4NS5A

Crystal structure of human bs69 bromo-zinc finger-pwwp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
185
Chain Sequence
QEMGTYLRFIVSRMKEVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human BS69 Bromo-ZnF-PWWP reveals its role in H3K36me3 nucleosome binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords Zinc finger MYND domain-containing protein 11
total genus 66
structure length 185
sequence length 209
ec nomenclature
pdb deposition date 2013-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ns5A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ns5A02
5DX4A 1WUGA 4A9IA 5KTXA 3LQJA 4CUTA 2XDPA 4ZW1A 5HJCA 3RCWA 1EQFA 4YYGA 5F1LA 4CUPA 2GF7A 4E7HA 5KTWA 5HLSA 4Z1SA 4NR8A 5FE3A 5L98A 5I40A 5FE7A 4MEQA 5CQ8A 5A82A 4A4GA 4UYGA 5CU8A 3S3OA 5FRNA 4QY4A 3ONIA 2DIGA 3FDRA 2D9TA 4MEPA 5JWMA 4BDYA 2BIVA 3DWYA 5D3TA 4A9MA 5LJ2A 5CRZA 3OYFA 2OSSA 4MR6A 5I29A 4XY8A 4UYFA 2X4XA 5EWHA 3KUFA 3OYHA 3S91A 4B9XA 2E7NA 4N3WA 4UYEA 5D0CA 4BACA 2RI5A 5J0DA 5DY7A 5FFWA 3L2RA 2DVSA 5ENJA 2MJVB 2RJEA 4YABA 4UC4A 4FL6A 4QW2A 5BT3A 2D82A 4UIXA 3QIIA 5CY9A 2I7KA 3JVLA 3OYIA 5D24A 3K2JA 5EWDA 5HQ7A 5DYXA 5E9IA 2QQSA 3HMHA 3O34A 5F2PA 4O7BA 2L85A 5I89A 4CL9A 1MHNA 4TU6A 2MWOA 5FH7A 4QB3A 1WJRA 3MB3A 4BJXA 4A9LA 5EGUA 3OS2A 3O36A 4QEVA 5CIUA 4PL6A 4TYLA 3OMGA 5AD3A 5F1HA 5L8UA 4UYHA 2RNYA 5CFWA 4O75A 1SSFA 4BE2A 4NQMA 4HXKA 3MXFA 4HXLA 5LJ0A 4NRCA 4O7EA 5KHMA 3UVYA 4A9HA 5CUCA 5FBXA 3UV4A 5H85A 5K29A 5KO4A 4YATA 2YRVA 4QQGA 5CPEA 4O7AA 2IG0A 5EK9A 4QR3A 4YC9A 5CZGA 4F3IA 4IUQA 4QR5A 2RJFA 4BD3A 3ZEHA 4A9FA 2NXBA 4WHUA 5DLXA 3MEWA 4YADA 4LZSA 5IAYA 5C0MA 4TZ2A 5FE5A 5DW1A 5II1A 4NQNA 5AMEA 4FU6A 4LC2A 4A9EA 4YH4A 2E7OA 4NUEA 4CURA 5HM0A 3EAEA 4CRIA 5FE2A 2YDWA 4GPJA 5EQ1A 5C6SA 4YY4A 4LZRA 4J3IA 3L2VA 3M9QA 5CUAA 5E9KA 5ENCA 4HXSA 4E7JA 5HENA 4C5EA 4NYWA 5A5OA 3OYBA 5E0RA 4UYFB 5F63A 4QSQA 4HXPA 5CS8A 4YYKA 4TQNA 4IOOA 3O8VA 5CUGA 5D3HA 5E7DA 2YYNA 5DW2A 4C5GA 1OZ2A 4KCXA 4YK0A 5ETDA 5IGMA 3U5JA 5E9LA 5D7XA 3LJWA 4NYXA 4X2IA 4Z6IA 1G5VA 2DAQA 4YYDA 5CQ3A 5COIA 4O7FA 4UIZA 2JZ2A 5EICA 3L2WA 5EWCA 3P1FA 5CQAA 3NTHA 3OY9A 4CFKA 5I7YA 3S92A 2G4AA 3OYMA 4II1A 3JVKA 4UIVA 4OUFA 3U5MA 3P8HA 4QVZA 5F5ZA 2OO1A 5ACYA 4PY6A 3MB4A 4J0SA 5E74A 2YW5A 4QSVA 4XY9A 5FE1A 