA 2YHTA 1WQ7A 1K9AA 3OW2S 1G5VA 4NRCA 1D09B 1D3BB 4RTVA 1QCNA 2MK5A 4RTZA 2X4XA 1Z9ZA 3NPFA 2XICA 4TT4A 2QASA 3CPWA 1GFDA 1M2VA 2YUNA 3EHRA 3RKWA 5C0MA 4RVRA 2RHZA 4C92D 1UDLA 3ZBDA 4F04B 2EKOA 1ZA1B 3CCMQ 4J9DA 4IUUA 1IGQA 1YJNA 4X34A 1IHWA 3CCRA 1J3TA 1LNXA 2WSCE 1YHQT 1X6GA 4ZN1A 1KD1C 4QZSA 1M3BA 3UV2A 2E6ZA 3MB3A 1RAGB 3V8JA 4DBRA 2RK2A 3OYAA 2E41A 2YRDA 2XHCA 1YWOA 3AHUA 5GAN8 5IHIA 2EQIA 3CMAT 5LJ5e 4UYFA 2NUPA 5HCKA 4M75D 3RMSA 3TVTA 2HSPA 2HKQB 3CC7T 2CP5A 1JO8A 3SB2A 4QYDA 1UGRB 3I35A 2LZ6B 2OTLA 5DFDA 1JXOA 3CEYA 2RB6A 4M7AF 4C92C 5DKDA 2YUQA 1WHHA 2YDLA 5GAN4 1Y96B 2YRCA 4Z1QA 1YJNT 3VS2A 1VIEA 3GIBA 4L6V5 1WJQA 1M27C 2MMPA 1K73C 2NUTB 4TQNA 1TH7A 1WJRA 2A0FB 2X3WD 3MPUB 2XIDA 5H85A 5A5NA 2ATCB 2QI2A 2XG8D 2X9HA 3OYHA 2EJ9A 3DLLA 4LE9A 2CT3A 5AYFA 2LCCA 4F7UF 5CK9A 3OQ5A 3GPLA 2QQAA 2EAYA 5DM7R 3OYFA 1VQKA 3R6NA 4UYDA 5DY9A 3JCMQ 3JCMP 5GAMf 5KYYB 3NTKA 3QDRB 4BJXA 2EYWA 1WHGA 4O7BA 2JMCA 1VQ5T 4YC9A 4CL9A 3VKHA 1AT1B 1RAHB 1R8OB 3LQJA 1YITA 4A9NA 5GMKm 2E1HA 4IKFA 5L8RE 5I89A 5D3NA 5LUUA 5CUBA 1QP3A 5HFRA 2OTJA 5F3AA 4YBSA 5FU7C 1YI2A 3PIOA 5A5QA 2RQVA 1JEGA 3ZYUA 2JXBA 1N5ZA 5DLOA 3EGDB 2F1LA 4J83A 1QVPA 4LRGA 4KGVB 1E6GA 3I56A 2DD4A 4M7DC 2EWNA 4OVAA 2EIFA 1MMNA 2M02A 3NTIA 3KBGA 2LRQA 1NLOC 2JVVA 2EQMA 4XU1A 1YJ9Q 4C0FA 1VQ8A 4JJDA 2JT4A 1S72Q 1OPLA 2E3IA 2H60A 3HRUA 3HL8A 4J9GA 5CO7A 1X43A 4BI4A 3LGFA 1Q86C 2YWWA 1M1KU 1PRLC 4EMGA 3H0IA 1X2KA 5KO4A 1WIEA 1PKSA 3M53A 1Y0MA 4M78G 3RESA 4E2FB 2LJ0A 4QSUA 1SPKA 2YUOA 2YELA 4C66A 4YYMA 2CREA 2VASA 4QT7A 1TOVA 4PJOC 4RKUE 1CKAA 4IIMA 1PSFA 4ELYC 1PRMC 4ME7A 5IXBA 4NR6A 3JCMh 1H641 4FYVB 3U5JA 4LDXA 1ZLMA 4O77A 1KIKA 1G3TA 1K4US 4E7ZA 2OJ2A 5FE3A 2EYYA 3BE3A 4DBHA 2F5TX 2AZVA 4B9WA 4C92E 2FYKA 3QYHB 1K9MU 1X2QA 4CC2A 3M0QA 1Y07A 4MDXA 3SEMA 2RA2A 2AKLA 1KC8U 4MZPA 4HBXA 1OX9A 2DRKA 2KSSA 1OU9A 5EQ1A 4CUUA 2YEKA 4MR4A 2LCSA 1WHMA 5FRMA 5CQ7A 3E2UA 3PNWC 3VS6A 2L3QA 4E7KA 3QIIA 5HM0A 1MMGA 2DL7A 3IU5A 1JU5C 2GFUA 5ENGA 4YABA 1ZUUA 4J9BA 3EG1A 2DVEA 1GFCA 5HKCA 3CCVA 1AEYA 5KTWA 4BB7A 2MYSA 2LC4A 4QSQA 2XMFA 3E9FA 4M7DD 4QQGA 2LT1A 2KNBB 5LJ5j 2K7AA 1PSEA 4OB2B 5ENFA 1RAFB 3RUXA 5CY9A 2DETA 3P1DA 4L5GA 3P8DA 4XY9A 3OYIA 3TQ7P 2MWPA 4PJOF 3EH1A 1PCXA 5FE8A 4E96A 5HFQA 2FL7A 3AQAA 2RHYA 2V1QA 1Q81R 3MULA 3UVWA 1FYNA 5GANd 3QDFA 4M7AB 4MEOA 5D0CA 5CQ8A 2DL3A 5I40A 2RQRA 4XUAA 4NYVA 1TUDA 2KXDA 4KRTA 5IH2A 2WACA 4J9CA 5I22A 3HSBA 1VQ8T 3CCQQ 4C8QD 2KBTA 5F25A 2H3JA 3JCMW 2G4AA 4O5VA 3O5ZA 4XQ3A 2Y4XA 4GPJA 2QEXA 3OYCA 4X2IA 2V8JA 4J9IA 3EGXB 3CCJQ 4QBMA 3VS1A 2DTOA 5A0GA 4TVRA 2XU8A 4C92F 2X3XD 5A81A 1HYOA 5KE2A 1M90U 1UGSB 1XOVA 3CBPA 4MEPA 4J7FA 2QXFA 3SVHA 1TWBA 5GANj 4QYLA 3Q2EA 5LVQA 2VUBA 1WJSA 3Q2FA 1JSPB 2KE9A 4BACA 2DVSA 1HSQA 2P0QA 4IR3A 4FT2A 1VQPA 1KQ2A 1V1CA 2JM8A 3ER0A 4UIXA 2GQIA 1YCSB 4Q0OA 1VQLA 4XUBA 5HCLA 1RACB 1RI0A 3CPWP 1VQLT 4HBWA 2RHXA 2C0IA 3OA6A 1VQKQ 1KQSA 2JS0A 1YP5A 3JB9H 4BW4A 1WFWA 1WUMA 5D26A 2NWMA 2V8KA 4UIVA 5D6XA 1YJ9A 4YY4A 5GANe 3CMEA 3MXFA 4IIOA 3VS5A 3FRNA 4FLPA 4FSXA 2I7KA 4RTUA 1VA7A 3UW9A 3PGGA 4M7AC 5G4SA 3HMEA 5DLZA 3LGLA 2OTJQ 2DL5A 2F2WA 5LJ3e 5FE9A 4AI6A 3UA7A 1QVFP 2J05A 5KE3A 5F2PA 4C8QE 5GAN7 2HDAA 5GAOp 5A0DA 1K9MC 4JZ3A 5BT5A 4GLKA 2A08A 4DBFA 3P1FA 1I8FA 1X6OA 5DX4A 4Z8AA 3I9QA 1ZSGA 1ZUYA 3I56T 4Z93A 4NR7A 4AFQC 5GAOm 4NOYA 2E12A 3PMIA 1O9SA 3O37A 1N27A 4CLBA 3J81E 1AWOA 2A3LA 4IUQA 4AG2C 3OS1A 3EAEA 2R10A 1LCKA 2GCXA 3L2VA 4WIVA 2RM4A 2VC8A 1IO6A 1KC8R 4KGXB 5CQYA 1KSWA 2J06A 4BW1A 3JAME 2DD5A 2DPPB 3P5OA 2R0VA 4M7DG 1VQ4Q 3X28B 3QJ6A 1YJWA 4R0KA 1U1TA 1H3HA 3THKA 1ZSZB 4HKEA 2F6NA 1UGVA 3DAIA 5C87A 2DJQA 4FT4A 4R56A 3CC7Q 4YATA 4F3IA 4MR6A 2EJFA 3D7SB 4RG8A 5CAIA 5EWDA 3FDRA 4CRIA 3RMQA 2WP1A 4O78A 1RLQC 2DL8A 3CC4A 3G71Q 3QWYA 4HCZA 1Q7YR 4ZQLA 1JJ2S 4Z89A 2D0NA 4YYDA 4OUFA 5D7UA 5CQXA 2RF0A 4TU4A 1WXUA 3KXTA 3GOXA 4YADA 4WTOB 1GXIE 2RNAA 2E70A 5EWVA 1D0XA 2VVKA 1E6IA 1K1ZA 4QQ6A 4PKLA 2QDLA 5KH6A 5GJVB 2JTMA 4HXNA 4FU6A 1OZ3A 4QR4A 4YY6A 4M77A 1G3SA 4LDYA 1JJ2P 3QO3A 2DTHA 4TT2A 2KGTA 1B07A 2JTFA 1TS9A 3CCUQ 3EG3A 1KJWA 1QCFA 2HQEA 1D1AA 3CXCA 4ZNXA 5F61A 4RCBA 5A2QE 4B9XA 3BFMA 3FJPA 2NUPB 4FW1A 3BW1A 1CKBA 2OSSA 1WPYA 2DATA 5LKUA 1VQOA 1G8XA 2LJ3A 2EYXA 2L5EA 5LKXA 3PMTA 5DW1A 5F62A 5CKBA 2CT4A 4NYXA 2EVRA 1NZ9A 3JVLA 1F1BB 1ZBJA 1VQ6T 2DERA 4EMKC 4FYWB 2E5KA 3OBWA 5KYWA 2LVMA 2XDPA 2EGEA 2DEUA 5KYYA 1AHJB 2BZXA 1JJ2A 2JZ2A 2RJFA 3LX7A 3C0CA 2HQXA 4NRAA 1Y57A 5LL6S 2CSQA 2RHIA 1VQMQ 2GGRA 4FIBA 4DOWA 4JS4A 4NRBA 4ZGEB 4XAXB 1BU1A 5FH7A 2KYMA 3X24B 4PJJA 2COYA 3GNFB 5GAOr 5A82A 3INZA 4BW2A 2DE0X 1Q81C 3VYGA 3QUIA 3C4SA 3JCMd 3TEEA 5IT9E 3K2JA 4HXKA 5CQ6A 5KCHA 3CMEQ 5D3RA 5EK9A 3H0FA 2FSAA 2CSIA 2JOYA 4BI3A 1AVZC 2X51A 1BIBA 1WHLA 3LYIA 1VQLQ 4PCIA 1CSKA 4TT6A 5GMKe 2R0SA 1UFFA 4NR9A 1VIFA 1OEBA 2K9GA 3H0HA 1WDXA 1K8AR 2EPDA 4M77F 1WLPB 5CFWA 1AZEA 3EHQA 3OYGA 1Q82R 3LWHA 5EWCA 3CCRT 4O7CA 2CP3A 4Z02A 2X4YA 2CZ0B 3QZTA 5C6SA 1K8AC 2HZYA 5I80A 3U5KA 2MF2A 4MZTA 4QSPA 3CXCP 4QSTA 1MNEA 5EU1A 4M77D 2DXTA 4IOQA 2RI7A 1VQNT 2DIGA 2RS9B 4QUTA 1C6VX 1UTIA 4CC7A 1VQNA 2LP5A 4PJOA 3EFRA 2K3BA 2K5FA 3VS7A 4NR4A 1NPPA 1N9RA 1OZ2A 1YWPA 1PUOA 3QKJA 2QAZA 3KFVA 4BDZA 2L85A 4C92B 5LJ3h 1LJOA 5CQ3A 2ENMA 4MR3A 3CMAQ 5DYCA 4AT1B 4CURA 4HXPA 2EJGA 4M7AG 1I07A 2BIVA 4RTYA 2SRCA 2JN0A 5GANh 1Q81U 3CPFA 3SWNA 3JB9I 2EQUA 4FSSA 2OAWA 2YW5A 3JCMb 2RJCA 3CCLT 1SRLA 4J6WA 3ZEHA 4X9DA 5CKDA 1GBRA 2KRNA 4A4GA 1RAEB 5E7DA 3EG0A 4RUGA 2VWFA 4A4HA 3CC4Q 3MQMA 4A9HA 4OMQA 3U23A 3UDCA 3V8LA 4ZN3A 4M78B 2KMTA 5ENBA 2CP6A 3O33A 3QZVA 2AK5A 5DBMA 2H3EB 5LJ3f 5M9OA 2I0NA 2I2LA 7AT1B 2NXBA 1RL2A 2A37A 1X01A 4PJMA 2RPNA 1K9MR 4HCKA 4LNPA 2EQJA 4M77E 2F5KA 5GAOl 4JRPA 1F68A 4F7UG 2K5LA 4TU6A 1W6XA 1VQMT 2P84A 1NJIR 4QUUA 2M1HA 4RTWA 5FB0A 5E9MA 4LDVA 4BUGA 3A8HB 1VQPT 2ZPHB 2FG0A 2KQWA 2LQ8A 3PTAA 4IUPA 2JM9A 1QWEA 3G71A 3DKMA 5DYXA 1UG1A 5GMKj 3G4SA 1MHNA 1YCYA 2O88A 4C8QF 1GCQC 4D8KA 1OU8A 5IHNA 2IVWA 3EH2A 1IHVA 3VUBA 1ZHIA 1SHFA 1V76A 2LNHB 1M2VB 3JB9J 1ZA2B 3UV5A 4Z88A 4F14A 4MZMA 2QQBA 2JTEA 3VYHB 4ALHA 5EWWA 3VKIA 3CCET 4ZW1A 4AFZC 3UATA 2FO0A 3G0LA 4PFOA 2VXFA 2DXUA 2E64A 3OW2A 2KTBB 4YTLA 3CCVQ 3R6OA 4Y91A 2KY9A 2D6FA 3CCQT 5GAMe 3H8ZA 4M77B 4ALGA 3FC3A 2K57A 2QGGA 3UF4A 1XJWB 1W2BA 1D1CA 2O9VA 4BDYA 4A9KA 2B8AA 1GCQA 2RMOA 1KQ1A 5I1QA 4AKNA 2QA4T 3NHNA 3JB9F 3D1DA 2DZ9A 4X9CA 3BDUA 4M75E 5LJ5d 4QY4A 1FX7A 4F7UA 1N8RU 1TXQA 5C85A 3WVEB 5KCOA 5G4RA 5FH8A 5EISA 5FE4A 5HQ7A 4C92G 3OYEA 4QC1A 2YLBA 4XY8A 3X26B 3OS5A 4Q0NA 3X25B 3I5RA 4LR6A 4E6RA 3OS0A 1E6HA 4C5HA 4EMKB 4F16A 5LJ3g 1NPRA 5A7CA 3OS2A 4QB3A 4HCCA 1U8RA 4Z6HA 3FKMX 3NXBA 1PD0A 2E5QA 4LDFA 3CXCS 3O34A 2DK3A 1WHKA 4IURA 5I21A 4RTXA 4OMLA 3I55Q 4GLMA 2RK1A 3NTHA 3CCMT 4X1VA 4LUEA 2J6OA 2L5QA 1R0BG 2HMAA 5BT3A 4NR8A 3EFSA 5DFBA 5IG6A 1M8MA 4EDUA 5D6YA 1TUCA 2E65A 4JJNK 5AT1B 2LNVA 4BI8B 4XK8E 1I5LA 2K6DA 4KCXA 3UT1A 2ZCFB 4J5YA 1TTHB 2OI3A 3M57A 5JWMA 5KYWB 3G6EA 3MKDA 1GL5A 1JXMA 1LPLA 1VQ5A 4QQDA 5CR2A 5CUEA 1VQ7Q 2E7OA 2RI5A 1G83A 4MEQA 3DWYA 4JZ4A 2A7YA 2G3RA 4QNSA 3WXMB 1PG5B 2E10A 3TU4K 3U5LA 2L2PA 3UPUA 1U5SA 4XTYA 1Q95G 4JPBW 4KT0E 5FU6B 3S91A 4OB0B 3P8BB 3A8LB 3META 1QMCA 4JLGA 1N8RR 2DEQA 5IIDA 1X6BA 2KXCA 2MPXC 2R57A 1VQOT 3CC2T 5EA1A 1LOJA 2EYZA 4LC2A 1RAAB 2DVRA 5ETDA 2GF7A 5E3DA 2DO3A 4YYIA 3RBBB 1U06A 2LDMA 5I11A 3OYDA 5CKFA 1D0ZA 4CUPA 1VQ7T 5E9LA 2XKOC 1AWXA 3MJXA 5LKZA 2JNGA 4N4IA 1UB4A 4XTVA 5IGLA 2KK4A 4ATOA 2JW4A 5EPBA 5GAN6 3D7CA 3HFNA 1VQ5Q 4O74A 3X20B 2KI7A 2K4YA 4HXSA 5CS8A 4A53A 3J7AF 2RD1A 2C0OA 4XU3A 5CUGA 3UA6A 3QPHA 3G0JA 4C0DB 5CIUA 4FL6A 5GJWB 4F7UE 5DY7A 2EBPA 3MEAA 4HVVA 2DM1A 2KVQG 2CGHA 5K29A 3RCWA 2K2MA 1JQQA 4WHWA 1RADB 2YUPA 4GY5A 4M75C 1OI1A 1FXXA 3F70A 1AD5A 2GTOA 4QSRA 2FHDA 3V7SA 4OMFB 3CCST 5LKTA 3MEVA 4C92A 4J8OA 3OB9A 3QG1A 1ZUKA 4GBQA 1VOMA 3MHXA 4PJNA 5IN1A 4YH4A 4QVCA 4MMKA 3REBB 4DQ2A 4M7DF 3P8HA 5GANg 2VYTA 1UHFA 3I56Q 4PFPA 2VXEA 2WSEE 1PNJA 1WUGA 2BE7D 1BI2A 3G7ZA 3JCMg 2G6FX 1NBEB 5D3TA 3A8MB 3D1BA 2EGCA 4QEUA 4HVUA 5IXFA 1VQPQ 2YDWA 3DLMA 5I29A 2W0ZA 2D1XA 2A28A 1UE9A 2GRCA 1I4K1 4C5EA 4QSVA 4MMLA 3GBQA 2X35A 4RMOA 4MDWA 2FB7A 4CI0C 2RO0A 1V29B 1WZOA 4HVWA 1XNIA 3CC2A 5ECAA 2D8HA 3SFMA 1OV3A 4BW3A 4Y28E 3L2ZA 4XU2A 3MCAB 4A9IA 3PIPA 2QA4A 1KQSS 1TUGB 5CU8A 5EM3A 1YIJQ 1BKBA 3QSUA 4UITA 2YSQA 3JCMV 3O35A 5F1HA 2Z0WA 3VUZA 2MWOA 5DLQE 5GAMj 4XTUA 3JCMe 2HEQA 2DILA 1U1SA 3RNJA 3P1CA 2E6NA 4LDWA 2F2XA 3MO8A 4K11A 2R5MA 5AD2A 2QEXT 1VQ9A 3M0PA 3GF5A 2DYBA 4UIZA 1MMAA 5C89A 2J6KA 4CUTA 2ABLA 4VUBA 5IAYA 5J39A 1HJDA 1QVFS 3UVDA 3G1JA 1B7TA 1QLYA 6AT1B 4PK4A 2YLCA 1Y71A 2DZCA 1IZ6A 4UIYA 4O75A 1SRMA 3H41A 3JCMX 1K73R 3HMHA 4O7FA 2Y90A 2PVGB 4PL6A 5HELA 4NYWA 3JVKA 5AMEA 4QSWA 2M0YA 4CC3A 1RABB 4E7HA 2DXCA 2O01E 4O70A 4WF2A 3ERRA 4HBYA 5HRWA 2K5IA 2LMJA 