4A9KA 4NR4A 2GRCA 2JTFA 5D3NA 3U5PA 2LSPB 3UW9A 4CUSA 4C67A 5DLZA 3UT1A 4N4IA 3AQAA 4NUDA 3FEOA 5HCLA 2CKKA 5KH6A 2E3KA 3JVJA 4FLPA 4TS8A 4QEUA 4MR3A 4HBVA 5DKCA 5E9MA 4OVAA 5D6YA 4DONA 2X35A 4C5IA 5FH8A 5L97A 5BT4A 3JVMA 4HXNA 4N4FA 3LGLA 4XUBA 5FFVA 2N9GA 5EPSA 4KV4A 2FSAA 3P8DA 5KCOA 3E9GA 5F36A 5FROA 5G4SA 2LRQA 4YYMA 4O78A 4Y03A 4BW1A 5J39A 5HRXA 2RI7A 4HCZA 3MQMA 2R5AA 3MP8A 4IUPA 2FHDA 4O71A 2RHXA 3LLRA 5CRMA 5A5QA 5E3DA 4YH3A 5FB0A 4YYIA 2R0YA 4QSXA 4YAXA 4LDFA 5LKUA 5KU3A 3GG3A 5DBMA 5L96A 2RI2A 3SVFA 5A5NA 5A5SA 4QUTA 5IG6A 4O77A 1OZ3A 3LQIA 2DIQA 4TT6A 4KV1A 3OB9A 4A9OA 3FKMX 4EDUA 5FE0A 3QKJA 5AMFA 3MEVA 2DVVA 4PCEA 2D9EA 2R0SA 5CQTA 5C87A 5F61A 4E7IA 5I1QA 1ZS5A 4CUQA 4GY5A 5FG5A 5JI8A 2NLUA 2RO1A 4QSPA 4UYDA 5C8GA 4WIVA 3UVDA 5FE8A 1XNIA 4QEWA 4IOQA 3P1EA 2X4WA 4BW2A 2QQRA 3Q1JA 5CP5A 5IN1A 4O76A 3OYGA 5I83A 5EV9A 4UIYA 5ETBA 4YYHA 1OI1A 4ALGA 2O4XB 3MUKA 4RVRA 2DWWA 5EPRA 3NXBA 4IR6A 3ME9A 4YY6A 5E9VA 3IU5A 4N4HA 3IU6A 5KE2A 2DVQA 4QQ6A 5EWWA 3O35A 4QYDA 4IR5A 2RHUA 5DYAA 4LZ2A 4NRBA 4QR4A 4LRGA 4HBWA 4CFLA 3U5NA 1OYXA 5IGLA 4YYNA 1WUMA 4LYSA 5C7NA 3LYIA 4NR5A 4CLBA 2LCCA 3H6ZA 5EWVA 4HXRA 5CQ7A 4HXOA 4QZSA 3Q2EA 2EFIA 2RI3A 3FC3A 5IIDA 2E5QA 3HMFA 5I88A 5C4QA 5CUBA 3I3JA 5AD2A 4NR9A 1N27A 4Z1QA 5ENGA 3G0JA 3Q2FA 2EQUA 2M16A 4LD6A 4NRAA 4UIWA 5EPBA 4HBXA 4NYVA 2EQJA 2H60A 5DKHA 2X4YA 4QSSA 5FE6A 4X34A 5HELA 5CGPA 4O72A 2EKOA 2GFUA 2PQWA 2XK0A 3G0LA 2F5KA 3ASKA 2R58A 3MULA 2HQXA 4E7LA 4QSUA 4PTBA 4BW3A 2RNXA 2P0KA 5EM3A 5IBNA 4ZTFA 3QBYA 3DLMA 5A5RA 2YQDA 2WP1A 2K3YA 5CQ5A 3META 3LQHA 3DB3A 3U5OA 2RFJA 4A4HA 5D6WA 5H1VA 4UITA 5HEMA 2LDMA 3PFSA 2RJDA 4QSTA 5A81A 4ALHA 5HQ6A 4BW4A 2RHIA 4QNSA 4TT2A 2R10A 3DAIA 5LKZA 2HQEA 2WACA 1N72A 4PS5A 5CUEA 5D3PA 4TT4A 5CTLA 2YELA 3OQ5A 4PCIA 3D7CA 3MEUA 4MEOA 5G4RA 4QC3A 5I7XA 4QSWA 5LKTA 4PLLA 5ENFA 1RI0A 5FG4A 5EU1A 5KTUA 3PMIA 3C4SA 5H1TA 3P5OA 5CQ6A 5KE3A 2GFAA 3DB4A 3MEAA 4TU4A 3TLPA 4Z93A 4IUUA 3S3NA 3UV2A 2YEMA 2B8AA 5I80A 3PMTA 3HMEA 4YYJA 2RHZA 2RHYA 4RG2A 5FRMA 4IURA 1KHCA 2BUDA 4Q0NA 2RJCA 5D3SA 5FB1A 1JSPB 2O4XA 4A9JA 3QZSA 4LYWA 5CUDA 5FH6A 3QZTA 2R57A 3QJ6A 5D3LA 3O37A 2LTOA 3SVGA 3UVXA 4C5HA 5DFCA 2R0VA 1F68A 4YBTA 2KTBB 4QQDA 5IGKA 4LR6A 3LXJA 4ZC9A 3PNWC 5II2A 5ENEA 2LVMA 2OUOA 5E9YA 4IUVA 5LVQA 4A4EA 3OYDA 5D3RA 4MR4A 4XYAA 5LUUA 2L5EA 5L8TA 3LGFA 5FE4A 2RS9B 3UVWA 5I86A 5EISA 3F70A 5HRWA 4J0RA 5DFBA 5FDZA 5TB6A 3S3MA 3S6WA 5BT5A 3ZYUA 3OYAA 3OS1A 3OYEA 4QYLA 4A4FA 4IR4A 4NXJA 5DFDA 2G3RA 4XUAA 3H8ZA 5F25A 3LH0A 3SD4A 4N4GA 3OYCA 4ZTJA 4NR7A 4BDZA 3FLGA 5KCHA 3P1DA 5LKXA 3OMCA 1E6IA 4J1PA 3NTKA 4OGJA 3L2UA 5EP7A 2DVRA 1WGSA 4NR6A 4Q5WA 2EQMA 5FE9A 5D25A 5FG6A 5F60A 4YBMA 5A7CA 4QBMA 5H1UA 2K3XA 3MP1A 2BKDN 4L59A 4IR3A 4O74A 4QC1A 2R5MA 5E3GA 4YBSA 3LX7A 5EI4A 4TZ8A 4CUUA 3MO8A 4TTEA 1WJQA 3U5KA 4NUCA 4O7CA 1WJSA 4MENA 5HQ5A 4BE1A 4BHWA 2RO0A 5D6XA 3OYLA 2DATA 4A9NA 4IORA 5ENIA 5HFQA 4E96A 4LYIA 3CEYA 3BDLA 5M9OA 4E7KA 3NTIA 5D3JA 4BE0A 2F6JA 4HXMA 4Z6HA 2L3RA 2EQKA 5LVRA 2MWPA 5A83A 5TCMA 4PLIA 4MR5A 2I8NA 5C85A 5DKDA 3L2QA 3GOXA 2E6NA 2VYTA 3UV5A 5DYCA 5IGNA 1JM4B 4HBYA 5L99A 3QZVA 3OS0A 5DYUA 3UWNA 4Z02A 1X0JA 3AADA 4B9WA 2F6NA 5C89A 2WP2A 4NS5A 4IUTA 2YEKA 5CQ4A 4C66A 4QUUA 3SVHA 5F62A 5EA1A 2L89A 5LJ1A 3OYKA 5FFYA 2DKWA 4WHWA 2M0OA 5HFRA 3OYNA 5EVAA 2M1HA 5A85A 4AKNA 4O70A 4ZQLA 3OYJA 3MP6A 5D26A 4UIUA 4OGIA 2L84A 4Q0OA 5ENBA 5J26A 4QSRA 1H3ZA 3O33A 3P1CA 5A5PA 3L42A 5E73A 5F3AA 5ENHA 3OA6A 4PKLA 5HRVA 2L8DA 3E9FA 4IKFA 2RNWA 3U5LA
chains in the Genus database with same CATH superfamily
1BI2A 4A9IA 3OBWA 2AK5A 2E12A 5A2QE 2L5QA 2XDPA 5HJCA 1EQFA 5F1LA 4IIOA 4RTTA 4E7HA 5KTWA 5FE3A 1VQ4A 5GAOr 4FSXA 2VXFA 2ZPGB 5FE7A 4UYGA 5CU8A 5FRNA 3G71T 1U06A 3FDRA 4JZ4A 1UGPB 1FMVA 3DWYA 1QVPA 2DD4A 2OAUA 3UPUA 4XTVA 5CRZA 3RESA 2EKHA 2OSSA 2VC8A 4UYFA 4C92A 1I07A 1WYXA 4B9XA 2E7NA 4CC3A 4O5VA 5D0CA 1BI3A 4PJOA 1G3SA 1IHWA 1T3LA 2V1QA 1K73C 5ENJA 2MJVB 2AKKA 4UIXA 1UHFA 2AIRB 2E10A 3M0QA 1AHJB 5D24A 5EWDA 2RD1A 2QQSA 3RMQA 3O34A 3UATA 1TUCA 1LVKA 4TVRA 2L85A 4LN2A 1MHNA 1N9SA 1M2VB 5KYWA 1VQ7A 2ZAEA 4LXCA 3FB9A 1K1ZA 5EGUA 5FLXE 2KGTA 3M5AA 5F1HA 3PTAA 2JTMA 3D1BA 2QQBA 1JB0E 1M1KU 3MXFA 3G4SQ 4O7EA 3CD6Q 2OTJA 4WF2A 3X20B 3CCLT 5CUCA 2FPDA 2MPXC 5FW9A 2SEMA 2J06A 5KO4A 4YATA 1VYVA 1JU5C 4O7AA 2I0NA 1ZKRA 2XG8D 2KAFA 1WDXA 4YC9A 4F3IA 4RCCA 4BD3A 4QR5A 1Q82C 1VQKQ 2ABLA 3I56T 5DLXA 5GANh 2KR3A 4TZ2A 1VQKT 1M3CA 4M7DC 5DW1A 2BZYA 4QKUA 4FU6A 4LC2A 3A8GB 4A9EA 3M0TA 2VWFA 2E7OA 4C8QG 4NUEA 1UGQB 2O9SA 3EAEA 3A8LB 4PJOC 2OTJT 3JAME 2YDWA 5GAN5 2XU8A 