4PY6A 4HXOA 2GQVA 2FZGB 2RJEA 5GAOn 2C06A 3LQHA 5D3HA 1VQ4A 4M78A 5DKCA 4KUIA 3S3NA 3V8KA 3EFOB 3HP9A 2OO1A 2HAXA 4ZGJB 5ENIA 1PD1A 5D3PA 2HSEB 3CBOA 4QC3A 2RQWA 1S1NA 5I7YA 5DW2A 1JRIA 3REAB 4L59A 4M75F 2CUBA 4YYHA 2PVDB 3LQIA 3U5OA 3C94A 3RIRA 5GAN5 1H3ZA 4IR6A 5GANf 5I88A 3G6EQ 5HRXA 4M78E 3SWNC 4DBQA 1JBMA 1UJ0A 3QJYA 1VQ9Q 4PFZA 4Y03A 1M2OA 3S6WA 2CH4A 2QK0A 4CC4B 2RFJA 4LDUA 2H8HA 5J0DA 5A5OA 3A8OB 4E7IA 1M1FA 4TZ2A 5H1VA 1ZBXA 2DKGA 1Q82C 3GLXA 2DIQA 5F1LA 4HT8A 5HLSA 1KD1R 2DAQA 3URGA 5D25A 5D3JA 5J3BA 2NUZA 4RTTA 2J7IA 4E47A 1UJYA 3S92A 3HKSA 2RN8A 4CFLA 5FE7A 2ZPBB 2ROTA 2K79A 4OMOA 5I83A 4TS8A 4AKGA 3MEWA 4A9MA 1N9SA 5D7XA 1ABOA 3ME9A 4RG2A 4LN2A 2QYZA 3CCUA 1M1KR 2RHUA 1ACMB 4HXMA 1GBQA 1Y7XA 2R0YA 4OGJA 3UV4A 3O36A 1KQSP 1SEMA 2JUFA 3G4ST 4EIKA 2V1RA 4BE0A 4LYSA 2AHJB 5A5SA 1K0XA 2PVOB 4QKUA 4QW2A 5A5RA 5CKHA 2EKHA 1W1FA 5L99A 2DNUA 5DLXA 4A54A 3C12A 2F6JA 2ECZA 3L2RA 4OMMA 4BY6B 4C0ZA 4N3WA 1PKTA 5CP5A 2EJNA 3FEOA 1YBYA 2YQDA 2ZPFB 4OGCA 2O4XB 4J0SA 4PLLA 2XI9A 3JRZA 3AADA 3M0RA 3FB9A 3M0UA 4HXJA 1BK2A 4MENA 1H8KA 1FMVA 3P1EA 4HBVA 3JB9G 4ORZA 2OAUA 4OP0A 3FLGA 3FIFA 3VRZA 1EX4A 1QWFA 1XQHA 5A0LA 5IBNA 4M7DE 5FBXA 3EGXA 4AFSC 5HK0A 2PU9B 5IGMA 1GCPA 4O7EA 4QSSA 1ZSZA 2FPDA 3M4GA 2RO1A 5FE1A 4QVZA 5HQ5A 3OYNA 1M30A 2PQWA 2LX9A 2HD0A 5BT4A 5FE0A 2BTTA 2D9TA 1ZQ1A 2OTLQ 2BKDN 3BDLA 4LXCA 5AMFA 2FRWA 4UYGA 2ED1A 2FZKB 4D8DA 3A98A 5HRVA 4A63B 5CGPA 4Y92A 3CD6T 2BUDA 4JUVA 4M4ZA 4IR4A 2P4TA 1Q7YU 1QVGA 2D0QB 2BZ8A 3QZSA 4NUCA 1M90R 1BYMA 5COIA 4UIWA 4QSXA 3CCQA 4YH3A 5F63A 2EFIA 1BIAA 1SSFA 1TG0A 4KV1A 2N9GA 1M4ZA 5GAMd 2LT4A 1HK9A 3HFOA 1RI9A 5CQ4A 1Z9QA 2LQNA 2CZ1B 4C0DC 5KYNA 4NS5A 4A4FA 2IIMA 5HK3A 4OB1B 3A1PA 4M77C 1QQJA 5E9KA 1P92A 2HCKA 5GAN3 2I8NA 3V7RA 1PHTA 1M90C 3A8GB 3M56A 4MR5A 2HBWA 5EP7A 4C5GA 2AT1B 1AOJA 2L89A 3L2QA 4JS5A 4IR5A 2NLUA 4N4GA 3CD6Q 2QG9B 4EMHA 2MJVB 5FDZA 1YN8A 2CS7A 2QTXA 2M16A 1G3YA 3JVJA 1FMWA 3LWIA 1JM4B 2GTJA 2DJZA 4TZ8A 3QZ5B 4P5NA 3HMFA 1FMKA 3VRYA 1NEGA 1C0MA 2KDSA 5LJ5f 4AKHA 3NFCA 2MIOA 2YYNA 3CCRQ 4PNOA 2M9UA 3OSVA 2RNWA 5I2MA 5FWBA 3S3MA 1I5OB 1C1AA 4IUTA 4B6MA 2VGNA 1EFNA 1WXBA 5GMKh 5EGUA 4PCEA 3HHTB 1LVKA 4YYJA 4NQMA 4V2SA 2DMOA 3HPWA 2RNYA 2DVVA 2LSPB 4UC4A 3U5PA 4C8QC 5E3GA 2FRYA 3LH5A 4ZC9A 4J6XA 3I3JA 2KR3A 1YHQA 4J9EA 2GFAA 1NM7A 4OMNA 1W2BP 5I2SA 4O76A 3OW2P 1RLPC 1BI3A 3I55T 2IPOB 3HRTA 3I5SA 3IQLA 2DXBA 2J6FA 4DEYA 1B3QA 5LJ2A 3M0SA 1X69A 2RJDA 1R77A 4DA4A 1ABQA 3EGUA 1VUBA 5FW9A 2DTIA 2X4JA 2X4WA 1N72A 2GBQA 5HEMA 5GMKi 1N6AA 3MB4A 3PT9A 1KK7A 5LVRA 1GRIA 4NUEA 4N4FA 3OYBA 2OX7A 4M77G 3CCJT 2LJ1A 4M75B 4NR5A 5EC7A 4NUDA 5EV9A 4AKIA 5CTLA 4J9HA 4KGZB 4RCCA 4QVDA 5C7NA 2COZA 2EQKA 3CBMA 4LD6A 1NJIC 2QGFB 4LZRA 4J9FA 3PFSA 1YITQ 4UYFB 1KHIA 3PVLA 1JB0E 2A36A 3CD6A 3VKGA 1PWTA 4PTBA 4N0AC 5LJ3j 5KTUA 5CUCA 2RH2A 2QA4Q 1M1KC 2KT1A 4JRKA 1PC0A 2CP7A 4FYYB 3EFOA 3RKYA 1YJ9T 2PZ1A 4BE1A 3CC7A 1SHGA 4A4KA 5L8UA 5GMKl 2EGAA 4II1A 2VKNA 1Y96A 4N0AA 1SF9A 4HA8A 2VB6A 2DLPA 3SDZA 1YJWQ 4O6JA 2CZ6B 1AWWA 3DB4A 2BE9B 8AT1B 1FWZA 1Q82U 2ZPGB 1PM3A 3CC4T 4J6YA 4BE2A 1UGPB 3CCSQ 4E7LA 5FB1A 5CCAA 3LJWA 5CQTA 3VS4A 4FCYA 5A5PA 3TCJA 1VQ4T 2O31A 2LCLA 4DONA 3MP1A 4M7AD 2KRSA 5CVIA 2WP2A 4WHUA 1M9SA 4FW2A 5E73A 3RKXA 2PTKA 3H9NA 4O71A 4ANJA 3VJPA 4CUSA 1YJWT 2DKWA 5CQAA 3UVYA 5KHMA 5LJ5h 5KTXA 3KUFA 4JJBA 3CCEA 3CCVT
chains in the Genus database with same CATH topology
3OBYA 3OMGA 5EICA 1M5Q1 1MGQA 1WQWA 4C0GA 5FE5A 5ETBA 4F7UB 3O8VA 3CPWS 1K73U 5D3LA 4PJOD 4QR3A 2OTJT 5CKEA 2RI3A 5C8GA 3M59A 5FLXE 4DOVA 2RI2A 3JCMJ 4PJOG 4YAXA 3M55A 4KBMB 5FE6A 4J3IA 3L2UA 5GAN2 2L84A 3GG3A 3ONIA 3MP6A 2LTOA 5TB6A 1KG1A 4A9LA 1DJ7B 5H1TA 3E9GA 2QQ9A 3OY9A 1QP2A 3VU3C 4QR5A 2CYZB 5FROA 2VGMA 1NE8A 5DYAA 5DFCA 5ENJA 1WGSA 3CCUT 5EPRA 4OB3B 4IOOA 4KUDK 3QHSA 4XTWA 3OMCA 4LZSA 2EYQA 4IUVA 2R5AA 2L3RA 3CCLA 5HY6A 2ZPIB 3QBYA 4M75G 5HENA 1BI1A 2IG0A 5LJ3d 1Q86U 3QZ9B 4BY6C 1QVGS 1KD1U 5L96A 2XK0A 5E9VA 5FE2A 4NL3A 5ACYA 2YRVA 3QYGB 3CMAA 5L98A 5TCMA 3IU6A 4D6WA 1WNLA 1YITT 4OGEA 3GP8A 1QW1A 4HT9A 4C8QB 1UGQB 5FU6C 3OYLA 3U5MA 4OF1A 5I86A 1YI2T 2O4XA 2ZGWA 4ELZC 2HNIA 4LYWA 4Z6IA 3SVFA 5EVAA 4XU0A 5FG6A 3ZFJA 5A83A 5FFVA 3N5BB 3WVDB 4KULA 4M7DA 4YYGA 1M8VA 5FU7B 2PUKB 2P0KA 5I7XA 3JCMf 1OYXA 5FFYA 5EPSA 4KV4A 3OYKA 3SWNB 3UVXA 4JRIA 4EPCA 1N8RC 2D82A 5E74A 5AD3A 4C8QG 4HCBA 3UWNA 3M5AA 5ENCA 5FH6A 4J0RA 3SD4A 3QXEB 1YIJA 4IORA 2Y4YA 3ASKA 1YIJT 2K3XA 4CFKA 5E9IA 3JB9D 5H1UA 4O72A 5CRMA 1X0JA 1I81A 3CCSA 1KHCA 4BD3A 1D3BA 4A9OA 5F60A 2CKKA 4A9FA 3BY7A 1Q7YC 4UYEA 1HXDA 1M1GA 5EG2A 2ZPEB 3H6ZA 1VQKT 1VQ9T 4LZ2A 3DB3A 5CUDA 3TREA 5FG4A 4YBTA 2M0OA 5FG5A 4PLIA 3E19A 2DWWA 5EI4A 2RNXA 4OGIA 4ZGDB 1KC8C 5FRNA 4N4HA 3OYJA 4LYIA 1W4SA 2E7NA 4M78C 2MI6A 1UEBA 4XTZA 4JDSA 4LD9K 3CCJA 4UYHA 2K2VA 4M7DB 2R58A 2MAMA 4C8QA 5GAMh 5JI8A 4J7IA 2PUOB 1K8AU 3L2WA 1B34A 5GAOq 4PJOE 2QQSA 1X75C 5DKHA 3RERA 3M9QA 2XD0A 3JVMA 5KU3A 3LH0A 4BHWA 5F5ZA 5A85A 4XTXA 5C4QA 3LXJA 1EIFA 4ZTJA 2OTLT 5D3SA 2ZZDA 5II2A 3HRSA 4YYNA 5II1A 3JCMc 5D6WA 5DYUA 3MEUA 5HQ6A 4XYAA 5IGKA 2FVUA 4M78D 1VQMA 5L97A 2P0PA 2HBPA 4A9EA 3L42A 4Q5WA 4HXLA 3GNGA 4EMKA 1VQ7A 3J80E 3OSSC 3M54A 1W2BS 5CRZA 2D9EA 4PJOB 1VQ6A 2F69A 1S72T 3OYYA 5ENEA 4M75A 4PS5A 4M78F 5ENHA 4QEVA 5GAMg 3Q1JA 5CQ5A 3I55A 3E1SA 4A4EA 4YYKA 3C95A 5L8TA 5E0RA 4NQNA 3LW5E 3MP8A 2E3KA 5E9YA 4CUQA 3OYMA 4PKCC 3MUKA 2XDDA 4J1PA 2VV5A 4E7JA 3L1AA 1XTDA 1ZS5A 3U5NA 2QQRA 2WSFE 4TYLA 1B34B 1EQFA 4M7AE 2QDYB 5EWHA 2K3YA 2YEMA 4YBMA 4TTEA 4YK0A 4O7AA 5LJ1A 3TLPA 4JRQA 4R55A 3T9NA 2LQKA 4QEWA 4HXRA 5F36A 3A5ZB 4NXJA 3JSCA 1QVFA 5LJ0A 4UIUA 3G6ET 3S3OA 2CZ7B 3VV0A 1O75A 4C67A 2L8DA 4ZTFA 3M58A 4A9JA 4FM4B 3SVGA 4Z1SA 3CCMA 1IREB 3V7CA 5FFWA 3LLRA 5LJ5g 2XDBA 4C5IA 5HJCA 1S72A 5CZGA 2V8IA 3G71T 1BI0A 5IGNA 5CUAA 4JLIA 3CMET 5D24A 5J26A 4M7AA 4NL2A 1G3WA 2DVQA 5CPEA 3M4YA 2OUOA 1NJIU 2KAFA 2YHTA 1WQ7A 3OW2S 1G5VA 4NRCA 1D3BB 2X4XA 2XICA 4TT4A 3CPWA 3RKWA 5C0MA 4RVRA 2RHZA 4C92D 3ZBDA 2EKOA 4IUUA 1YJNA 4X34A 3CCRA 1LNXA 2WSCE 1YHQT 4ZN1A 1KD1C 4QZSA 3UV2A 2E6ZA 3MB3A 3V8JA 2RK2A 3OYAA 2E41A 2XHCA 3AHUA 5GAN8 3CMAT 5LJ5e 4UYFA 4M75D 3RMSA 3CC7T 3SB2A 4QYDA 1UGRB 2OTLA 5DFDA 3CEYA 2RB6A 4M7AF 4C92C 5DKDA 5GAN4 1Y96B 1YJNT 4Z1QA 3GIBA 1VIEA 4L6V5 1WJQA 2MMPA 1K73C 4TQNA 1TH7A 1WJRA 2XIDA 5H85A 5A5NA 2QI2A 2XG8D 3OYHA 3DLLA 2EJ9A 5AYFA 2LCCA 4F7UF 5CK9A 3OQ5A 3GPLA 2QQAA 2EAYA 5DM7R 3OYFA 1VQKA 4UYDA 5DY9A 3JCMQ 3JCMP 5GAMf 3NTKA 3QDRB 4BJXA 4O7BA 1VQ5T 4YC9A 4CL9A 1R8OB 3LQJA 1YITA 4A9NA 5GMKm 2E1HA 4IKFA 5L8RE 5I89A 5D3NA 5LUUA 5CUBA 1QP3A 5HFRA 2OTJA 5F3AA 4YBSA 5FU7C 1YI2A 3PIOA 5A5QA 3ZYUA 5DLOA 4J83A 1QVPA 4LRGA 3I56A 2DD4A 4M7DC 2EWNA 4OVAA 2EIFA 3NTIA 3KBGA 2LRQA 2JVVA 2EQMA 4XU1A 4C0FA 1VQ8A 2H60A 3HRUA 3HL8A 5CO7A 4BI4A 3LGFA 1Q86C 1M1KU 4EMGA 5KO4A 3M53A 4M78G 3RESA 4QSUA 2YELA 4C66A 4YYMA 4PJOC 4RKUE 1PSFA 4ELYC 4ME7A 4NR6A 3JCMh 1H641 3U5JA 4LDXA 4O77A 1G3TA 5FE3A 2F5TX 4B9WA 4C92E 2FYKA 3QYHB 1K9MU 1Y07A 4MDXA 2RA2A 1KC8U 4MZPA 4HBXA 2KSSA 5EQ1A 4CUUA 2YEKA 4MR4A 5FRMA 5CQ7A 3PNWC 4E7KA 3QIIA 5HM0A 3IU5A 2GFUA 5ENGA 4YABA 2DVEA 5HKCA 3CCVA 5KTWA 4BB7A 2LC4A 4QSQA 3E9FA 4M7DD 4QQGA 2LT1A 5LJ5j 1PSEA 4OB2B 5ENFA 3RUXA 5CY9A 3P1DA 4L5GA 3P8DA 4XY9A 3OYIA 2MWPA 4PJOF 5FE8A 4E96A 5HFQA 2FL7A 3AQAA 2RHYA 3MULA 3UVWA 5GANd 4M7AB 4MEOA 5D0CA 5CQ8A 5I40A 4XUAA 4NYVA 2WACA 3HSBA 1VQ8T 4C8QD 5F25A 2H3JA 3JCMW 2G4AA 4O5VA 4XQ3A 2Y4XA 4GPJA 2QEXA 3OYCA 4X2IA 2V8JA 4QBMA 2DTOA 5A0GA 4TVRA 2XU8A 4C92F 5A81A 5KE2A 1M90U 1UGSB 1XOVA 3CBPA 4MEPA 4J7FA 2QXFA 3SVHA 5GANj 4QYLA 3Q2EA 5LVQA 2VUBA 1WJSA 3Q2FA 1JSPB 4BACA 2DVSA 2P0QA 4IR3A 4FT2A 1VQPA 1KQ2A 3ER0A 4UIXA 4Q0OA 1VQLA 4XUBA 5HCLA 1RI0A 1VQLT 4HBWA 2RHXA 3OA6A 1KQSA 3JB9H 4BW4A 1WUMA 5D26A 2V8KA 4UIVA 5D6XA 1YJ9A 4YY4A 5GANe 3CMEA 3MXFA 3FRNA 4FLPA 4FSXA 2I7KA 3UW9A 3PGGA 4M7AC 5G4SA 3HMEA 5DLZA 3LGLA 5LJ3e 5FE9A 5KE3A 5F2PA 4C8QE 5GAN7 5GAOp 5A0DA 1K9MC 5BT5A 4GLKA 3P1FA 1I8FA 1X6OA 5DX4A 3I56T 4Z93A 4NR7A 5GAOm 4NOYA 2E12A 3PMIA 1O9SA 3O37A 1N27A 4CLBA 3J81E 2A3LA 4IUQA 3OS1A 3EAEA 2R10A 2GCXA 3L2VA 4WIVA 2RM4A 2VC8A 5CQYA 4BW1A 3JAME 2DD5A 2DPPB 3P5OA 2R0VA 4M7DG 3X28B 3QJ6A 1YJWA 1U1TA 4HKEA 2F6NA 3DAIA 5C87A 4FT4A 4R56A 4YATA 4F3IA 4MR6A 2EJFA 4RG8A 5CAIA 5EWDA 3FDRA 4CRIA 3RMQA 2WP1A 4O78A 3CC4A 4HCZA 1JJ2S 4ZQLA 4YYDA 4OUFA 5CQXA 4TU4A 3KXTA 3GOXA 4YADA 1GXIE 2E70A 5EWVA 1E6IA 4QQ6A 4PKLA 5KH6A 2JTMA 4HXNA 4FU6A 1OZ3A 4QR4A 4YY6A 4M77A 1G3SA 4LDYA 3QO3A 2DTHA 4TT2A 2JTFA 2HQEA 3CXCA 5F61A 4RCBA 5A2QE 4B9XA 3BFMA 3FJPA 3BW1A 2OSSA 1WPYA 2DATA 5LKUA 1VQOA 2L5EA 5LKXA 3PMTA 5DW1A 5F62A 5CKBA 4NYXA 1NZ9A 3JVLA 1VQ6T 4EMKC 3OBWA 2LVMA 2XDPA 1AHJB 1JJ2A 2JZ2A 2RJFA 3LX7A 2HQXA 4NRAA 5LL6S 2RHIA 4DOWA 4FIBA 4JS4A 4NRBA 4ZGEB 4XAXB 5FH7A 3X24B 3GNFB 5GAOr 5A82A 