5C6SA 4LZRA 3L2VA 2JNGA 3E19A 1UHCA 4XQ3A 5A5OA 3HFNA 5CO7A 3EHRA 2CUDA 3OYBA 1AWJA 2PNIA 4QSQA 4KGXB 1YWOA 4M7AG 1Y07A 2E65A 4JLGA 1VQ5T 3C95A 1YJ9A 1JBMA 2CZ6B 2LJ3A 3UF4A 3R6NA 3U5JA 1ZUUA 4NYXA 2FRYA 2JOYA 4OMMA 5KYYB 2LJ1A 1GCQA 4DA4A 4CFKA 4ZGDB 2G4AA 4LD9K 1KQSS 3GIBA 3JVKA 2BE7D 1IXDA 5I22A 5ACYA 2PU9B 3MB4A 4J0SA 1WPYA 3VS7A 3CC4T 1OU8A 5GAMd 4QSVA 4XY9A 3RMSA 2GRCA 4LDWA 3G71A 4BUGA 1RABB 2E1HA 1D1CA 2RK2A 1UJYA 1VQ9T 5KH6A 3JVJA 4E7SA 4C8QD 2O9VA 3QWXX 4GBQA 4HBVA 3KXTA 3JCMe 2KK4A 4E2FB 3CCSA 1VQMA 2DM1A 3JVMA 2MAMA 2RN8A 2E6ZA 3CCJQ 2ED1A 4LE9A 1ZX6A 4YYMA 4O78A 1M30A 2RI7A 3A98A 3G6EQ 2R5AA 4IUPA 5CK9A 4O71A 3TEEA 4YH3A 2AT1B 2J7IA 2FZGB 1U8RA 3M57A 5KYXB 4EMKB 3M53A 4JS4A 2E70A 1K0XA 5LJ3e 2CUBA 3V8LA 1GFDA 4FT4A 2D1XA 3RBBB 5A0LA 3FKMX 5L8RE 3QJYA 1S72T 1QW1A 1IGQA 3EGUA 4PCEA 2C0OA 2EGCA 2R0SA 4E7IA 1HD3A 4KH1B 4CUQA 4GY5A 5JI8A 2RO1A 4QSPA 3RKYA 1XNIA 5FE8A 5CKEA 4IOQA 3P1EA 1RAAB 5KYNA 2W0ZA 4O76A 2CZ7B 3OYGA 5EV9A 4UIYA 4YYHA 2XD0A 4ALGA 1FMWA 2DWWA 3RKXA 4IR6A 2DRKA 3ME9A 1Y0MA 4N4HA 2NUTA 2JT4A 3A8HB 1TU0B 3C0CA 4M78B 1MNDA 1M8VA 5KE2A 1GCPA 4QYDA 4IR5A 4PKCC 4LZ2A 4ZGJB 4LRGA 3LYIA 1VQOQ 5EWVA 1JXOA 3JCMX 2EFIA 4QZSA 2RI3A 2JUFA 2DNUA 1VQ5A 1MV3A 4M7DG 1M2OA 5AD2A 1K76A 2LC4A 3G0JA 2CSQA 4PJOG 5LJ5f 3LH5A 4LD6A 4N0AC 2LNHB 4HBXA 4C92G 2OI3A 2H60A 1VOMA 2PQWA 2KEAA 3ASKA 4E7LA 2HQXA 2IVWA 1VQOA 5GAOn 1RUWA 1PRLC 4OMPA 2GTOA 5CQ5A 3OS5A 2RFJA 4EIKA 1BB9A 1YJNA 4HT8A 1ARKA 3PFSA 2A37A 2A08A 2HL5C 4ALHA 5HQ6A 1IREB 1G83A 1YITQ 2R10A 3CC7T 3EH1A 5LKZA 1M90U 2WACA 2DVJA 1N72A 2QK0A 5LJ3g 5GMKi 5D3PA 1OEBA 5CTLA 3SWNB 3OQ5A 3D7CA 1UGVA 2DE0X 5LJ5e 1M90R 4KGZB 1PCXA 4PLLA 5FG4A 4XTWA 3SWNA 1Y96B 5H1TA 3J7AF 3MEAA 3VS4A 1BIBA 4Z93A 4A4KA 2L2PA 4EMKC 2B8AA 5I80A 3HMEA 1U1TA 2CSIA 2FG0A 4JJBA 2RHYA 4HT9A 2JS0A 2GNCA 4YTLA 1NZ9A 5FB1A 2QDLA 1JSPB 4FT2A 2R57A 5D3LA 3OSSC 2D0NA 1ZSZC 2RH2A 3UVXA 4C5HA 2DJQA 4QVDA 1F68A 2KTBB 2OX7A 4F7UA 3JCMQ 3QYHB 3PNWC 3RUXA 3OW2S 1RAIB 1WHMA 5HY6A 3FJ5A 2KXCA 5GAN8 1B7TA 1KHIA 4XYAA 1S72A 3G71Q 3ER0A 1VQLQ 2E5KA 3UVWA 1VQ8T 2MF2A 1C0MA 2DFUA 3CC2Q 1KJWA 5BT5A 3ZYUA 4M78C 1C6VX 3OYEA 4CC2A 4XUAA 2NUTB 3LH0A 2K2MA 3JB9J 2V8KA 2VKNA 5GANf 1WXUA 3HRSA 3NTKA 4OGJA 2XICA 5EP7A 1LOJA 3CCJA 5GAMf 5FG6A 2K57A 5LL6S 2FPFA 2K3XA 3EH2A 3VKGA 4L59A 4O74A 4QC1A 1NEGA 3LX7A 3EFSA 1A0NB 3QZ5B 4TZ8A 1VQ6T 4TTEA 1QVGS 3U5KA 1XJWB 2EJGA 2A3LA 4O7CA 1WJSA 1Z9ZA 4BHWA 2RO0A 3OYLA 1YI2A 4PNOA 3KFVA 1NPPA 2ROLA 4LYIA 3CEYA 4WTOB 1BIAA 5LJ5j 4BE0A 2KDSA 4C92E 2DJZA 3J80E 2L3RA 4E7ZA 1NLOC 2XIDA 2I8NA 5C85A 5DKDA 1AEYA 4AFQC 2CGHA 2IPOB 2D8JA 4F17A 2E6NA 3UV5A 4OMQA 5FWBA 5IGNA 2CT3A 2PVDB 1G3YA 3HP9A 1H92A 4Z02A 1VUBA 4C8QA 4IUTA 2YEKA 1N5ZA 3G4ST 4C92C 5EA1A 5LJ1A 2D6FA 2C0TA 2OTJQ 2M0OA 5HFRA 4JJNK 5EVAA 1G2BA 2QAZA 4Z8AA 3X24B 4FYWB 4CI0C 4O70A 1C1AA 2DF6A 3FRNA 3OYJA 4OGIA 4Q0OA 5ENBA 4QSRA 5A5PA 2JM9A 2DZ9A 1ZA1B 1NYFA 1YN8A 1PM3A 1FMKA 4HVVA 4M77E 1WUGA 4KUDK 5KTXA 4HVWA 4PFOA 4KT0E 3PIPA 4CUTA 8AT1B 1YIJQ 3WVEB 4ZW1A 3RCWA 4FW1A 1JJ2S 1QP3A 4NR8A 2ZPEB 5L98A 2YHTA 4PFZA 2RM4A 5I40A 4MEQA 2KXDA 4A4GA 3O5ZA 4MZMA 2DIGA 1GL5A 1ZSGA 2XI9A 4M75C 5GANe 4XU3A 4BDYA 3JCMP 1OQKA 3JB9G 1Q82U 4A9MA 1IB8A 2DERA 2K5IA 2M0YA 4C8QF 2FYKA 4J9DA 4MR6A 5I29A 2A36A 1LCKA 3A8MB 2V26A 1NM7A 5EWHA 1ZSZA 3KUFA 1K73R 3S91A 3IQLA 4N3WA 1TTHB 1ABQA 4E47A 4UYEA 1B3QA 4OMFB 3A1PA 5DY7A 2V1RA 4AFSC 1VYUA 1PG5B 2RJEA 2QA4T 4YABA 2HMAA 3JCMg 2D82A 3QIIA 5CY9A 2FEIA 4M78E 5HQ7A 5DYXA 4DQ2A 2C06A 3LWIA 2YXYA 4CL9A 3QWYA 2RQTA 1WJRA 4QB3A 3MB3A 4A9LA 3EGDA 1X01A 1RL2A 3OS2A 4QEVA 2ZGWA 5CIUA 4TYLA 2EYXA 3OMGA 5AD3A 4A53A 2RNYA 2V8IA 1SPKA 4O75A 2XDDA 1G3WA 4NQMA 5LJ0A 2F2VA 1YHQQ 2RK1A 2NWMA 1QLYA 1YJ9Q 2RQWA 4EMHA 1GBQA 1CKAA 2YT6A 1M3BA 5A0DA 4HCBA 5CQXA 5CPEA 1M8MA 1M9SA 3VJPA 3EFRA 2DKGA 1AZGB 1VQLA 1W1FA 1WHGA 4OB0B 1H641 5GAMe 1M2VA 5KYWB 1YI2Q 4F7UF 4WHUA 4F16A 3G6EA 4YADA 4LZSA 3VKIA 4BB7A 5C0MA 1KQ1A 1N6AA 1UECA 3JB9F 1SRLA 3EGXB 4YH4A 2J6FA 3A5ZB 2CP5A 2E41A 2ENMA 3EGXA 4BI8B 4YY4A 4M7AF 3M55A 2DTOA 4HXSA 5HENA 4C5EA 1JQQA 1NJIC 4UYFB 2CREA 5F63A 3HKSA 2KMTA 4YYKA 2K5LA 4C0ZA 3I55Q 3MJXA 3CCRT 4IOOA 5E7DA 2YYNA 5DW2A 2BZ8A 4KCXA 2KI7A 1BU1A 5IGMA 3M0PA 4X2IA 4AG1C 1YFNA 5CQ3A 5COIA 4UIZA 2GBQA 3L2WA 5EWCA 3P1FA 5DY9A 5I7YA 4II1A 3U5MA 3P8HA 1PKSA 2OO1A 4ANJA 1VQNA 5GMKm 4PY6A 3CBOA 1M27C 2QG9B 5E74A 2K7AA 4NR4A 2JTFA 3L2ZA 2CZ1B 1VIEA 2LSPB 4LDUA 4C67A 5DLZA 3CCQT 2EGEA 2CKKA 2E3KA 1LNXA 4FLPA 4TS8A 3EG1A 4QEUA 5DKCA 5E9MA 2LQWA 2PUOB 4DONA 2JMCA 5FH8A 5BT4A 3J81E 1QVGA 4N4FA 5FFVA 2ECZA 3VRYA 1YCSB 1I81A 