3INZA 4BW2A 1Q81C 3VYGA 3QUIA 3C4SA 3JCMd 3TEEA 5IT9E 3K2JA 4HXKA 5CQ6A 5KCHA 5D3RA 5EK9A 2FSAA 2JOYA 4BI3A 1BIBA 3LYIA 4PCIA 4TT6A 5GMKe 2R0SA 4NR9A 1VIFA 4M77F 5CFWA 3OYGA 3LWHA 5EWCA 3CCRT 4O7CA 4Z02A 2X4YA 2CZ0B 3QZTA 5C6SA 1K8AC 5I80A 3U5KA 2MF2A 4MZTA 4QSPA 4QSTA 5EU1A 4M77D 2DXTA 4IOQA 2RI7A 1VQNT 2DIGA 2RS9B 4QUTA 1VQNA 4PJOA 3EFRA 2K5FA 4NR4A 1NPPA 1N9RA 1OZ2A 3QKJA 4BDZA 2L85A 4C92B 5LJ3h 1LJOA 5CQ3A 4MR3A 5DYCA 4CURA 4HXPA 2EJGA 4M7AG 2BIVA 2JN0A 5GANh 1Q81U 3CPFA 3SWNA 3JB9I 2EQUA 2YW5A 3JCMb 2RJCA 3CCLT 4J6WA 3ZEHA 4X9DA 5CKDA 4A4GA 5E7DA 4A4HA 3MQMA 4A9HA 3UDCA 3V8LA 4ZN3A 4M78B 2KMTA 5ENBA 3O33A 3QZVA 5LJ3f 5DBMA 5M9OA 2I2LA 2NXBA 1RL2A 1X01A 2EQJA 4M77E 2F5KA 5GAOl 4JRPA 1F68A 4F7UG 2K5LA 4TU6A 1VQMT 4QUUA 2M1HA 5FB0A 5E9MA 4LDVA 4BUGA 3A8HB 1VQPT 2ZPHB 2KQWA 2LQ8A 3PTAA 4IUPA 3G71A 3DKMA 5DYXA 5GMKj 3G4SA 1MHNA 1YCYA 4C8QF 2IVWA 3VUBA 1ZHIA 3JB9J 3UV5A 4MZMA 2QQBA 3VYHB 4ALHA 5EWWA 3VKIA 3CCET 4ZW1A 3G0LA 2VXFA 2DXUA 2E64A 3OW2A 2KTBB 4YTLA 3R6OA 4Y91A 2KY9A 2D6FA 3CCQT 5GAMe 3H8ZA 4M77B 4ALGA 3FC3A 2K57A 1W2BA 4BDYA 4A9KA 2B8AA 1KQ1A 5I1QA 4AKNA 2QA4T 3JB9F 2DZ9A 4X9CA 3BDUA 4M75E 5LJ5d 4QY4A 1FX7A 4F7UA 1N8RU 5C85A 3WVEB 5KCOA 5G4RA 5FH8A 5EISA 5FE4A 5HQ7A 4C92G 3OYEA 4QC1A 2YLBA 4XY8A 3X26B 3OS5A 4Q0NA 3X25B 4LR6A 3OS0A 4C5HA 4EMKB 5LJ3g 1NPRA 5A7CA 3OS2A 4QB3A 4HCCA 1U8RA 4Z6HA 3FKMX 3NXBA 2E5QA 4LDFA 3CXCS 3O34A 2DK3A 4IURA 5I21A 2RK1A 3NTHA 3CCMT 2L5QA 5BT3A 4NR8A 3EFSA 5DFBA 5IG6A 4EDUA 5D6YA 2E65A 4JJNK 2LNVA 4BI8B 4XK8E 1I5LA 4KCXA 3UT1A 2ZCFB 4J5YA 3M57A 5JWMA 3G6EA 1VQ5A 4QQDA 5CR2A 5CUEA 2E7OA 2RI5A 4MEQA 3DWYA 2A7YA 2G3RA 4QNSA 3WXMB 2E10A 3TU4K 3U5LA 3UPUA 4XTYA 4KT0E 5FU6B 3S91A 4OB0B 3P8BB 3A8LB 3META 4JLGA 2DEQA 5IIDA 1VQOT 2R57A 3CC2T 5EA1A 1LOJA 4LC2A 2DVRA 5ETDA 2GF7A 5E3DA 2DO3A 4YYIA 2LDMA 3OYDA 5CKFA 4CUPA 1VQ7T 5E9LA 2XKOC 5LKZA 2JNGA 4N4IA 1UB4A 4XTVA 5IGLA 2KK4A 4ATOA 5EPBA 5GAN6 3D7CA 3HFNA 4O74A 3X20B 2K4YA 4HXSA 5CS8A 4A53A 3J7AF 2RD1A 4XU3A 5CUGA 3QPHA 3G0JA 4C0DB 5CIUA 4FL6A 4F7UE 5DY7A 3MEAA 2KVQG 2CGHA 5K29A 3RCWA 4WHWA 4GY5A 4M75C 1OI1A 1FXXA 3F70A 4QSRA 2FHDA 3V7SA 4OMFB 3CCST 5LKTA 3MEVA 4C92A 4J8OA 3OB9A 3QG1A 3MHXA 5IN1A 4YH4A 4QVCA 4MMKA 4DQ2A 4M7DF 3P8HA 5GANg 2VYTA 2VXEA 2WSEE 1WUGA 1BI2A 3G7ZA 3JCMg 5D3TA 3A8MB 4QEUA 2YDWA 3DLMA 5I29A 2GRCA 1I4K1 4C5EA 4QSVA 4MMLA 4RMOA 2X35A 4MDWA 2FB7A 4CI0C 2RO0A 1V29B 1XNIA 3CC2A 3SFMA 4BW3A 4Y28E 3L2ZA 4XU2A 3MCAB 4A9IA 3PIPA 2QA4A 1KQSS 5CU8A 5EM3A 3QSUA 1BKBA 4UITA 3JCMV 3O35A 5F1HA 3VUZA 2MWOA 5DLQE 5GAMj 4XTUA 3JCMe 1U1SA 3P1CA 2E6NA 4LDWA 3MO8A 2R5MA 5AD2A 2QEXT 1VQ9A 3GF5A 4UIZA 5C89A 5IAYA 4CUTA 4VUBA 5J39A 1QVFS 3UVDA 2YLCA 1Y71A 2DZCA 1IZ6A 4UIYA 4O75A 3JCMX 3HMHA 4O7FA 2Y90A 2PVGB 4PL6A 5HELA 4NYWA 3JVKA 5AMEA 4QSWA 4E7HA 2DXCA 2O01E 4O70A 4WF2A 4HBYA 5HRWA 2K5IA 4PY6A 4HXOA 2GQVA 2RJEA 5GAOn 2C06A 3LQHA 5D3HA 1VQ4A 4M78A 5DKCA 4KUIA 3S3NA 3V8KA 3HP9A 2OO1A 2HAXA 4ZGJB 5ENIA 5D3PA 3CBOA 4QC3A 5I7YA 5DW2A 1JRIA 4L59A 4M75F 4YYHA 2PVDB 3LQIA 3U5OA 3C94A 3RIRA 5GAN5 1H3ZA 4IR6A 5GANf 5I88A 5HRXA 4M78E 3SWNC 1JBMA 3QJYA 4Y03A 3S6WA 2RFJA 4LDUA 5J0DA 5A5OA 3A8OB 4E7IA 1M1FA 4TZ2A 5H1VA 1ZBXA 2DKGA 1Q82C 3GLXA 2DIQA 5F1LA 4HT8A 5HLSA 2DAQA 3URGA 5D25A 5D3JA 5J3BA 4E47A 3S92A 3HKSA 4CFLA 5FE7A 2ZPBB 5I83A 4TS8A 3MEWA 4A9MA 1N9SA 5D7XA 3ME9A 4RG2A 3CCUA 2RHUA 4HXMA 1Y7XA 2R0YA 4OGJA 3UV4A 3O36A 2JUFA 3G4ST 4BE0A 4LYSA 2AHJB 5A5SA 2PVOB 4QW2A 5A5RA 5CKHA 5L99A 5DLXA 4A54A 3C12A 2F6JA 3L2RA 4BY6B 4C0ZA 4N3WA 5CP5A 3FEOA 1YBYA 2YQDA 2ZPFB 4OGCA 2O4XB 4J0SA 4PLLA 2XI9A 3JRZA 3AADA 3FB9A 4MENA 3P1EA 4HBVA 3JB9G 2OAUA 4OP0A 3FLGA 3FIFA 1XQHA 5A0LA 5IBNA 4M7DE 5FBXA 5HK0A 2PU9B 5IGMA 4O7EA 4QSSA 3M4GA 2RO1A 5FE1A 4QVZA 5HQ5A 3OYNA 2PQWA 2LX9A 2HD0A 5BT4A 5FE0A 2D9TA 1ZQ1A 2BKDN 3BDLA 5AMFA 4UYGA 5HRVA 5CGPA 3CD6T 2BUDA 4JUVA 4IR4A 2P4TA 1Q7YU 1QVGA 2D0QB 3QZSA 4NUCA 1BYMA 5COIA 4UIWA 4QSXA 3CCQA 4YH3A 5F63A 2EFIA 1BIAA 1SSFA 4KV1A 2N9GA 1M4ZA 5GAMd 2LT4A 1HK9A 3HFOA 5CQ4A 2CZ1B 4C0DC 4NS5A 4A4FA 5HK3A 4OB1B 4M77C 5E9KA 1P92A 5GAN3 2I8NA 3V7RA 1M90C 3A8GB 3M56A 4MR5A 5EP7A 4C5GA 2L89A 3L2QA 4JS5A 4IR5A 2NLUA 4N4GA 4EMHA 2MJVB 5FDZA 2CS7A 2QTXA 2M16A 1G3YA 3JVJA 3LWIA 1JM4B 2DJZA 4TZ8A 3QZ5B 4P5NA 3HMFA 2KDSA 5LJ5f 3NFCA 2YYNA 4PNOA 2M9UA 3OSVA 2RNWA 5I2MA 3S3MA 4IUTA 2VGNA 5GMKh 5EGUA 4PCEA 3HHTB 4YYJA 4NQMA 4V2SA 3HPWA 2RNYA 2DVVA 2LSPB 4UC4A 3U5PA 4C8QC 5E3GA 4J6XA 4ZC9A 3I3JA 1YHQA 2GFAA 5I2SA 4O76A 1BI3A 3I55T 3HRTA 2DXBA 5LJ2A 2RJDA 4DA4A 1VUBA 2DTIA 2X4JA 2X4WA 1N72A 5HEMA 5GMKi 1N6AA 3MB4A 3PT9A 5LVRA 4NUEA 4N4FA 3OYBA 4M77G 3CCJT 4M75B 4NR5A 4NUDA 5EV9A 5CTLA 4RCCA 4QVDA 5C7NA 2EQKA 3CBMA 4LD6A 1NJIC 4LZRA 3PFSA 4UYFB 1KHIA 1JB0E 3CD6A 4PTBA 4N0AC 5LJ3j 5KTUA 5CUCA 2RH2A 1M1KC 4JRKA 3RKYA 1YJ9T 4BE1A 3CC7A 4A4KA 5L8UA 5GMKl 4II1A 1Y96A 4N0AA 4HA8A 3SDZA 4O6JA 2CZ6B 3DB4A 1FWZA 1Q82U 2ZPGB 3CC4T 4J6YA 4BE2A 1UGPB 4E7LA 5FB1A 5CCAA 3LJWA 5CQTA 5A5PA 3TCJA 1VQ4T 2LCLA 4DONA 3MP1A 4M7AD 5CVIA 2WP2A 4WHUA 1M9SA 5E73A 3RKXA 4O71A 3VJPA 4CUSA 1YJWT 2DKWA 5CQAA 3UVYA 5KHMA 5LJ5h 5KTXA 3KUFA 3CCEA 3CCVT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WUG A;  4TT2 A;  3OMG A;  5D3T A;  5EIC A;  2JTF A;  1G5V A;  4QEU A;  4NRC A;  2YDW A;  3DLM A;  5I29 A;  2HQE A;  2X4X A;  2GRC A;  5FE5 A;  5ETB A;  4TT4 A;  5F61 A;  4B9X A;  4C5E A;  4QSV A;  3O8V A;  2OSS A;  2X35 A;  5D3L A;  2DAT A;  5C0M A;  5LKU A;  4RVR A;  4QR3 A;  2RHZ A;  2L5E A;  5LKX A;  3PMT A;  2EKO A;  2RO0 A;  5DW1 A;  5F62 A;  4NYX A;  2RI3 A;  1XNI A;  3JVL A;  5C8G A;  4IUU A;  2LVM A;  2XDP A;  4BW3 A;  4X34 A;  4A9I A;  2JZ2 A;  2RJF A;  3LX7 A;  2RI2 A;  5CU8 A;  2HQX A;  4NRA A;  5EM3 A;  2RHI A;  4UIT A;  4NRB A;  4QZS A;  4YAX A;  5FE6 A;  3O35 A;  3UV2 A;  5F1H A;  4J3I A;  2MWO A;  3MB3 A;  3L2U A;  3OYA A;  2L84 A;  3GG3 A;  5FH7 A;  3ONI A;  3MP6 A;  2LTO A;  3P1C A;  5A82 A;  5TB6 A;  2E6N A;  4BW2 A;  4UYF A;  3MO8 A;  2R5M A;  4A9L A;  5AD2 A;  3C4S A;  4UIZ A;  5H1T A;  5C89 A;  5IAY A;  4CUT A;  5J39 A;  3E9G A;  3UVD A;  3OY9 A;  4QYD A;  4QR5 A;  3K2J A;  4HXK A;  5CQ6 A;  4UIY A;  4O75 A;  5KCH A;  5DFD A;  3CEY A;  5FRO A;  3HMH A;  4O7F A;  5D3R A;  4PL6 A;  5EK9 A;  5HEL A;  5DYA A;  5DKD A;  3JVK A;  4NYW A;  4QSW A;  5AME A;  4E7H A;  4O70 A;  2FSA A;  4Z1Q A;  4HBY A;  5HRW A;  1WJQ A;  4PY6 A;  5DFC A;  3LYI A;  5ENJ A;  4HXO A;  4PCI A;  4TT6 A;  1WGS A;  2R0S A;  2RJE A;  4TQN A;  1WJR A;  5EPR A;  4NR9 A;  3LQH A;  4IOO A;  5D3H A;  5DKC A;  3S3N A;  5H85 A;  5A5N A;  3OMC A;  4LZS A;  5CFW A;  3OYH A;  3OYG A;  2OO1 A;  4IUV A;  2R5A A;  2LCC A;  5ENI A;  3OQ5 A;  5EWC A;  5D3P A;  3OYF A;  4QC3 A;  4O7C A;  2L3R A;  4Z02 A;  5I7Y A;  2X4Y A;  5DW2 A;  3QZT A;  4UYD A;  5C6S A;  3QBY A;  5I80 A;  5HEN A;  3U5K A;  4L59 A;  4YYH A;  2IG0 A;  3LQI A;  4QSP A;  3U5O A;  3NTK A;  4BJX A;  4O7B A;  1H3Z A;  4IR6 A;  5I88 A;  4YC9 A;  4QST A;  4CL9 A;  5HRX A;  5EU1 A;  4IOQ A;  2RI7 A;  2DIG A;  2RS9 B;  4Y03 A;  5L96 A;  3LQJ A;  4QUT A;  5E9V A;  5FE2 A;  2RFJ A;  5ACY A;  2XK0 A;  3S6W A;  2YRV A;  5J0D A;  4A9N A;  5A5O A;  4E7I A;  4IKF A;  4TZ2 A;  5L98 A;  5TCM A;  3IU6 A;  5I89 A;  4NR4 A;  5H1V A;  5D3N A;  5LUU A;  2DIQ A;  1OZ2 A;  5CUB A;  5F1L A;  5HFR A;  5HLS A;  2DAQ A;  3QKJ A;  3OYL A;  5D25 A;  5D3J A;  5F3A A;  4YBS A;  4BDZ A;  2L85 A;  3U5M A;  5CQ3 A;  4MR3 A;  5A5Q A;  5I86 A;  3S92 A;  5DYC A;  3ZYU A;  4CFL A;  4CUR A;  4HXP A;  5FE7 A;  2O4X A;  5I83 A;  4TS8 A;  4LRG A;  2BIV A;  4LYW A;  4Z6I A;  3SVF A;  3MEW A;  4A9M A;  2EQU A;  4OVA A;  5D7X A;  5EVA A;  2YW5 A;  3ME9 A;  2RJC A;  3NTI A;  4RG2 A;  5FG6 A;  2LRQ A;  3ZEH A;  2EQM A;  2RHU A;  4HXM A;  5A83 A;  5FFV A;  2R0Y A;  4OGJ A;  3UV4 A;  3O36 A;  2H60 A;  4A4G A;  4YYG A;  5E7D A;  3LGF A;  4A4H A;  4BE0 A;  3MQM A;  4A9H A;  4LYS A;  5A5S A;  2P0K A;  5I7X A;  4QW2 A;  5A5R A;  1OYX A;  5KO4 A;  5FFY A;  5ENB A;  3O33 A;  3QZV A;  5DLX A;  5DBM A;  5EPS A;  5L99 A;  5M9O A;  4KV4 A;  3OYK A;  2F6J A;  4QSU A;  3L2R A;  2YEL A;  4C66 A;  4YYM A;  4N3W A;  3UVX A;  2NXB A;  5CP5 A;  2D82 A;  4NR6 A;  3FEO A;  5E74 A;  5AD3 A;  2EQJ A;  2YQD A;  3U5J A;  2F5K A;  4J0S A;  2O4X B;  4PLL A;  4O77 A;  1F68 A;  3AAD A;  3UWN A;  5ENC A;  4TU6 A;  5FH6 A;  4J0R A;  5FE3 A;  4MEN A;  3SD4 A;  4B9W A;  4IOR A;  4QUU A;  2M1H A;  3P1E A;  5FB0 A;  3ASK A;  5E9M A;  2K3X A;  4HBV A;  4HBX A;  4CFK A;  5E9I A;  3FLG A;  4IUP A;  5H1U A;  4O72 A;  5CRM A;  1X0J A;  5IBN A;  5FBX A;  5EQ1 A;  1KHC A;  4BD3 A;  5DYX A;  4CUU A;  5IGM A;  4A9O A;  5F60 A;  2YEK A;  1MHN A;  4MR4 A;  2CKK A;  4O7E A;  4QSS A;  4A9F A;  5FRM A;  2RO1 A;  5FE1 A;  4UYE A;  5CQ7 A;  3PNW C;  5HQ5 A;  