4KV4A 2FSAA 1OX9A 3P8DA 3E9GA 1SKUB 3L1AA 5G4SA 1X2KA 4J9IA 4J9FA 5J39A 1BBZA 5HRXA 2QDYB 2COWA 1VQPA 1YJWA 4BY6C 1BI1A 4RUGA 2FHDA 2RHXA 5A5QA 4DBRA 4YYIA 4ELYC 2R0YA 4YAXA 4RTUA 5LKUA 5KU3A 1K9MC 3GG3A 1PHTA 1U1SA 5A5NA 5LJ5d 5A5SA 2GCXA 4Y91A 1OZ3A 3GP8A 4TT6A 3OB9A 1VQPQ 1AVZC 5GJVB 3QKJA 1WHKA 5IXFA 3CCEQ 3V8JA 2P0QA 5F61A 3CCMT 3M54A 2K2VA 3AT1B 3VYGA 2EIFA 4UYDA 1Q7YR 3DLLA 5C8GA 3QHSA 4CC4B 3KBGA 1D0YA 2J6KA 2JMAA 4ORZA 5CKFA 3JCMV 3U23A 4VUBA 3RKWA 4M75E 3VYHB 3FIFA 5IH2A 1WQWA 4A54A 1M90C 2YUNA 2PUKB 3M0RA 1K8AR 4OB2B 3GNFB 2AKLA 5E9VA 1B34B 1OU9A 1MMGA 3IU6A 4XTUA 2QGGA 2L3PA 3O35A 4RTZA 1NJIU 4NRBA 3CCLQ 1UE9A 3OW2A 1FYNA 4CFLA 1YP5A 3E2UA 3CC2T 5IGLA 4YYNA 4NR5A 4CLBA 2JM8A 2HDAA 1YWPA 4HXOA 3Q2EA 3ZL7C 1VQMT 1RACB 3I5SA 3HMFA 1OULA 3V7SA 3I9QA 4NR9A 1G8XA 4M7AE 2X3WD 1W6XA 2M16A 3NFCA 5EPBA 1M1KC 2DK3A 5FE6A 2EKOA 2XK0A 3G0LA 2F5KA 3H0IA 4DOWA 3MKDA 3CPWP 5EM3A 5IBNA 4HVUA 2JS2A 3GF5A 5A5RA 4R0KA 3SDZA 3LQHA 3DB3A 3U5OA 2DL7A 5D6WA 2NYSA 4UITA 3VS5A 2LDMA 1VQ6Q 5A81A 2H3EB 4R55A 2E64A 3VU3C 1AT1B 1AD5A 4JPBW 1B07A 4TT4A 1O9SA 2YELA 4R56A 3H0FA 1D1BA 5G4RA 3FJPA 4C0DB 4Z88A 5KTUA 3CCST 4RTVA 3THKA 3P5OA 4RG8A 1OPKA 4J5YA 4TU4A 3TLPA 4IUUA 4QT7A 3PGGA 2X51A 2QA4A 4JS5A 4YYJA 1HXDA 2X4JA 2RHZA 3VS1A 2CP0A 3BFMA 4M75D 1PNJA 4IURA 3CCUA 4Q0NA 2RJCA 3RERA 1WQ7A 2X3XD 4M7AC 3QG1A 3CBPA 4A9JA 5GAMh 3I56Q 1D3BB 1YJWT 1AWOA 1NJIR 1JJ2P 2LTOA 1PUOA 1QVGP 1TUGB 1VA7A 2R0VA 1D3BA 5GMKl 2GTJA 8ATCB 4QQDA 1VQNQ 4ZC9A 1D0ZA 4OP0A 1KD1U 2FZKB 2KE9A 2LVMA 1MNEA 3NPFA 4MZTA 5LJ5h 4C8QE 5LVQA 1WHHA 2KNBB 5GMKj 5D3RA 4MR4A 3TCJA 1TSFA 5L8TA 3LGFA 1VQ7Q 5I86A 1V76A 4J0RA 3M4YA 1I5LA 1DJ7B 3S6WA 1Q81U 3OYAA 3TREA 4PJOB 5HCKA 4IR4A 3CMEA 3OYCA 5F25A 1MUZA 4N4GA 1U5SA 2KBTA 1YIJA 1EIFA 1OX8A 3FLGA 3INZA 4PJOD 3P1DA 3OMCA 1IZ6A 1WGSA 4RCBA 4M7AD 4Q5WA 4M77A 1JEGA 5D25A 5F60A 4OGEA 1QQJA 2OJ2A 4RMOA 2BKDN 3CD6T 4IR3A 3TU4K 1R77A 5EI4A 2RNAA 3MO8A 2RQVA 2KT1A 3CC7A 3CMET 2HSEB 2QASA 3ULRB 4LDYA 5HQ5A 2DTHA 4BE1A 5D6XA 3V7RA 2DATA 4A9NA 5CQYA 4IORA 5HFQA 4E7KA 2COZA 1I1JA 2F6JA 1EZZB 4ELZC 3HPWA 4F04B 3CCEA 3VKHA 2EQKA 5A83A 5TCMA 4MR5A 1UTIA 3V8KA 4PJOE 1WI7A 1WX6A 3EFOB 2FRWA 3L2QA 1K9MR 1AWWA 3GOXA 2VYTA 2F2XA 1MV0B 2DETA 4J9HA 2HAXA 2MI6A 3QZVA 3OS0A 3RIRA 4M78A 3UWNA 1SHFA 1RAFB 4J9EA 3SWNC 3SVHA 1VIFA 3SHWA 5F62A 1YNZA 2P84A 2BE9B 1ZLMA 1YCYA 1IHVA 1NBEB 2EYWA 2M1HA 1VQ8A 5GAN6 1BI0A 4OF1A 3CCLA 4ZQLA 2Z0WA 5D26A 4UIUA 4J7IA 4AFUC 1H3ZA 3L42A 4MDXA 3LWHA 2L8DA 3GPLA 3CCRQ 2M9UA 2RNWA 4DBQA 5DX4A 4F14A 1WXBA 3DKMA 1HSQA 2ZPFB 3JB9H 4GLMA 1HK9A 4JRIA 2AHJB 5IT9E 4CUPA 2GF7A 4EMKA 1D0XA 2HL3A 1FX7A 4MMLA 1N9RA 2LMJA 2LP5A 1ZQ1A 5A82A 3S3OA 1E7OA 4QY4A 3ONIA 2DLPA 3NMZC 5I11A 1RAHB 2DXBA 2OTLQ 3JV3A 4O6JA 5D3TA 3I55A 5LJ2A 3N5BB 4KBMB 1ABOA 3OYFA 1XOVA 4AG2C 3R6OA 1E6GA 4XY8A 2X4XA 1PSFA 3OYHA 2DVEA 1TH7A 1YBYA 1JJ2A 4BACA 2RI5A 5FFWA 3VS0A 4NL3A 3L2RA 2DVSA 1K0SA 2MMPA 3CPWA 2K4YA 1S1NA 4FL6A 4QW2A 5BT3A 5GAOm 2CP2A 3JVLA 3OYIA 2DX1A 3VS3A 2A7YA 3HMHA 2P0PA 3P8BB 4O7BA 5I89A 4TU6A 5FH7A 4N0AA 3M0SA 4C0GA 2GQVA 2LJ0A 4NOYA 1LPLA 5L8UA 4UYHA 5CFWA 1SSFA 4ZGEB 2W10A 2HNIA 4HXKA 1Q95G 3CCVT 4HXLA 4C92B 4A9HA 4OMNA 3EHQA 5CKBA 2E3HA 5FBXA 3UV4A 2HBWA 5H85A 1I4K1 1Q7YC 2YRVA 3C12A 1JXMA 3CCVQ 2ATCB 4RTWA 4QQGA 1XQHA 2EBPA 3E1SA 5ECAA 5IHKA 5EK9A 4P5NA 2LT4A 3ZBDA 1PD0A 3ZEHA 2MOXA 4A9FA 3CPWS 3CCET 2O31A 5IAYA 2QGFB 2CP7A 4FCYA 5AMEA 3GLXA 4XU0A 2ESWA 1GRIA 3CCVA 4AMCA 4D8KA 2XDBA 1QWFA 4CURA 5HM0A 4CRIA 5FE2A 4GPJA 3D1DA 4J3IA 4JLIA 3M9QA 5E9KA 1WA7A 5ENCA 4E7JA 4NYWA 5E0RA 1Y71A 4M4ZA 1GXIE 4HXPA 2F2WA 5CUGA 3JCMJ 5D3HA 4RTYA 4C5GA 1OZ2A 2DL3A 3CCQQ 4YK0A 1YJNQ 5ETDA 5E9LA 5D7XA 3LJWA 1YITA 1NYGA 2F69A 1HYOA 3MCAB 1VQ8Q 4IIMA 2DAQA 3QUIA 1G5VA 4YYDA 5CKHA 2GGRA 1F1BB 1R0CB 1X6OA 4J9GA 1UB4A 1K9AA 5CR2A 1M1KR 2KRSA 1ZUYA 5CQAA 3NTHA 3S92A 2ZPIB 1O75A 2ZZDA 4UIVA 3CBMA 4MZPA 5F5ZA 1PKTA 2YW5A 1KC8R 4FM4B 4A9KA 5D3NA 2EVRA 2JTEA 4ZN3A 2MK5A 1OV3A 1YITT 1VQMQ 1J3TA 4F7UB 3AQAA 4NUDA 5HCLA 4OMOA 2DTIA 1IO6A 4MR3A 5D6YA 1VQ4Q 2X35A 2DYBA 4V2SA 2OTLA 2HCKA 1VQPT 3LGLA 4JJDA 4XUBA 1RADB 2N9GA 5EPSA 1ZA2B 3PE0A 5F36A 1T0HA 5FROA 4M7AA 3CCSQ 4M7DA 2LRQA 3CCMQ 4Y03A 4BW1A 1MGQA 2EJNA 4HCZA 4ZNXA 2HEQA 3MP8A 4J83A 3EFOA 4J6YA 2L3QA 3LLRA 5CRMA 5FU7B 4M78G 1UEBA 3MHXA 1VQ6A 1QCOA 5DBMA 2YSQA 5L96A 3CMAT 1BYMA 2K3BA 4QUTA 3VRZA 5IG6A 3CCMA 3LQIA 2DIQA 1WNLA 1P92A 5IHNA 4KV1A 1WZOA 1N8RU 4EDUA 5AMFA 5AT1B 3MEVA 2DVVA 3RNJA 1ZBJA 1T3SA 5CQTA 5KYYA 5I1QA 1BKBA 4KRTA 1WIEA 3HTRA 1VQLT 1Q81R 1M5Q1 4M77C 4WIVA 1BCMA 1SSHA 4QEWA 2QTVA 3LW5E 