4QVZ A;  3OYN A;  4E7K A;  3QII A;  5HM0 A;  2PQW A;  3IU5 A;  2GFU A;  5ENG A;  4YAB A;  5BT4 A;  5FE0 A;  2D9T A;  2BKD N;  3BDL A;  3H6Z A;  5AMF A;  4UYG A;  3UV5 A;  5KTW A;  5HRV A;  4LZ2 A;  5CGP A;  3DB3 A;  4QSQ A;  2BUD A;  3E9F A;  4ALH A;  5EWW A;  4ZW1 A;  5CUD A;  5FG4 A;  4IR4 A;  4QQG A;  3G0L A;  4YBT A;  3QZS A;  2M0O A;  5FG5 A;  2KTB B;  4NUC A;  4PLI A;  5ENF A;  2DWW A;  5EI4 A;  5CY9 A;  5COI A;  3P1D A;  2RNX A;  3P8D A;  4XY9 A;  4UIW A;  4OGI A;  3OYI A;  4QSX A;  3H8Z A;  4ALG A;  4YH3 A;  5F63 A;  2EFI A;  2MWP A;  3FC3 A;  5FE8 A;  4N4H A;  4E96 A;  1SSF A;  3OYJ A;  4LYI A;  5HFQ A;  5FRN A;  2E7N A;  4KV1 A;  2N9G A;  3AQA A;  2RHY A;  3MUL A;  3UVW A;  4A9K A;  4BDY A;  2B8A A;  4UYH A;  2R58 A;  5I1Q A;  4AKN A;  5CQ4 A;  5JI8 A;  4MEO A;  5D0C A;  4QY4 A;  5CQ8 A;  5I40 A;  4NS5 A;  4NYV A;  4XUA A;  5C85 A;  5KCO A;  4A4F A;  5G4R A;  5FH8 A;  2WAC A;  5EIS A;  5FE4 A;  5HQ7 A;  3L2W A;  3OYE A;  4QC1 A;  5E9K A;  4XY8 A;  2I8N A;  4Q0N A;  5F25 A;  2QQS A;  2G4A A;  4LR6 A;  5DKH A;  3M9Q A;  3OS0 A;  4MR5 A;  3JVM A;  5EP7 A;  4C5H A;  4C5G A;  4GPJ A;  5KU3 A;  3OYC A;  2L89 A;  4X2I A;  3L2Q A;  4IR5 A;  2NLU A;  4QBM A;  3LH0 A;  4N4G A;  4BHW A;  5F5Z A;  2MJV B;  5FDZ A;  5A7C A;  3OS2 A;  5A85 A;  4QB3 A;  5A81 A;  5C4Q A;  3LXJ A;  4ZTJ A;  2M16 A;  5KE2 A;  4Z6H A;  3FKM X;  3NXB A;  2E5Q A;  3JVJ A;  4MEP A;  4LDF A;  5D3S A;  5II2 A;  3O34 A;  4YYN A;  5II1 A;  3SVH A;  1JM4 B;  4IUR A;  4QYL A;  3Q2E A;  5D6W A;  4TZ8 A;  5DYU A;  5LVQ A;  3HMF A;  1WJS A;  3MEU A;  5HQ6 A;  4XYA A;  5IGK A;  3Q2F A;  1JSP B;  5L97 A;  4A9E A;  4BAC A;  2DVS A;  2YYN A;  3L42 A;  4Q5W A;  4IR3 A;  4HXL A;  3NTH A;  2RNW A;  3S3M A;  4UIX A;  4IUT A;  4Q0O A;  4XUB A;  5CRZ A;  2D9E A;  5EGU A;  4PCE A;  5BT3 A;  5HCL A;  4YYJ A;  1RI0 A;  4NR8 A;  4NQM A;  4HBW A;  5DFB A;  5IG6 A;  4EDU A;  5D6Y A;  2RHX A;  3OA6 A;  2RNY A;  2DVV A;  2LSP B;  5ENE A;  4UC4 A;  3U5P A;  4PS5 A;  4BW4 A;  5E3G A;  1WUM A;  5D26 A;  4ZC9 A;  5ENH A;  4UIV A;  3I3J A;  5D6X A;  4QEV A;  4YY4 A;  3Q1J A;  4KCX A;  5CQ5 A;  2GFA A;  3UT1 A;  3MXF A;  5JWM A;  4FLP A;  4O76 A;  4QQD A;  2I7K A;  4A4E A;  4YYK A;  5CUE A;  2E7O A;  2RI5 A;  5L8T A;  5E0R A;  4NQN A;  4MEQ A;  3UW9 A;  3DWY A;  5LJ2 A;  2G3R A;  3MP8 A;  4QNS A;  2E3K A;  2RJD A;  5G4S A;  3HME A;  3U5L A;  5DLZ A;  5E9Y A;  4CUQ A;  3LGL A;  3OYM A;  5FE9 A;  1N72 A;  2X4W A;  3MUK A;  5HEM A;  3S91 A;  3MB4 A;  4J1P A;  5KE3 A;  5LVR A;  5F2P A;  4E7J A;  3MET A;  4NUE A;  4N4F A;  3OYB A;  5IID A;  2R57 A;  1ZS5 A;  5EA1 A;  4LC2 A;  3U5N A;  2QQR A;  4NR5 A;  5BT5 A;  4TYL A;  1EQF A;  4NUD A;  2DVR A;  5ETD A;  5EV9 A;  2GF7 A;  3P1F A;  5E3D A;  5CTL A;  5EWH A;  4YYI A;  5DX4 A;  2K3Y A;  2LDM A;  2YEM A;  5C7N A;  4Z93 A;  4NR7 A;  3OYD A;  2EQK A;  4YBM A;  4LD6 A;  4TTE A;  3PMI A;  4CUP A;  5E9L A;  3O37 A;  1N27 A;  4CLB A;  4LZR A;  4YK0 A;  4IUQ A;  4O7A A;  3PFS A;  3OS1 A;  3EAE A;  2R10 A;  5LKZ A;  4UYF B;  5LJ1 A;  3TLP A;  3L2V A;  4WIV A;  4N4I A;  4PTB A;  5IGL A;  5EPB A;  4QEW A;  5KTU A;  5CUC A;  4BW1 A;  4HXR A;  3D7C A;  5F36 A;  3P5O A;  2R0V A;  4NXJ A;  4O74 A;  5LJ0 A;  3QJ6 A;  4UIU A;  4BE1 A;  4HXS A;  3S3O A;  5CS8 A;  5L8U A;  4II1 A;  4C67 A;  5CUG A;  2L8D A;  4ZTF A;  3G0J A;  2F6N A;  5CIU A;  4FL6 A;  3DAI A;  5C87 A;  5DY7 A;  4A9J A;  3MEA A;  4YAT A;  4F3I A;  4MR6 A;  3DB4 A;  3SVG A;  5EWD A;  5K29 A;  4Z1S A;  3FDR A;  4CRI A;  2WP1 A;  4O78 A;  4BE2 A;  3RCW A;  5FFW A;  3LLR A;  4WHW A;  4HCZ A;  4ZQL A;  4E7L A;  5FB1 A;  4GY5 A;  4YYD A;  4OUF A;  3LJW A;  4C5I A;  5CQT A;  1OI1 A;  3F70 A;  4TU4 A;  5HJC A;  4QSR A;  2FHD A;  5CZG A;  5A5P A;  3GOX A;  4YAD A;  4DON A;  3MP1 A;  5LKT A;  3MEV A;  5IGN A;  5CUA A;  3OB9 A;  2WP2 A;  5EWV A;  4WHU A;  1E6I A;  4QQ6 A;  4PKL A;  5IN1 A;  5KH6 A;  5E73 A;  4YH4 A;  4HXN A;  4FU6 A;  4O71 A;  5D24 A;  4QR4 A;  4YY6 A;  1OZ3 A;  4CUS A;  5J26 A;  3P8H A;  2DKW A;  5CQA A;  3UVY A;  2VYT A;  2DVQ A;  5CPE A;  5KHM A;  2OUO A;  5KTX A;  3KUF A; 
#chains in the Genus database with same CATH topology
 3OBY A;  3OMG A;  5EIC A;  3HTR A;  4DEX A;  2DA9 A;  1M5Q 1;  1MGQ A;  1WQW A;  2JMA A;  3EG9 B;  4C0G A;  3VS0 A;  1QKW A;  1MV0 B;  5FE5 A;  5ETB A;  1AZG B;  4F7U B;  1G2B A;  3O8V A;  3CPW S;  1K73 U;  5D3L A;  2KRM A;  3RR6 A;  3FJ5 A;  3RDV A;  4PJO D;  4QR3 A;  2DBK A;  2OTJ T;  5CKE A;  1X27 A;  2RI3 A;  1U3O A;  5C8G A;  3M59 A;  2DYI A;  2MCN A;  5FLX E;  4DOV A;  3ZL7 C;  2RI2 A;  1IXD A;  3JCM J;  4PJO G;  2RQU A;  4YAX A;  3M55 A;  4KBM B;  5FE6 A;  2EW3 A;  4J3I A;  3L2U A;  5GAN 2;  2L84 A;  3GG3 A;  3ONI A;  3MP6 A;  2CP0 A;  1YHQ Q;  2LTO A;  1M3A A;  5TB6 A;  1KG1 A;  1MUZ A;  1SKU B;  4A9L A;  1DJ7 B;  5H1T A;  3E9G A;  1QVG P;  2BZY A;  2QQ9 A;  3OY9 A;  1QP2 A;  2CH4 W;  3VU3 C;  4QR5 A;  2CYZ B;  5FRO A;  2DX1 A;  2VGM A;  1IRX A;  1NE8 A;  5DYA A;  1I1J A;  1OPK A;  1Q86 R;  2COW A;  2L3S A;  5DFC A;  5ENJ A;  2CP2 A;  2L0A A;  1WGS A;  5KYX B;  3CCU T;  5EPR A;  4OB3 B;  5IHK A;  4IOO A;  4KUD K;  3QHS A;  2W10 A;  4XTW A;  3OMC A;  4LZS A;  1SSH A;  2EYQ A;  4IUV A;  1WHJ A;  2R5A A;  2DFU A;  1VYT A;  1ZX6 A;  2ROL A;  2L3R A;  3CCL A;  5HY6 A;  2ZPI B;  1HD3 A;  2AKK A;  3QBY A;  4M75 G;  5HEN A;  1BI1 A;  1QCO A;  2IG0 A;  8ATC B;  5LJ3 d;  1Q86 U;  1WXT A;  3QZ9 B;  1NLP C;  1RAI B;  4BY6 C;  1QVG S;  1KD1 U;  5L96 A;  2XK0 A;  5E9V A;  5FE2 A;  4NL3 A;  5ACY A;  2YRV A;  3QYG B;  1OQK A;  3CMA A;  5L98 A;  5TCM A;  3IU6 A;  4D6W A;  1WNL A;  1YIT T;  4OGE A;  3GP8 A;  1QW1 A;  4HT9 A;  3AT1 B;  4C8Q B;  1UGQ B;  5FU6 C;  3OYL A;  2QEX Q;  3U5M A;  1MMD A;  4OF1 A;  2SEM A;  5I86 A;  2KEA A;  3EG9 A;  1YI2 T;  2O4X A;  1YNZ A;  2ZGW A;  1K76 A;  4ELZ C;  2HNI A;  4LYW A;  4Z6I A;  3SVF A;  1IGU A;  5EVA A;  4OMP A;  4XU0 A;  1UEC A;  3TSZ A;  5FG6 A;  3ZFJ A;  5A83 A;  5FFV A;  3N5B B;  4KH1 B;  3WVD B;  4KUL A;  3TSW A;  2HL5 C;  4M7D A;  4YYG A;  1M8V A;  5FU7 B;  1QKX A;  2PUK B;  2CUD A;  1VYV A;  2P0K A;  1WI7 A;  5I7X A;  3JCM f;  2AZS A;  1OYX A;  4E7S A;  2B86 A;  5FFY A;  2HKN A;  5EPS A;  4AG1 C;  4KV4 A;  3OYK A;  3SWN B;  3UVX A;  4JRI A;  3CCE Q;  4F17 A;  4EPC A;  1N8R C;  2D82 A;  5E74 A;  5AD3 A;  2ZAE A;  3NGP A;  4C8Q G;  4HCB A;  3UWN A;  3M5A A;  5ENC A;  5FH6 A;  4J0R A;  1BB9 A;  3SD4 A;  3QXE B;  1OUL A;  4IOR A;  1YIJ A;  2Y4Y A;  3ASK A;  2AIR B;  1YIJ T;  2K3X A;  2V26 A;  3PE0 A;  4CFK A;  5E9I A;  3JB9 D;  5H1U A;  4O72 A;  1T0J A;  5CRM A;  1X0J A;  1I81 A;  3CCS A;  1KHC A;  2HQH A;  4BD3 A;  1D3B A;  4A9O A;  5F60 A;  2FEI A;  2CKK A;  5FWC A;  4A9F A;  3BY7 A;  1Q7Y C;  4UYE A;  1A0N B;  1HXD A;  1M1G A;  1R0C B;  5EG2 A;  3CC2 Q;  4WCI A;  2ZPE B;  3H6Z A;  4JJC A;  1VQ9 T;  1VQK T;  4FYX B;  1M3C A;  4LZ2 A;  2DBM A;  3DB3 A;  4LUD A;  5CUD A;  3TRE A;  5FG4 A;  2DVJ A;  5KYU B;  4YBT A;  1YI2 Q;  2M0O A;  5FG5 A;  4PLI A;  1MV3 A;  3E19 A;  2DWW A;  5EI4 A;  1MND A;  1UHC A;  2RNX A;  4OGI A;  1I0C A;  4ZGD B;  1KC8 C;  5FRN A;  4N4H A;  9ATC B;  3OYJ A;  4LYI A;  1W4S A;  2E7N A;  4M78 C;  2MI6 A;  1TSF A;  2C0T A;  2L3P A;  1UEB A;  4XTZ A;  4JDS A;  5KYU A;  4LD9 K;  3CCJ A;  4UYH A;  2K2V A;  4M7D B;  2R58 A;  3ULR B;  5L23 A;  2DL4 A;  2MAM A;  2FPF A;  4C8Q A;  5GAM h;  5JI8 A;  4J7I A;  2D8J A;  2PUO B;  2YT6 A;  1K8A U;  4AFU C;  3L2W A;  1B34 A;  2O9S A;  1SG5 A;  2FPE A;  5GAO q;  1BBZ A;  3JV3 A;  1EZZ B;  1OX8 A;  4PJO E;  1OOT A;  1D0Y A;  2QQS A;  1X75 C;  5DKH A;  3RER A;  3M9Q A;  2XD0 A;  3JVM A;  5KU3 A;  2ESW A;  3LH0 A;  4BHW A;  5F5Z A;  2E3H A;  5A85 A;  4XTX A;  5C4Q A;  3LXJ A;  1EIF A;  4ZTJ A;  3EGD A;  1NG2 A;  2OTL T;  1YJN Q;  5D3S A;  1YFN A;  2ZZD A;  5II2 A;  3HRS A;  1KFZ A;  4YYN A;  2MOX A;  5II1 A;  3JCM c;  1WYX A;  5DYU A;  5D6W A;  3CQT A;  5HQ6 A;  3MEU A;  4XYA A;  5IGK A;  2FVU A;  4M78 D;  1VQM A;  5L97 A;  2P0P A;  2HBP A;  4A9E A;  1D1B A;  1W70 A;  3L42 A;  4Q5W A;  4HXL A;  3GNG A;  4EMK A;  1VQ7 A;  3J80 E;  1WA7 A;  3OSS C;  1NYF A;  3M54 A;  1BCO A;  5CRZ A;  1ZKR A;  2D9E A;  1VYU A;  1W2B S;  4PJO B;  1VQ6 A;  1K0S A;  2F69 A;  4ESR A;  1S72 T;  3OYY A;  1WX6 A;  5ENE A;  3CCL Q;  1VQO Q;  4M75 A;  4PS5 A;  1UUE A;  4M78 F;  5ENH A;  2LQW A;  4QEV A;  5GAM g;  3Q1J A;  5CQ5 A;  2RQT A;  3I55 A;  1RUW A;  3E1S A;  4A4E A;  4YYK A;  2O2O A;  3C95 A;  5L8T A;  5E0R A;  4NQN A;  3LW5 E;  1BCM A;  2NYS A;  3MP8 A;  2M51 A;  2E3K A;  1NEB A;  2PNI A;  5E9Y A;  4CUQ A;  3OYM A;  4PKC C;  3G4S Q;  5KYX A;  3MUK A;  2XDD A;  4J1P A;  2VV5 A;  4E7J A;  2QTV A;  3L1A A;  1XTD A;  1ZS5 A;  3M0T A;  3U5N A;  2QQR A;  2WSF E;  4TYL A;  1B34 B;  1EQF A;  4M7A E;  1T3L A;  2QDY B;  2LX7 A;  5EWH A;  2GNC A;  2K3Y A;  1VQ8 Q;  2YEM A;  4YBM A;  1VQ6 Q;  4TTE A;  3QWX X;  1AWJ A;  1ZSZ C;  4YK0 A;  4O7A A;  2YXY A;  2KYB A;  3EG2 A;  5LJ1 A;  3TLP A;  4JRQ A;  1E7O A;  2KT8 A;  2CDT A;  3T9N A;  4R55 A;  2LQK A;  4QEW A;  4PJL A;  4HXR A;  5F36 A;  3A5Z B;  4NXJ A;  3JSC A;  1TU0 B;  2DRM A;  1QVF A;  1VQN Q;  5LJ0 A;  1H92 A;  2P4R A;  4UIU A;  2JS2 A;  3G6E T;  3S3O A;  2KRO A;  2CZ7 B;  3VV0 A;  1O75 A;  4C67 A;  2L8D A;  1T0H A;  1T3S A;  4ZTF A;  3M58 A;  3SHW A;  3VS3 A;  1IB8 A;  2F2V A;  4A9J A;  4FM4 B;  3SVG A;  4Z1S A;  2DF6 A;  3CCM A;  1IRE B;  2FZC B;  3V7C A;  5FFW A;  3PVQ A;  3LLR A;  5LJ5 g;  2XDB A;  4C5I A;  4KH0 B;  1ARK A;  5HJC A;  1S72 A;  2HL3 A;  5CZG A;  2V8I A;  2JJ9 A;  3G71 T;  1BI0 A;  5IGN A;  5CUA A;  4JLI A;  1NYG A;  2E4H A;  2NUT A;  3NMZ C;  3CME T;  5D24 A;  4AMC A;  5J26 A;  4M7A A;  4NL2 A;  1G3W A;  2DVQ A;  5CPE A;  2ED0 A;  3M4Y A;  2OUO A;  1NJI U;  2KAF A;  2YHT A;  1WQ7 A;  1K9A A;  3OW2 S;  1G5V A;  4NRC A;  1D09 B;  1D3B B;  4RTV A;  1QCN A;  2MK5 A;  4RTZ A;  2X4X A;  1Z9Z A;  3NPF A;  2XIC A;  4TT4 A;  2QAS A;  3CPW A;  1GFD A;  1M2V A;  2YUN A;  3EHR A;  3RKW A;  5C0M A;  4RVR A;  2RHZ A;  4C92 D;  1UDL A;  3ZBD A;  4F04 B;  2EKO A;  1ZA1 B;  3CCM Q;  4J9D A;  4IUU A;  1IGQ A;  1YJN A;  4X34 A;  1IHW A;  3CCR A;  1J3T A;  1LNX A;  2WSC E;  1YHQ T;  1X6G A;  4ZN1 A;  1KD1 C;  4QZS A;  1M3B A;  3UV2 A;  2E6Z A;  3MB3 A;  1RAG B;  3V8J A;  4DBR A;  2RK2 A;  3OYA A;  2E41 A;  2YRD A;  2XHC A;  1YWO A;  3AHU A;  5GAN 8;  5IHI A;  2EQI A;  3CMA T;  5LJ5 e;  4UYF A;  2NUP A;  5HCK A;  4M75 D;  3RMS A;  3TVT A;  2HSP A;  2HKQ B;  3CC7 T;  2CP5 A;  1JO8 A;  3SB2 A;  4QYD A;  1UGR B;  3I35 A;  2LZ6 B;  2OTL A;  5DFD A;  1JXO A;  3CEY A;  2RB6 A;  4M7A F;  4C92 C;  5DKD A;  2YUQ A;  1WHH A;  2YDL A;  5GAN 4;  1Y96 B;  2YRC A;  4Z1Q A;  1YJN T;  3VS2 A;  1VIE A;  3GIB A;  4L6V 5;  1WJQ A;  1M27 C;  2MMP A;  1K73 C;  2NUT B;  4TQN A;  1TH7 A;  1WJR A;  2A0F B;  2X3W D;  3MPU B;  2XID A;  5H85 A;  5A5N A;  2ATC B;  2QI2 A;  2XG8 D;  2X9H A;  3OYH A;  2EJ9 A;  3DLL A;  4LE9 A;  2CT3 A;  5AYF A;  2LCC A;  4F7U F;  5CK9 A;  3OQ5 A;  3GPL A;  2QQA A;  2EAY A;  5DM7 R;  3OYF A;  1VQK A;  3R6N A;  4UYD A;  5DY9 A;  3JCM Q;  3JCM P;  5GAM f;  5KYY B;  3NTK A;  3QDR B;  4BJX A;  2EYW A;  1WHG A;  4O7B A;  2JMC A;  1VQ5 T;  4YC9 A;  4CL9 A;  3VKH A;  1AT1 B;  1RAH B;  1R8O B;  3LQJ A;  1YIT A;  4A9N A;  5GMK m;  2E1H A;  4IKF A;  5L8R E;  5I89 A;  5D3N A;  5LUU A;  5CUB A;  1QP3 A;  5HFR A;  2OTJ A;  5F3A A;  4YBS A;  5FU7 C;  1YI2 A;  3PIO A;  5A5Q A;  2RQV A;  1JEG A;  3ZYU A;  2JXB A;  1N5Z A;  5DLO A;  3EGD B;  2F1L A;  4J83 A;  1QVP A;  4LRG A;  4KGV B;  1E6G A;  3I56 A;  2DD4 A;  4M7D C;  2EWN A;  4OVA A;  2EIF A;  1MMN A;  2M02 A;  3NTI A;  3KBG A;  2LRQ A;  1NLO C;  2JVV A;  2EQM A;  4XU1 A;  1YJ9 Q;  4C0F A;  1VQ8 A;  4JJD A;  2JT4 A;  1S72 Q;  1OPL A;  2E3I A;  2H60 A;  3HRU A;  3HL8 A;  4J9G A;  5CO7 A;  1X43 A;  4BI4 A;  3LGF A;  1Q86 C;  2YWW A;  1M1K U;  1PRL C;  4EMG A;  3H0I A;  1X2K A;  5KO4 A;  1WIE A;  1PKS A;  3M53 A;  1Y0M A;  4M78 G;  3RES A;  4E2F B;  2LJ0 A;  4QSU A;  1SPK A;  2YUO A;  2YEL A;  4C66 A;  4YYM A;  2CRE A;  2VAS A;  4QT7 A;  1TOV A;  4PJO C;  4RKU E;  1CKA A;  4IIM A;  1PSF A;  4ELY C;  1PRM C;  4ME7 A;  5IXB A;  4NR6 A;  3JCM h;  1H64 1;  4FYV B;  3U5J A;  4LDX A;  1ZLM A;  4O77 A;  1KIK A;  1G3T A;  1K4U S;  4E7Z A;  2OJ2 A;  5FE3 A;  2EYY A;  3BE3 A;  4DBH A;  2F5T X;  2AZV A;  4B9W A;  4C92 E;  2FYK A;  3QYH B;  1K9M U;  1X2Q A;  4CC2 A;  3M0Q A;  1Y07 A;  4MDX A;  3SEM A;  2RA2 A;  2AKL A;  1KC8 U;  4MZP A;  4HBX A;  1OX9 A;  2DRK A;  2KSS A;  1OU9 A;  5EQ1 A;  4CUU A;  2YEK A;  4MR4 A;  2LCS A;  1WHM A;  5FRM A;  5CQ7 A;  3E2U A;  3PNW C;  3VS6 A;  2L3Q A;  4E7K A;  3QII A;  5HM0 A;  1MMG A;  2DL7 A;  3IU5 A;  1JU5 C;  2GFU A;  5ENG A;  4YAB A;  1ZUU A;  4J9B A;  3EG1 A;  2DVE A;  1GFC A;  5HKC A;  3CCV A;  1AEY A;  5KTW A;  4BB7 A;  2MYS A;  2LC4 A;  4QSQ A;  2XMF A;  3E9F A;  4M7D D;  4QQG A;  2LT1 A;  2KNB B;  5LJ5 j;  2K7A A;  1PSE A;  4OB2 B;  5ENF A;  1RAF B;  3RUX A;  5CY9 A;  2DET A;  3P1D A;  4L5G A;  3P8D A;  4XY9 A;  3OYI A;  3TQ7 P;  2MWP A;  4PJO F;  3EH1 A;  1PCX A;  5FE8 A;  4E96 A;  5HFQ A;  2FL7 A;  3AQA A;  2RHY A;  2V1Q A;  1Q81 R;  3MUL A;  3UVW A;  1FYN A;  5GAN d;  3QDF A;  4M7A B;  4MEO A;  5D0C A;  5CQ8 A;  2DL3 A;  5I40 A;  2RQR A;  4XUA A;  4NYV A;  1TUD A;  2KXD A;  4KRT A;  5IH2 A;  2WAC A;  4J9C A;  5I22 A;  3HSB A;  1VQ8 T;  3CCQ Q;  4C8Q D;  2KBT A;  5F25 A;  2H3J A;  3JCM W;  2G4A A;  4O5V A;  3O5Z A;  4XQ3 A;  2Y4X A;  4GPJ A;  2QEX A;  3OYC A;  4X2I A;  2V8J A;  4J9I A;  3EGX B;  3CCJ Q;  4QBM A;  3VS1 A;  2DTO A;  5A0G A;  4TVR A;  2XU8 A;  4C92 F;  2X3X D;  5A81 A;  1HYO A;  5KE2 A;  1M90 U;  1UGS B;  1XOV A;  3CBP A;  4MEP A;  4J7F A;  2QXF A;  3SVH A;  1TWB A;  5GAN j;  4QYL A;  3Q2E A;  5LVQ A;  2VUB A;  1WJS A;  3Q2F A;  1JSP B;  2KE9 A;  4BAC A;  2DVS A;  1HSQ A;  2P0Q A;  4IR3 A;  4FT2 A;  1VQP A;  1KQ2 A;  1V1C A;  2JM8 A;  3ER0 A;  4UIX A;  2GQI A;  1YCS B;  4Q0O A;  1VQL A;  4XUB A;  5HCL A;  1RAC B;  1RI0 A;  3CPW P;  1VQL T;  4HBW A;  2RHX A;  2C0I A;  3OA6 A;  1VQK Q;  1KQS A;  2JS0 A;  1YP5 A;  3JB9 H;  4BW4 A;  1WFW A;  1WUM A;  5D26 A;  2NWM A;  2V8K A;  4UIV A;  5D6X A;  1YJ9 A;  4YY4 A;  5GAN e;  3CME A;  3MXF A;  4IIO A;  3VS5 A;  3FRN A;  4FLP A;  4FSX A;  2I7K A;  4RTU A;  1VA7 A;  3UW9 A;  3PGG A;  4M7A C;  5G4S A;  3HME A;  5DLZ A;  3LGL A;  2OTJ Q;  2DL5 A;  2F2W A;  5LJ3 e;  5FE9 A;  4AI6 A;  3UA7 A;  1QVF P;  2J05 A;  5KE3 A;  5F2P A;  4C8Q E;  5GAN 7;  2HDA A;  5GAO p;  5A0D A;  1K9M C;  4JZ3 A;  5BT5 A;  4GLK A;  2A08 A;  4DBF A;  3P1F A;  1I8F A;  1X6O A;  5DX4 A;  4Z8A A;  3I9Q A;  1ZSG A;  1ZUY A;  3I56 T;  4Z93 A;  4NR7 A;  4AFQ C;  5GAO m;  4NOY A;  2E12 A;  3PMI A;  1O9S A;  3O37 A;  1N27 A;  4CLB A;  3J81 E;  1AWO A;  2A3L A;  4IUQ A;  4AG2 C;  3OS1 A;  3EAE A;  2R10 A;  1LCK A;  2GCX A;  3L2V A;  4WIV A;  2RM4 A;  2VC8 A;  1IO6 A;  1KC8 R;  4KGX B;  5CQY A;  1KSW A;  2J06 A;  4BW1 A;  3JAM E;  2DD5 A;  2DPP B;  3P5O A;  2R0V A;  4M7D G;  1VQ4 Q;  3X28 B;  3QJ6 A;  1YJW A;  4R0K A;  1U1T A;  1H3H A;  3THK A;  1ZSZ B;  4HKE A;  2F6N A;  1UGV A;  3DAI A;  5C87 A;  2DJQ A;  4FT4 A;  4R56 A;  3CC7 Q;  4YAT A;  4F3I A;  4MR6 A;  2EJF A;  3D7S B;  4RG8 A;  5CAI A;  5EWD A;  3FDR A;  4CRI A;  3RMQ A;  2WP1 A;  4O78 A;  1RLQ C;  2DL8 A;  3CC4 A;  3G71 Q;  3QWY A;  4HCZ A;  1Q7Y R;  4ZQL A;  1JJ2 S;  4Z89 A;  2D0N A;  4YYD A;  4OUF A;  5D7U A;  5CQX A;  2RF0 A;  4TU4 A;  1WXU A;  3KXT A;  3GOX A;  4YAD A;  4WTO B;  1GXI E;  2RNA A;  2E70 A;  5EWV A;  1D0X A;  2VVK A;  1E6I A;  1K1Z A;  4QQ6 A;  4PKL A;  2QDL A;  5KH6 A;  5GJV B;  2JTM A;  4HXN A;  4FU6 A;  1OZ3 A;  4QR4 A;  4YY6 A;  4M77 A;  1G3S A;  4LDY A;  1JJ2 P;  3QO3 A;  2DTH A;  4TT2 A;  2KGT A;  1B07 A;  2JTF A;  1TS9 A;  3CCU Q;  3EG3 A;  1KJW A;  1QCF A;  2HQE A;  1D1A A;  3CXC A;  4ZNX A;  5F61 A;  4RCB A;  5A2Q E;  4B9X A;  3BFM A;  3FJP A;  2NUP B;  4FW1 A;  3BW1 A;  1CKB A;  2OSS A;  1WPY A;  2DAT A;  5LKU A;  1VQO A;  1G8X A;  2LJ3 A;  2EYX A;  2L5E A;  5LKX A;  3PMT A;  5DW1 A;  5F62 A;  5CKB A;  2CT4 A;  4NYX A;  2EVR A;  1NZ9 A;  3JVL A;  1F1B B;  1ZBJ A;  1VQ6 T;  2DER A;  4EMK C;  4FYW B;  2E5K A;  3OBW A;  5KYW A;  2LVM A;  2XDP A;  2EGE A;  2DEU A;  5KYY A;  1AHJ B;  2BZX A;  1JJ2 A;  2JZ2 A;  2RJF A;  3LX7 A;  3C0C A;  2HQX A;  4NRA A;  1Y57 A;  5LL6 S;  2CSQ A;  2RHI A;  1VQM Q;  2GGR A;  4FIB A;  4DOW A;  4JS4 A;  4NRB A;  4ZGE B;  4XAX B;  1BU1 A;  5FH7 A;  2KYM A;  3X24 B;  4PJJ A;  2COY A;  3GNF B;  5GAO r;  5A82 A;  3INZ A;  4BW2 A;  2DE0 X;  1Q81 C;  3VYG A;  3QUI A;  3C4S A;  3JCM d;  3TEE A;  5IT9 E;  3K2J A;  4HXK A;  5CQ6 A;  5KCH A;  3CME Q;  5D3R A;  5EK9 A;  3H0F A;  2FSA A;  2CSI A;  2JOY A;  4BI3 A;  1AVZ C;  2X51 A;  1BIB A;  1WHL A;  3LYI A;  1VQL Q;  4PCI A;  1CSK A;  4TT6 A;  5GMK e;  2R0S A;  1UFF A;  4NR9 A;  1VIF A;  1OEB A;  2K9G A;  3H0H A;  1WDX A;  1K8A R;  2EPD A;  4M77 F;  1WLP B;  5CFW A;  1AZE A;  3EHQ A;  3OYG A;  1Q82 R;  3LWH A;  5EWC A;  3CCR T;  4O7C A;  2CP3 A;  4Z02 A;  2X4Y A;  2CZ0 B;  3QZT A;  5C6S A;  1K8A C;  2HZY A;  5I80 A;  3U5K A;  2MF2 A;  4MZT A;  4QSP A;  3CXC P;  4QST A;  1MNE A;  5EU1 A;  4M77 D;  2DXT A;  4IOQ A;  2RI7 A;  1VQN T;  2DIG A;  2RS9 B;  4QUT A;  1C6V X;  1UTI A;  4CC7 A;  1VQN A;  2LP5 A;  4PJO A;  3EFR A;  2K3B A;  2K5F A;  3VS7 A;  4NR4 A;  1NPP A;  1N9R A;  1OZ2 A;  1YWP A;  1PUO A;  3QKJ A;  2QAZ A;  3KFV A;  4BDZ A;  2L85 A;  4C92 B;  5LJ3 h;  1LJO A;  5CQ3 A;  2ENM A;  4MR3 A;  3CMA Q;  5DYC A;  4AT1 B;  4CUR A;  4HXP A;  2EJG A;  4M7A G;  1I07 A;  2BIV A;  4RTY A;  2SRC A;  2JN0 A;  5GAN h;  1Q81 U;  3CPF A;  3SWN A;  3JB9 I;  2EQU A;  4FSS A;  2OAW A;  2YW5 A;  3JCM b;  2RJC A;  3CCL T;  1SRL A;  4J6W A;  3ZEH A;  4X9D A;  5CKD A;  1GBR A;  2KRN A;  4A4G A;  1RAE B;  5E7D A;  3EG0 A;  4RUG A;  2VWF A;  4A4H A;  3CC4 Q;  3MQM A;  4A9H A;  4OMQ A;  3U23 A;  3UDC A;  3V8L A;  4ZN3 A;  4M78 B;  2KMT A;  5ENB A;  2CP6 A;  3O33 A;  3QZV A;  2AK5 A;  5DBM A;  2H3E B;  5LJ3 f;  5M9O A;  2I0N A;  2I2L A;  7AT1 B;  2NXB A;  1RL2 A;  2A37 A;  1X01 A;  4PJM A;  2RPN A;  1K9M R;  4HCK A;  4LNP A;  2EQJ A;  4M77 E;  2F5K A;  5GAO l;  4JRP A;  1F68 A;  4F7U G;  2K5L A;  4TU6 A;  1W6X A;  1VQM T;  2P84 A;  1NJI R;  4QUU A;  2M1H A;  4RTW A;  5FB0 A;  5E9M A;  4LDV A;  4BUG A;  3A8H B;  1VQP T;  2ZPH B;  2FG0 A;  2KQW A;  2LQ8 A;  3PTA A;  4IUP A;  2JM9 A;  1QWE A;  3G71 A;  3DKM A;  5DYX A;  1UG1 A;  5GMK j;  3G4S A;  1MHN A;  1YCY A;  2O88 A;  4C8Q F;  1GCQ C;  4D8K A;  1OU8 A;  5IHN A;  2IVW A;  3EH2 A;  1IHV A;  3VUB A;  1ZHI A;  1SHF A;  1V76 A;  2LNH B;  1M2V B;  3JB9 J;  1ZA2 B;  3UV5 A;  4Z88 A;  4F14 A;  4MZM A;  2QQB A;  2JTE A;  3VYH B;  4ALH A;  5EWW A;  3VKI A;  3CCE T;  4ZW1 A;  4AFZ C;  3UAT A;  2FO0 A;  3G0L A;  4PFO A;  2VXF A;  2DXU A;  2E64 A;  3OW2 A;  2KTB B;  4YTL A;  3CCV Q;  3R6O A;  4Y91 A;  2KY9 A;  2D6F A;  3CCQ T;  5GAM e;  3H8Z A;  4M77 B;  4ALG A;  3FC3 A;  2K57 A;  2QGG A;  3UF4 A;  1XJW B;  1W2B A;  1D1C A;  2O9V A;  4BDY A;  4A9K A;  2B8A A;  1GCQ A;  2RMO A;  1KQ1 A;  5I1Q A;  4AKN A;  2QA4 T;  3NHN A;  3JB9 F;  3D1D A;  2DZ9 A;  4X9C A;  3BDU A;  4M75 E;  5LJ5 d;  4QY4 A;  1FX7 A;  4F7U A;  1N8R U;  1TXQ A;  5C85 A;  3WVE B;  5KCO A;  5G4R A;  5FH8 A;  5EIS A;  5FE4 A;  5HQ7 A;  4C92 G;  3OYE A;  4QC1 A;  2YLB A;  4XY8 A;  3X26 B;  3OS5 A;  4Q0N A;  3X25 B;  3I5R A;  4LR6 A;  4E6R A;  3OS0 A;  1E6H A;  4C5H A;  4EMK B;  4F16 A;  5LJ3 g;  1NPR A;  5A7C A;  3OS2 A;  4QB3 A;  4HCC A;  1U8R A;  4Z6H A;  3FKM X;  3NXB A;  1PD0 A;  2E5Q A;  4LDF A;  3CXC S;  3O34 A;  2DK3 A;  1WHK A;  4IUR A;  5I21 A;  4RTX A;  4OML A;  3I55 Q;  4GLM A;  2RK1 A;  3NTH A;  3CCM T;  4X1V A;  4LUE A;  2J6O A;  2L5Q A;  1R0B G;  2HMA A;  5BT3 A;  4NR8 A;  3EFS A;  5DFB A;  5IG6 A;  1M8M A;  4EDU A;  5D6Y A;  1TUC A;  2E65 A;  4JJN K;  5AT1 B;  2LNV A;  4BI8 B;  4XK8 E;  1I5L A;  2K6D A;  4KCX A;  3UT1 A;  2ZCF B;  4J5Y A;  1TTH B;  2OI3 A;  3M57 A;  5JWM A;  5KYW B;  3G6E A;  3MKD A;  1GL5 A;  1JXM A;  1LPL A;  1VQ5 A;  4QQD A;  5CR2 A;  5CUE A;  1VQ7 Q;  2E7O A;  2RI5 A;  1G83 A;  4MEQ A;  3DWY A;  4JZ4 A;  2A7Y A;  2G3R A;  4QNS A;  3WXM B;  1PG5 B;  2E10 A;  3TU4 K;  3U5L A;  2L2P A;  3UPU A;  1U5S A;  4XTY A;  1Q95 G;  4JPB W;  4KT0 E;  5FU6 B;  3S91 A;  4OB0 B;  3P8B B;  3A8L B;  3MET A;  1QMC A;  4JLG A;  1N8R R;  2DEQ A;  5IID A;  1X6B A;  2KXC A;  2MPX C;  2R57 A;  1VQO T;  3CC2 T;  5EA1 A;  1LOJ A;  2EYZ A;  4LC2 A;  1RAA B;  2DVR A;  5ETD A;  2GF7 A;  5E3D A;  2DO3 A;  4YYI A;  3RBB B;  1U06 A;  2LDM A;  5I11 A;  3OYD A;  5CKF A;  1D0Z A;  4CUP A;  1VQ7 T;  5E9L A;  2XKO C;  1AWX A;  3MJX A;  5LKZ A;  2JNG A;  4N4I A;  1UB4 A;  4XTV A;  5IGL A;  2KK4 A;  4ATO A;  2JW4 A;  5EPB A;  5GAN 6;  3D7C A;  3HFN A;  1VQ5 Q;  4O74 A;  3X20 B;  2KI7 A;  2K4Y A;  4HXS A;  5CS8 A;  4A53 A;  3J7A F;  2RD1 A;  2C0O A;  4XU3 A;  5CUG A;  3UA6 A;  3QPH A;  3G0J A;  4C0D B;  5CIU A;  4FL6 A;  5GJW B;  4F7U E;  5DY7 A;  2EBP A;  3MEA A;  4HVV A;  2DM1 A;  2KVQ G;  2CGH A;  5K29 A;  3RCW A;  2K2M A;  1JQQ A;  4WHW A;  1RAD B;  2YUP A;  4GY5 A;  4M75 C;  1OI1 A;  1FXX A;  3F70 A;  1AD5 A;  2GTO A;  4QSR A;  2FHD A;  3V7S A;  4OMF B;  3CCS T;  5LKT A;  3MEV A;  4C92 A;  4J8O A;  3OB9 A;  3QG1 A;  1ZUK A;  4GBQ A;  1VOM A;  3MHX A;  4PJN A;  5IN1 A;  4YH4 A;  4QVC A;  4MMK A;  3REB B;  4DQ2 A;  4M7D F;  3P8H A;  5GAN g;  2VYT A;  1UHF A;  3I56 Q;  4PFP A;  2VXE A;  2WSE E;  1PNJ A;  1WUG A;  2BE7 D;  1BI2 A;  3G7Z A;  3JCM g;  2G6F X;  1NBE B;  5D3T A;  3A8M B;  3D1B A;  2EGC A;  4QEU A;  4HVU A;  5IXF A;  1VQP Q;  2YDW A;  3DLM A;  5I29 A;  2W0Z A;  2D1X A;  2A28 A;  1UE9 A;  2GRC A;  1I4K 1;  4C5E A;  4QSV A;  4MML A;  3GBQ A;  2X35 A;  4RMO A;  4MDW A;  2FB7 A;  4CI0 C;  2RO0 A;  1V29 B;  1WZO A;  4HVW A;  1XNI A;  3CC2 A;  5ECA A;  2D8H A;  3SFM A;  1OV3 A;  4BW3 A;  4Y28 E;  3L2Z A;  4XU2 A;  3MCA B;  4A9I A;  3PIP A;  2QA4 A;  1KQS S;  1TUG B;  5CU8 A;  5EM3 A;  1YIJ Q;  1BKB A;  3QSU A;  4UIT A;  2YSQ A;  3JCM V;  3O35 A;  5F1H A;  2Z0W A;  3VUZ A;  2MWO A;  5DLQ E;  5GAM j;  4XTU A;  3JCM e;  2HEQ A;  2DIL A;  1U1S A;  3RNJ A;  3P1C A;  2E6N A;  4LDW A;  2F2X A;  3MO8 A;  4K11 A;  2R5M A;  5AD2 A;  2QEX T;  1VQ9 A;  3M0P A;  3GF5 A;  2DYB A;  4UIZ A;  1MMA A;  5C89 A;  2J6K A;  4CUT A;  2ABL A;  4VUB A;  5IAY A;  5J39 A;  1HJD A;  1QVF S;  3UVD A;  3G1J A;  1B7T A;  1QLY A;  6AT1 B;  4PK4 A;  2YLC A;  1Y71 A;  2DZC A;  1IZ6 A;  4UIY A;  4O75 A;  1SRM A;  3H41 A;  3JCM X;  1K73 R;  3HMH A;  4O7F A;  2Y90 A;  2PVG B;  4PL6 A;  5HEL A;  4NYW A;  3JVK A;  5AME A;  4QSW A;  2M0Y A;  4CC3 A;  1RAB B;  4E7H A;  2DXC A;  2O01 E;  4O70 A;  4WF2 A;  3ERR A;  4HBY A;  5HRW A;  2K5I A;  2LMJ A;  4PY6 A;  4HXO A;  2GQV A;  2FZG B;  2RJE A;  5GAO n;  2C06 A;  3LQH A;  5D3H A;  1VQ4 A;  4M78 A;  5DKC A;  4KUI A;  3S3N A;  3V8K A;  3EFO B;  3HP9 A;  2OO1 A;  2HAX A;  4ZGJ B;  5ENI A;  1PD1 A;  5D3P A;  2HSE B;  3CBO A;  4QC3 A;  2RQW A;  1S1N A;  5I7Y A;  5DW2 A;  1JRI A;  3REA B;  4L59 A;  4M75 F;  2CUB A;  4YYH A;  2PVD B;  3LQI A;  3U5O A;  3C94 A;  3RIR A;  5GAN 5;  1H3Z A;  4IR6 A;  5GAN f;  5I88 A;  3G6E Q;  5HRX A;  4M78 E;  3SWN C;  4DBQ A;  1JBM A;  1UJ0 A;  3QJY A;  1VQ9 Q;  4PFZ A;  4Y03 A;  1M2O A;  3S6W A;  2CH4 A;  2QK0 A;  4CC4 B;  2RFJ A;  4LDU A;  2H8H A;  5J0D A;  5A5O A;  3A8O B;  4E7I A;  1M1F A;  4TZ2 A;  5H1V A;  1ZBX A;  2DKG A;  1Q82 C;  3GLX A;  2DIQ A;  5F1L A;  4HT8 A;  5HLS A;  1KD1 R;  2DAQ A;  3URG A;  5D25 A;  5D3J A;  5J3B A;  2NUZ A;  4RTT A;  2J7I A;  4E47 A;  1UJY A;  3S92 A;  3HKS A;  2RN8 A;  4CFL A;  5FE7 A;  2ZPB B;  2ROT A;  2K79 A;  4OMO A;  5I83 A;  4TS8 A;  4AKG A;  3MEW A;  4A9M A;  1N9S A;  5D7X A;  1ABO A;  3ME9 A;  4RG2 A;  4LN2 A;  2QYZ A;  3CCU A;  1M1K R;  2RHU A;  1ACM B;  4HXM A;  1GBQ A;  1Y7X A;  2R0Y A;  4OGJ A;  3UV4 A;  3O36 A;  1KQS P;  1SEM A;  2JUF A;  3G4S T;  4EIK A;  2V1R A;  4BE0 A;  4LYS A;  2AHJ B;  5A5S A;  1K0X A;  2PVO B;  4QKU A;  4QW2 A;  5A5R A;  5CKH A;  2EKH A;  1W1F A;  5L99 A;  2DNU A;  5DLX A;  4A54 A;  3C12 A;  2F6J A;  2ECZ A;  3L2R A;  4OMM A;  4BY6 B;  4C0Z A;  4N3W A;  1PKT A;  5CP5 A;  2EJN A;  3FEO A;  1YBY A;  2YQD A;  2ZPF B;  4OGC A;  2O4X B;  4J0S A;  4PLL A;  2XI9 A;  3JRZ A;  3AAD A;  3M0R A;  3FB9 A;  3M0U A;  4HXJ A;  1BK2 A;  4MEN A;  1H8K A;  1FMV A;  3P1E A;  4HBV A;  3JB9 G;  4ORZ A;  2OAU A;  4OP0 A;  3FLG A;  3FIF A;  3VRZ A;  1EX4 A;  1QWF A;  1XQH A;  5A0L A;  5IBN A;  4M7D E;  5FBX A;  3EGX A;  4AFS C;  5HK0 A;  2PU9 B;  5IGM A;  1GCP A;  4O7E A;  4QSS A;  1ZSZ A;  2FPD A;  3M4G A;  2RO1 A;  5FE1 A;  4QVZ A;  5HQ5 A;  3OYN A;  1M30 A;  2PQW A;  2LX9 A;  2HD0 A;  5BT4 A;  5FE0 A;  2BTT A;  2D9T A;  1ZQ1 A;  2OTL Q;  2BKD N;  3BDL A;  4LXC A;  5AMF A;  2FRW A;  4UYG A;  2ED1 A;  2FZK B;  4D8D A;  3A98 A;  5HRV A;  4A63 B;  5CGP A;  4Y92 A;  3CD6 T;  2BUD A;  4JUV A;  4M4Z A;  4IR4 A;  2P4T A;  1Q7Y U;  1QVG A;  2D0Q B;  2BZ8 A;  3QZS A;  4NUC A;  1M90 R;  1BYM A;  5COI A;  4UIW A;  4QSX A;  3CCQ A;  4YH3 A;  5F63 A;  2EFI A;  1BIA A;  1SSF A;  1TG0 A;  4KV1 A;  2N9G A;  1M4Z A;  5GAM d;  2LT4 A;  1HK9 A;  3HFO A;  1RI9 A;  5CQ4 A;  1Z9Q A;  2LQN A;  2CZ1 B;  4C0D C;  5KYN A;  4NS5 A;  4A4F A;  2IIM A;  5HK3 A;  4OB1 B;  3A1P A;  4M77 C;  1QQJ A;  5E9K A;  1P92 A;  2HCK A;  5GAN 3;  2I8N A;  3V7R A;  1PHT A;  1M90 C;  3A8G B;  3M56 A;  4MR5 A;  2HBW A;  5EP7 A;  4C5G A;  2AT1 B;  1AOJ A;  2L89 A;  3L2Q A;  4JS5 A;  4IR5 A;  2NLU A;  4N4G A;  3CD6 Q;  2QG9 B;  4EMH A;  2MJV B;  5FDZ A;  1YN8 A;  2CS7 A;  2QTX A;  2M16 A;  1G3Y A;  3JVJ A;  1FMW A;  3LWI A;  1JM4 B;  2GTJ A;  2DJZ A;  4TZ8 A;  3QZ5 B;  4P5N A;  3HMF A;  1FMK A;  3VRY A;  1NEG A;  1C0M A;  2KDS A;  5LJ5 f;  4AKH A;  3NFC A;  2MIO A;  2YYN A;  3CCR Q;  4PNO A;  2M9U A;  3OSV A;  2RNW A;  5I2M A;  5FWB A;  3S3M A;  1I5O B;  1C1A A;  4IUT A;  4B6M A;  2VGN A;  1EFN A;  1WXB A;  5GMK h;  5EGU A;  4PCE A;  3HHT B;  1LVK A;  4YYJ A;  4NQM A;  4V2S A;  2DMO A;  3HPW A;  2RNY A;  2DVV A;  2LSP B;  4UC4 A;  3U5P A;  4C8Q C;  5E3G A;  2FRY A;  3LH5 A;  4ZC9 A;  4J6X A;  3I3J A;  2KR3 A;  1YHQ A;  4J9E A;  2GFA A;  1NM7 A;  4OMN A;  1W2B P;  5I2S A;  4O76 A;  3OW2 P;  1RLP C;  1BI3 A;  3I55 T;  2IPO B;  3HRT A;  3I5S A;  3IQL A;  2DXB A;  2J6F A;  4DEY A;  1B3Q A;  5LJ2 A;  3M0S A;  1X69 A;  2RJD A;  1R77 A;  4DA4 A;  1ABQ A;  3EGU A;  1VUB A;  5FW9 A;  2DTI A;  2X4J A;  2X4W A;  1N72 A;  2GBQ A;  5HEM A;  5GMK i;  1N6A A;  3MB4 A;  3PT9 A;  1KK7 A;  5LVR A;  1GRI A;  4NUE A;  4N4F A;  3OYB A;  2OX7 A;  4M77 G;  3CCJ T;  2LJ1 A;  4M75 B;  4NR5 A;  5EC7 A;  4NUD A;  5EV9 A;  4AKI A;  5CTL A;  4J9H A;  4KGZ B;  4RCC A;  4QVD A;  5C7N A;  2COZ A;  2EQK A;  3CBM A;  4LD6 A;  1NJI C;  2QGF B;  4LZR A;  4J9F A;  3PFS A;  1YIT Q;  4UYF B;  1KHI A;  3PVL A;  1JB0 E;  2A36 A;  3CD6 A;  3VKG A;  1PWT A;  4PTB A;  4N0A C;  5LJ3 j;  5KTU A;  5CUC A;  2RH2 A;  2QA4 Q;  1M1K C;  2KT1 A;  4JRK A;  1PC0 A;  2CP7 A;  4FYY B;  3EFO A;  3RKY A;  1YJ9 T;  2PZ1 A;  4BE1 A;  3CC7 A;  1SHG A;  4A4K A;  5L8U A;  5GMK l;  2EGA A;  4II1 A;  2VKN A;  1Y96 A;  4N0A A;  1SF9 A;  4HA8 A;  2VB6 A;  2DLP A;  3SDZ A;  1YJW Q;  4O6J A;  2CZ6 B;  1AWW A;  3DB4 A;  2BE9 B;  8AT1 B;  1FWZ A;  1Q82 U;  2ZPG B;  1PM3 A;  3CC4 T;  4J6Y A;  4BE2 A;  1UGP B;  3CCS Q;  4E7L A;  5FB1 A;  5CCA A;  3LJW A;  5CQT A;  3VS4 A;  4FCY A;  5A5P A;  3TCJ A;  1VQ4 T;  2O31 A;  2LCL A;  4DON A;  3MP1 A;  4M7A D;  2KRS A;  5CVI A;  2WP2 A;  4WHU A;  1M9S A;  4FW2 A;  5E73 A;  3RKX A;  2PTK A;  3H9N A;  4O71 A;  4ANJ A;  3VJP A;  4CUS A;  1YJW T;  2DKW A;  5CQA A;  3UVY A;  5KHM A;  5LJ5 h;  5KTX A;  3KUF A;  4JJB A;  3CCE A;  3CCV T; 
#chains in the Genus database with same CATH homology
 3OBY A;  3OMG A;  5EIC A;  1M5Q 1;  1MGQ A;  1WQW A;  4C0G A;  5FE5 A;  5ETB A;  4F7U B;  3O8V A;  3CPW S;  1K73 U;  5D3L A;  4PJO D;  4QR3 A;  2OTJ T;  5CKE A;  2RI3 A;  5C8G A;  3M59 A;  5FLX E;  4DOV A;  2RI2 A;  3JCM J;  4PJO G;  4YAX A;  3M55 A;  4KBM B;  5FE6 A;  4J3I A;  3L2U A;  5GAN 2;  2L84 A;  3GG3 A;  3ONI A;  3MP6 A;  2LTO A;  5TB6 A;  1KG1 A;  4A9L A;  1DJ7 B;  5H1T A;  3E9G A;  2QQ9 A;  3OY9 A;  1QP2 A;  3VU3 C;  4QR5 A;  2CYZ B;  5FRO A;  2VGM A;  1NE8 A;  5DYA A;  5DFC A;  5ENJ A;  1WGS A;  3CCU T;  5EPR A;  4OB3 B;  4IOO A;  4KUD K;  3QHS A;  4XTW A;  3OMC A;  4LZS A;  2EYQ A;  4IUV A;  2R5A A;  2L3R A;  3CCL A;  5HY6 A;  2ZPI B;  3QBY A;  4M75 G;  5HEN A;  1BI1 A;  2IG0 A;  5LJ3 d;  1Q86 U;  3QZ9 B;  4BY6 C;  1QVG S;  1KD1 U;  5L96 A;  2XK0 A;  5E9V A;  5FE2 A;  4NL3 A;  5ACY A;  2YRV A;  3QYG B;  3CMA A;  5L98 A;  5TCM A;  3IU6 A;  4D6W A;  1WNL A;  1YIT T;  4OGE A;  3GP8 A;  1QW1 A;  4HT9 A;  4C8Q B;  1UGQ B;  5FU6 C;  3OYL A;  3U5M A;  4OF1 A;  5I86 A;  1YI2 T;  2O4X A;  2ZGW A;  4ELZ C;  2HNI A;  4LYW A;  4Z6I A;  3SVF A;  5EVA A;  4XU0 A;  5FG6 A;  3ZFJ A;  5A83 A;  5FFV A;  3N5B B;  3WVD B;  4KUL A;  4M7D A;  4YYG A;  1M8V A;  5FU7 B;  2PUK B;  2P0K A;  5I7X A;  3JCM f;  1OYX A;  5FFY A;  5EPS A;  4KV4 A;  3OYK A;  3SWN B;  3UVX A;  4JRI A;  4EPC A;  1N8R C;  2D82 A;  5E74 A;  5AD3 A;  4C8Q G;  4HCB A;  3UWN A;  3M5A A;  5ENC A;  5FH6 A;  4J0R A;  3SD4 A;  3QXE B;  1YIJ A;  4IOR A;  2Y4Y A;  3ASK A;  1YIJ T;  2K3X A;  4CFK A;  5E9I A;  3JB9 D;  5H1U A;  4O72 A;  5CRM A;  1X0J A;  1I81 A;  3CCS A;  1KHC A;  4BD3 A;  1D3B A;  4A9O A;  5F60 A;  2CKK A;  4A9F A;  3BY7 A;  1Q7Y C;  4UYE A;  1HXD A;  1M1G A;  5EG2 A;  2ZPE B;  3H6Z A;  1VQK T;  1VQ9 T;  4LZ2 A;  3DB3 A;  5CUD A;  3TRE A;  5FG4 A;  4YBT A;  2M0O A;  5FG5 A;  4PLI A;  3E19 A;  2DWW A;  5EI4 A;  2RNX A;  4OGI A;  4ZGD B;  1KC8 C;  5FRN A;  4N4H A;  3OYJ A;  4LYI A;  1W4S A;  2E7N A;  4M78 C;  2MI6 A;  1UEB A;  4XTZ A;  4JDS A;  4LD9 K;  3CCJ A;  4UYH A;  2K2V A;  4M7D B;  2R58 A;  2MAM A;  4C8Q A;  5GAM h;  5JI8 A;  4J7I A;  2PUO B;  1K8A U;  3L2W A;  1B34 A;  5GAO q;  4PJO E;  2QQS A;  1X75 C;  5DKH A;  3RER A;  3M9Q A;  2XD0 A;  3JVM A;  5KU3 A;  3LH0 A;  4BHW A;  5F5Z A;  5A85 A;  4XTX A;  5C4Q A;  3LXJ A;  1EIF A;  4ZTJ A;  2OTL T;  5D3S A;  2ZZD A;  5II2 A;  3HRS A;  4YYN A;  5II1 A;  3JCM c;  5D6W A;  5DYU A;  3MEU A;  5HQ6 A;  4XYA A;  5IGK A;  2FVU A;  4M78 D;  1VQM A;  5L97 A;  2P0P A;  2HBP A;  4A9E A;  3L42 A;  4Q5W A;  4HXL A;  3GNG A;  4EMK A;  1VQ7 A;  3J80 E;  3OSS C;  3M54 A;  1W2B S;  5CRZ A;  2D9E A;  4PJO B;  1VQ6 A;  2F69 A;  1S72 T;  3OYY A;  5ENE A;  4M75 A;  4PS5 A;  4M78 F;  5ENH A;  4QEV A;  5GAM g;  3Q1J A;  5CQ5 A;  3I55 A;  3E1S A;  4A4E A;  4YYK A;  3C95 A;  5L8T A;  5E0R A;  4NQN A;  3LW5 E;  3MP8 A;  2E3K A;  5E9Y A;  4CUQ A;  3OYM A;  4PKC C;  3MUK A;  2XDD A;  4J1P A;  2VV5 A;  4E7J A;  3L1A A;  1XTD A;  1ZS5 A;  3U5N A;  2QQR A;  2WSF E;  4TYL A;  1B34 B;  1EQF A;  4M7A E;  2QDY B;  5EWH A;  2K3Y A;  2YEM A;  4YBM A;  4TTE A;  4YK0 A;  4O7A A;  5LJ1 A;  3TLP A;  4JRQ A;  4R55 A;  3T9N A;  2LQK A;  4QEW A;  4HXR A;  5F36 A;  3A5Z B;  4NXJ A;  3JSC A;  1QVF A;  5LJ0 A;  4UIU A;  3G6E T;  3S3O A;  2CZ7 B;  3VV0 A;  1O75 A;  4C67 A;  2L8D A;  4ZTF A;  3M58 A;  4A9J A;  4FM4 B;  3SVG A;  4Z1S A;  3CCM A;  1IRE B;  3V7C A;  5FFW A;  3LLR A;  5LJ5 g;  2XDB A;  4C5I A;  5HJC A;  1S72 A;  5CZG A;  2V8I A;  3G71 T;  1BI0 A;  5IGN A;  5CUA A;  4JLI A;  3CME T;  5D24 A;  5J26 A;  4M7A A;  4NL2 A;  1G3W A;  2DVQ A;  5CPE A;  3M4Y A;  2OUO A;  1NJI U;  2KAF A;  2YHT A;  1WQ7 A;  3OW2 S;  1G5V A;  4NRC A;  1D3B B;  2X4X A;  2XIC A;  4TT4 A;  3CPW A;  3RKW A;  5C0M A;  4RVR A;  2RHZ A;  4C92 D;  3ZBD A;  2EKO A;  4IUU A;  1YJN A;  4X34 A;  3CCR A;  1LNX A;  2WSC E;  1YHQ T;  4ZN1 A;  1KD1 C;  4QZS A;  3UV2 A;  2E6Z A;  3MB3 A;  3V8J A;  2RK2 A;  3OYA A;  2E41 A;  2XHC A;  3AHU A;  5GAN 8;  3CMA T;  5LJ5 e;  4UYF A;  4M75 D;  3RMS A;  3CC7 T;  3SB2 A;  4QYD A;  1UGR B;  2OTL A;  5DFD A;  3CEY A;  2RB6 A;  4M7A F;  4C92 C;  5DKD A;  5GAN 4;  1Y96 B;  1YJN T;  4Z1Q A;  3GIB A;  1VIE A;  4L6V 5;  1WJQ A;  2MMP A;  1K73 C;  4TQN A;  1TH7 A;  1WJR A;  2XID A;  5H85 A;  5A5N A;  2QI2 A;  2XG8 D;  3OYH A;  3DLL A;  2EJ9 A;  5AYF A;  2LCC A;  4F7U F;  5CK9 A;  3OQ5 A;  3GPL A;  2QQA A;  2EAY A;  5DM7 R;  3OYF A;  1VQK A;  4UYD A;  5DY9 A;  3JCM Q;  3JCM P;  5GAM f;  3NTK A;  3QDR B;  4BJX A;  4O7B A;  1VQ5 T;  4YC9 A;  4CL9 A;  1R8O B;  3LQJ A;  1YIT A;  4A9N A;  5GMK m;  2E1H A;  4IKF A;  5L8R E;  5I89 A;  5D3N A;  5LUU A;  5CUB A;  1QP3 A;  5HFR A;  2OTJ A;  5F3A A;  4YBS A;  5FU7 C;  1YI2 A;  3PIO A;  5A5Q A;  3ZYU A;  5DLO A;  4J83 A;  1QVP A;  4LRG A;  3I56 A;  2DD4 A;  4M7D C;  2EWN A;  4OVA A;  2EIF A;  3NTI A;  3KBG A;  2LRQ A;  2JVV A;  2EQM A;  4XU1 A;  4C0F A;  1VQ8 A;  2H60 A;  3HRU A;  3HL8 A;  5CO7 A;  4BI4 A;  3LGF A;  1Q86 C;  1M1K U;  4EMG A;  5KO4 A;  3M53 A;  4M78 G;  3RES A;  4QSU A;  2YEL A;  4C66 A;  4YYM A;  4PJO C;  4RKU E;  1PSF A;  4ELY C;  4ME7 A;  4NR6 A;  3JCM h;  1H64 1;  3U5J A;  4LDX A;  4O77 A;  1G3T A;  5FE3 A;  2F5T X;  4B9W A;  4C92 E;  2FYK A;  3QYH B;  1K9M U;  1Y07 A;  4MDX A;  2RA2 A;  1KC8 U;  4MZP A;  4HBX A;  2KSS A;  5EQ1 A;  4CUU A;  2YEK A;  4MR4 A;  5FRM A;  5CQ7 A;  3PNW C;  4E7K A;  3QII A;  5HM0 A;  3IU5 A;  2GFU A;  5ENG A;  4YAB A;  2DVE A;  5HKC A;  3CCV A;  5KTW A;  4BB7 A;  2LC4 A;  4QSQ A;  3E9F A;  4M7D D;  4QQG A;  2LT1 A;  5LJ5 j;  1PSE A;  4OB2 B;  5ENF A;  3RUX A;  5CY9 A;  3P1D A;  4L5G A;  3P8D A;  4XY9 A;  3OYI A;  2MWP A;  4PJO F;  5FE8 A;  4E96 A;  5HFQ A;  2FL7 A;  3AQA A;  2RHY A;  3MUL A;  3UVW A;  5GAN d;  4M7A B;  4MEO A;  5D0C A;  5CQ8 A;  5I40 A;  4XUA A;  4NYV A;  2WAC A;  3HSB A;  1VQ8 T;  4C8Q D;  5F25 A;  2H3J A;  3JCM W;  2G4A A;  4O5V A;  4XQ3 A;  2Y4X A;  4GPJ A;  2QEX A;  3OYC A;  4X2I A;  2V8J A;  4QBM A;  2DTO A;  5A0G A;  4TVR A;  2XU8 A;  4C92 F;  5A81 A;  5KE2 A;  1M90 U;  1UGS B;  1XOV A;  3CBP A;  4MEP A;  4J7F A;  2QXF A;  3SVH A;  5GAN j;  4QYL A;  3Q2E A;  5LVQ A;  2VUB A;  1WJS A;  3Q2F A;  1JSP B;  4BAC A;  2DVS A;  2P0Q A;  4IR3 A;  4FT2 A;  1VQP A;  1KQ2 A;  3ER0 A;  4UIX A;  4Q0O A;  1VQL A;  4XUB A;  5HCL A;  1RI0 A;  1VQL T;  4HBW A;  2RHX A;  3OA6 A;  1KQS A;  3JB9 H;  4BW4 A;  1WUM A;  5D26 A;  2V8K A;  4UIV A;  5D6X A;  1YJ9 A;  4YY4 A;  5GAN e;  3CME A;  3MXF A;  3FRN A;  4FLP A;  4FSX A;  2I7K A;  3UW9 A;  3PGG A;  4M7A C;  5G4S A;  3HME A;  5DLZ A;  3LGL A;  5LJ3 e;  5FE9 A;  5KE3 A;  5F2P A;  4C8Q E;  5GAN 7;  5GAO p;  5A0D A;  1K9M C;  5BT5 A;  4GLK A;  3P1F A;  1I8F A;  1X6O A;  5DX4 A;  3I56 T;  4Z93 A;  4NR7 A;  5GAO m;  4NOY A;  2E12 A;  3PMI A;  1O9S A;  3O37 A;  1N27 A;  4CLB A;  3J81 E;  2A3L A;  4IUQ A;  3OS1 A;  3EAE A;  2R10 A;  2GCX A;  3L2V A;  4WIV A;  2RM4 A;  2VC8 A;  5CQY A;  4BW1 A;  3JAM E;  2DD5 A;  2DPP B;  3P5O A;  2R0V A;  4M7D G;  3X28 B;  3QJ6 A;  1YJW A;  1U1T A;  4HKE A;  2F6N A;  3DAI A;  5C87 A;  4FT4 A;  4R56 A;  4YAT A;  4F3I A;  4MR6 A;  2EJF A;  4RG8 A;  5CAI A;  5EWD A;  3FDR A;  4CRI A;  3RMQ A;  2WP1 A;  4O78 A;  3CC4 A;  4HCZ A;  1JJ2 S;  4ZQL A;  4YYD A;  4OUF A;  5CQX A;  4TU4 A;  3KXT A;  3GOX A;  4YAD A;  1GXI E;  2E70 A;  5EWV A;  1E6I A;  4QQ6 A;  4PKL A;  5KH6 A;  2JTM A;  4HXN A;  4FU6 A;  1OZ3 A;  4QR4 A;  4YY6 A;  4M77 A;  1G3S A;  4LDY A;  3QO3 A;  2DTH A;  4TT2 A;  2JTF A;  2HQE A;  3CXC A;  5F61 A;  4RCB A;  5A2Q E;  4B9X A;  3BFM A;  3FJP A;  3BW1 A;  2OSS A;  1WPY A;  2DAT A;  5LKU A;  1VQO A;  2L5E A;  5LKX A;  3PMT A;  5DW1 A;  5F62 A;  5CKB A;  4NYX A;  1NZ9 A;  3JVL A;  1VQ6 T;  4EMK C;  3OBW A;  2LVM A;  2XDP A;  1AHJ B;  1JJ2 A;  2JZ2 A;  2RJF A;  3LX7 A;  2HQX A;  4NRA A;  5LL6 S;  2RHI A;  4DOW A;  4FIB A;  4JS4 A;  4NRB A;  4ZGE B;  4XAX B;  5FH7 A;  3X24 B;  3GNF B;  5GAO r;  5A82 A;  3INZ A;  4BW2 A;  1Q81 C;  3VYG A;  3QUI A;  3C4S A;  3JCM d;  3TEE A;  5IT9 E;  3K2J A;  4HXK A;  5CQ6 A;  5KCH A;  5D3R A;  5EK9 A;  2FSA A;  2JOY A;  4BI3 A;  1BIB A;  3LYI A;  4PCI A;  4TT6 A;  5GMK e;  2R0S A;  4NR9 A;  1VIF A;  4M77 F;  5CFW A;  3OYG A;  3LWH A;  5EWC A;  3CCR T;  4O7C A;  4Z02 A;  2X4Y A;  2CZ0 B;  3QZT A;  5C6S A;  1K8A C;  5I80 A;  3U5K A;  2MF2 A;  4MZT A;  4QSP A;  4QST A;  5EU1 A;  4M77 D;  2DXT A;  4IOQ A;  2RI7 A;  1VQN T;  2DIG A;  2RS9 B;  4QUT A;  1VQN A;  4PJO A;  3EFR A;  2K5F A;  4NR4 A;  1NPP A;  1N9R A;  1OZ2 A;  3QKJ A;  4BDZ A;  2L85 A;  4C92 B;  5LJ3 h;  1LJO A;  5CQ3 A;  4MR3 A;  5DYC A;  4CUR A;  4HXP A;  2EJG A;  4M7A G;  2BIV A;  2JN0 A;  5GAN h;  1Q81 U;  3CPF A;  3SWN A;  3JB9 I;  2EQU A;  2YW5 A;  3JCM b;  2RJC A;  3CCL T;  4J6W A;  3ZEH A;  4X9D A;  5CKD A;  4A4G A;  5E7D A;  4A4H A;  3MQM A;  4A9H A;  3UDC A;  3V8L A;  4ZN3 A;  4M78 B;  2KMT A;  5ENB A;  3O33 A;  3QZV A;  5LJ3 f;  5DBM A;  5M9O A;  2I2L A;  2NXB A;  1RL2 A;  1X01 A;  2EQJ A;  4M77 E;  2F5K A;  5GAO l;  4JRP A;  1F68 A;  4F7U G;  2K5L A;  4TU6 A;  1VQM T;  4QUU A;  2M1H A;  5FB0 A;  5E9M A;  4LDV A;  4BUG A;  3A8H B;  1VQP T;  2ZPH B;  2KQW A;  2LQ8 A;  3PTA A;  4IUP A;  3G71 A;  3DKM A;  5DYX A;  5GMK j;  3G4S A;  1MHN A;  1YCY A;  4C8Q F;  2IVW A;  3VUB A;  1ZHI A;  3JB9 J;  3UV5 A;  4MZM A;  2QQB A;  3VYH B;  4ALH A;  5EWW A;  3VKI A;  3CCE T;  4ZW1 A;  3G0L A;  2VXF A;  2DXU A;  2E64 A;  3OW2 A;  2KTB B;  4YTL A;  3R6O A;  4Y91 A;  2KY9 A;  2D6F A;  3CCQ T;  5GAM e;  3H8Z A;  4M77 B;  4ALG A;  3FC3 A;  2K57 A;  1W2B A;  4BDY A;  4A9K A;  2B8A A;  1KQ1 A;  5I1Q A;  4AKN A;  2QA4 T;  3JB9 F;  2DZ9 A;  4X9C A;  3BDU A;  4M75 E;  5LJ5 d;  4QY4 A;  1FX7 A;  4F7U A;  1N8R U;  5C85 A;  3WVE B;  5KCO A;  5G4R A;  5FH8 A;  5EIS A;  5FE4 A;  5HQ7 A;  4C92 G;  3OYE A;  4QC1 A;  2YLB A;  4XY8 A;  3X26 B;  3OS5 A;  4Q0N A;  3X25 B;  4LR6 A;  3OS0 A;  4C5H A;  4EMK B;  5LJ3 g;  1NPR A;  5A7C A;  3OS2 A;  4QB3 A;  4HCC A;  1U8R A;  4Z6H A;  3FKM X;  3NXB A;  2E5Q A;  4LDF A;  3CXC S;  3O34 A;  2DK3 A;  4IUR A;  5I21 A;  2RK1 A;  3NTH A;  3CCM T;  2L5Q A;  5BT3 A;  4NR8 A;  3EFS A;  5DFB A;  5IG6 A;  4EDU A;  5D6Y A;  2E65 A;  4JJN K;  2LNV A;  4BI8 B;  4XK8 E;  1I5L A;  4KCX A;  3UT1 A;  2ZCF B;  4J5Y A;  3M57 A;  5JWM A;  3G6E A;  1VQ5 A;  4QQD A;  5CR2 A;  5CUE A;  2E7O A;  2RI5 A;  4MEQ A;  3DWY A;  2A7Y A;  2G3R A;  4QNS A;  3WXM B;  2E10 A;  3TU4 K;  3U5L A;  3UPU A;  4XTY A;  4KT0 E;  5FU6 B;  3S91 A;  4OB0 B;  3P8B B;  3A8L B;  3MET A;  4JLG A;  2DEQ A;  5IID A;  1VQO T;  2R57 A;  3CC2 T;  5EA1 A;  1LOJ A;  4LC2 A;  2DVR A;  5ETD A;  2GF7 A;  5E3D A;  2DO3 A;  4YYI A;  2LDM A;  3OYD A;  5CKF A;  4CUP A;  1VQ7 T;  5E9L A;  2XKO C;  5LKZ A;  2JNG A;  4N4I A;  1UB4 A;  4XTV A;  5IGL A;  2KK4 A;  4ATO A;  5EPB A;  5GAN 6;  3D7C A;  3HFN A;  4O74 A;  3X20 B;  2K4Y A;  4HXS A;  5CS8 A;  4A53 A;  3J7A F;  2RD1 A;  4XU3 A;  5CUG A;  3QPH A;  3G0J A;  4C0D B;  5CIU A;  4FL6 A;  4F7U E;  5DY7 A;  3MEA A;  2KVQ G;  2CGH A;  5K29 A;  3RCW A;  4WHW A;  4GY5 A;  4M75 C;  1OI1 A;  1FXX A;  3F70 A;  4QSR A;  2FHD A;  3V7S A;  4OMF B;  3CCS T;  5LKT A;  3MEV A;  4C92 A;  4J8O A;  3OB9 A;  3QG1 A;  3MHX A;  5IN1 A;  4YH4 A;  4QVC A;  4MMK A;  4DQ2 A;  4M7D F;  3P8H A;  5GAN g;  2VYT A;  2VXE A;  2WSE E;  1WUG A;  1BI2 A;  3G7Z A;  3JCM g;  5D3T A;  3A8M B;  4QEU A;  2YDW A;  3DLM A;  5I29 A;  2GRC A;  1I4K 1;  4C5E A;  4QSV A;  4MML A;  4RMO A;  2X35 A;  4MDW A;  2FB7 A;  4CI0 C;  2RO0 A;  1V29 B;  1XNI A;  3CC2 A;  3SFM A;  4BW3 A;  4Y28 E;  3L2Z A;  4XU2 A;  3MCA B;  4A9I A;  3PIP A;  2QA4 A;  1KQS S;  5CU8 A;  5EM3 A;  3QSU A;  1BKB A;  4UIT A;  3JCM V;  3O35 A;  5F1H A;  3VUZ A;  2MWO A;  5DLQ E;  5GAM j;  4XTU A;  3JCM e;  1U1S A;  3P1C A;  2E6N A;  4LDW A;  3MO8 A;  2R5M A;  5AD2 A;  2QEX T;  1VQ9 A;  3GF5 A;  4UIZ A;  5C89 A;  5IAY A;  4CUT A;  4VUB A;  5J39 A;  1QVF S;  3UVD A;  2YLC A;  1Y71 A;  2DZC A;  1IZ6 A;  4UIY A;  4O75 A;  3JCM X;  3HMH A;  4O7F A;  2Y90 A;  2PVG B;  4PL6 A;  5HEL A;  4NYW A;  3JVK A;  5AME A;  4QSW A;  4E7H A;  2DXC A;  2O01 E;  4O70 A;  4WF2 A;  4HBY A;  5HRW A;  2K5I A;  4PY6 A;  4HXO A;  2GQV A;  2RJE A;  5GAO n;  2C06 A;  3LQH A;  5D3H A;  1VQ4 A;  4M78 A;  5DKC A;  4KUI A;  3S3N A;  3V8K A;  3HP9 A;  2OO1 A;  2HAX A;  4ZGJ B;  5ENI A;  5D3P A;  3CBO A;  4QC3 A;  5I7Y A;  5DW2 A;  1JRI A;  4L59 A;  4M75 F;  4YYH A;  2PVD B;  3LQI A;  3U5O A;  3C94 A;  3RIR A;  5GAN 5;  1H3Z A;  4IR6 A;  5GAN f;  5I88 A;  5HRX A;  4M78 E;  3SWN C;  1JBM A;  3QJY A;  4Y03 A;  3S6W A;  2RFJ A;  4LDU A;  5J0D A;  5A5O A;  3A8O B;  4E7I A;  1M1F A;  4TZ2 A;  5H1V A;  1ZBX A;  2DKG A;  1Q82 C;  3GLX A;  2DIQ A;  5F1L A;  4HT8 A;  5HLS A;  2DAQ A;  3URG A;  5D25 A;  5D3J A;  5J3B A;  4E47 A;  3S92 A;  3HKS A;  4CFL A;  5FE7 A;  2ZPB B;  5I83 A;  4TS8 A;  3MEW A;  4A9M A;  1N9S A;  5D7X A;  3ME9 A;  4RG2 A;  3CCU A;  2RHU A;  4HXM A;  1Y7X A;  2R0Y A;  4OGJ A;  3UV4 A;  3O36 A;  2JUF A;  3G4S T;  4BE0 A;  4LYS A;  2AHJ B;  5A5S A;  2PVO B;  4QW2 A;  5A5R A;  5CKH A;  5L99 A;  5DLX A;  4A54 A;  3C12 A;  2F6J A;  3L2R A;  4BY6 B;  4C0Z A;  4N3W A;  5CP5 A;  3FEO A;  1YBY A;  2YQD A;  2ZPF B;  4OGC A;  2O4X B;  4J0S A;  4PLL A;  2XI9 A;  3JRZ A;  3AAD A;  3FB9 A;  4MEN A;  3P1E A;  4HBV A;  3JB9 G;  2OAU A;  4OP0 A;  3FLG A;  3FIF A;  1XQH A;  5A0L A;  5IBN A;  4M7D E;  5FBX A;  5HK0 A;  2PU9 B;  5IGM A;  4O7E A;  4QSS A;  3M4G A;  2RO1 A;  5FE1 A;  4QVZ A;  5HQ5 A;  3OYN A;  2PQW A;  2LX9 A;  2HD0 A;  5BT4 A;  5FE0 A;  2D9T A;  1ZQ1 A;  2BKD N;  3BDL A;  5AMF A;  4UYG A;  5HRV A;  5CGP A;  3CD6 T;  2BUD A;  4JUV A;  4IR4 A;  2P4T A;  1Q7Y U;  1QVG A;  2D0Q B;  3QZS A;  4NUC A;  1BYM A;  5COI A;  4UIW A;  4QSX A;  3CCQ A;  4YH3 A;  5F63 A;  2EFI A;  1BIA A;  1SSF A;  4KV1 A;  2N9G A;  1M4Z A;  5GAM d;  2LT4 A;  1HK9 A;  3HFO A;  5CQ4 A;  2CZ1 B;  4C0D C;  4NS5 A;  4A4F A;  5HK3 A;  4OB1 B;  4M77 C;  5E9K A;  1P92 A;  5GAN 3;  2I8N A;  3V7R A;  1M90 C;  3A8G B;  3M56 A;  4MR5 A;  5EP7 A;  4C5G A;  2L89 A;  3L2Q A;  4JS5 A;  4IR5 A;  2NLU A;  4N4G A;  4EMH A;  2MJV B;  5FDZ A;  2CS7 A;  2QTX A;  2M16 A;  1G3Y A;  3JVJ A;  3LWI A;  1JM4 B;  2DJZ A;  4TZ8 A;  3QZ5 B;  4P5N A;  3HMF A;  2KDS A;  5LJ5 f;  3NFC A;  2YYN A;  4PNO A;  2M9U A;  3OSV A;  2RNW A;  5I2M A;  3S3M A;  4IUT A;  2VGN A;  5GMK h;  5EGU A;  4PCE A;  3HHT B;  4YYJ A;  4NQM A;  4V2S A;  3HPW A;  2RNY A;  2DVV A;  2LSP B;  4UC4 A;  3U5P A;  4C8Q C;  5E3G A;  4J6X A;  4ZC9 A;  3I3J A;  1YHQ A;  2GFA A;  5I2S A;  4O76 A;  1BI3 A;  3I55 T;  3HRT A;  2DXB A;  5LJ2 A;  2RJD A;  4DA4 A;  1VUB A;  2DTI A;  2X4J A;  2X4W A;  1N72 A;  5HEM A;  5GMK i;  1N6A A;  3MB4 A;  3PT9 A;  5LVR A;  4NUE A;  4N4F A;  3OYB A;  4M77 G;  3CCJ T;  4M75 B;  4NR5 A;  4NUD A;  5EV9 A;  5CTL A;  4RCC A;  4QVD A;  5C7N A;  2EQK A;  3CBM A;  4LD6 A;  1NJI C;  4LZR A;  3PFS A;  4UYF B;  1KHI A;  1JB0 E;  3CD6 A;  4PTB A;  4N0A C;  5LJ3 j;  5KTU A;  5CUC A;  2RH2 A;  1M1K C;  4JRK A;  3RKY A;  1YJ9 T;  4BE1 A;  3CC7 A;  4A4K A;  5L8U A;  5GMK l;  4II1 A;  1Y96 A;  4N0A A;  4HA8 A;  3SDZ A;  4O6J A;  2CZ6 B;  3DB4 A;  1FWZ A;  1Q82 U;  2ZPG B;  3CC4 T;  4J6Y A;  4BE2 A;  1UGP B;  4E7L A;  5FB1 A;  5CCA A;  3LJW A;  5CQT A;  5A5P A;  3TCJ A;  1VQ4 T;  2LCL A;  4DON A;  3MP1 A;  4M7A D;  5CVI A;  2WP2 A;  4WHU A;  1M9S A;  5E73 A;  3RKX A;  4O71 A;  3VJP A;  4CUS A;  1YJW T;  2DKW A;  5CQA A;  3UVY A;  5KHM A;  5LJ5 h;  5KTX A;  3KUF A;  3CCE A;  3CCV T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...