3JCMc 2YWWA 5CP5A 3CCUQ 1TXQA 5IN1A 5I83A 5ETBA 2O4XB 1VQNT 2CT4A 3SEMA 4EMGA 3MUKA 3OBYA 1PSEA 4RVRA 4C8QB 2O88A 5EPRA 4FYYB 4YY6A 3IU5A 4AKGA 2LX7A 4DOVA 2RQUA 1PWTA 3REAB 2DVQA 5EWWA 4KGVB 2RHUA 5DYAA 5IHIA 1YHQT 1LJOA 3U5NA 5GANg 1X6BA 1WUMA 5C7NA 1W2BS 2LCCA 1SRMA 1VQ7T 5CQ7A 2Y4XA 3I35A 3FC3A 2KYMA 1X2QA 5IIDA 2E5QA 2KY9A 5I88A 5C4QA 3I3JA 2ZCFB 1N27A 3JCMW 5ENGA 4C8QC 4JRPA 4NRAA 2EQJA 1NG2A 1I8FA 3CMEQ 4QSSA 1VQ5Q 2LZ6B 4JJCA 1N8RR 1QCNA 1UDLA 2L0AA 1IRXA 2GFUA 5DLOA 3MULA 1AZEA 5KYUA 4PTBA 4BW3A 2AZVA 4PJOF 5HKCA 2LQNA 2P0KA 5FWCA 3WXMB 4FW2A 3DLMA 5LJ3d 2YQDA 2WP1A 5DM7R 2G6FX 2K3YA 3META 1Y57A 5H1VA 2VUBA 1BK2A 2YRDA 5HEMA 2LCLA 2RJDA 4QSTA 2RHIA 4BW4A 3BW1A 1Y7XA 3DAIA 4KUIA 2WSEE 4A63B 3NHNA 2HQEA 5CUEA 4PCIA 1NEBA 3MEUA 4MEOA 1RLPC 4QC3A 1UFFA 5I7XA 5KYXA 2L3SA 5ENFA 1RI0A 1EX4A 2YUPA 3C4SA 4D8DA 4DBFA 5CQ6A 5KE3A 3CCUT 2LT1A 2CYZB 2GFAA 3REBB 3DB4A 4E6RA 1YJWQ 3S3NA 2YEMA 2EGAA 2RQRA 3EG0A 1WHJA 2EYYA 4HA8A 5FRMA 3H9NA 1SHGA 1KHCA 3M0UA 2HD0A 1YJ9T 5D3SA 2O4XA 3HFOA 3HSBA 2XMFA 2JXBA 4LYWA 1Q86C 5CUDA 3SFMA 5I2SA 3QJ6A 3O37A 3G6ET 5DFCA 2DEUA 4M7DD 4YBTA 3H0HA 3JSCA 3AHUA 4PFPA 4LR6A 3G7ZA 4LUDA 5II2A 5ENEA 5E9YA 1V29B 4IUVA 1AWXA 3OYDA 4ATOA 3JCMf 5LUUA 2L5EA 5FE4A 2RS9B 2K5FA 5EISA 1I5OB 5FDZA 4OB1B 1Q7YU 1VQ9Q 3OS1A 4QYLA 3I5RA 1S72Q 5DFDA 1PC0A 2G3RA 4DBHA 3H8ZA 2K6DA 3SD4A 4BDZA 1W2BP 2QQAA 4M75B 2D0QB 5KCHA 3CC4A 4JZ3A 3L2UA 5CVIA 4NR6A 5FE9A 2K79A 1M1GA 5A7CA 5GANd 4QBMA 5H1UA 3MP1A 1VQ9A 3M4GA 3TSWA 3QO3A 2R5MA 4JRKA 4YBSA 1VYTA 2VB6A 1R8OB 4M7DF 2F1LA 4CUUA 1UUEA 4M77G 3URGA 5AYFA 5IXBA 2EW3A 4XTYA 1KQSA 4MENA 1CKBA 2WSFE 2HBPA 2XHCA 4E96A 3BDLA 3NTIA 2KROA 5D3JA 3EG2A 3D7SB 2MWPA 1ZUKA 4PLIA 1TS9A 1E6HA 4C0DC 3GBQA 3HL8A 1D09B 1W2BA 2VV5A 2MYSA 3RR6A 5L99A 1VQKA 4M7DB 2HKQB 3VS2A 3AADA 3QDRB 1NPRA 2WP2A 5CQ4A 4FSSA 4XU1A 5HK0A 2VGMA 1X27A 2L89A 3JRZA 4FIBA 5FFYA 2DKWA 4WHWA 2DO3A 4L5GA 3TSZA 5D7UA 2HQHA 5A85A 2QA4Q 3MP6A 4OMLA 1KC8U 2A28A 2DL4A 5E73A 4J9CA 4PKLA 3I56A 1RI9A 1KIKA 4PJNA 3U5LA 2PVOB 1KK7A 3BDUA 3LQJA 2I2LA 3CCJT 4YYGA 1QP2A 5HLSA 4Z1SA 2JJ9A 2M02A 1M4ZA 2ROTA 2O2OA 2EAYA 5CQ8A 2H3JA 1QKWA 5GAMj 2AZSA 1SF9A 1ZHIA 1UGSB 4AI6A 5GANj 2D9TA 4MEPA 1YJNT 5JWMA 4AFZC 2BIVA 2QTXA 2D8HA 2EJFA 4JDSA 4M75A 1N8RC 3HHTB 2RPNA 2IIMA 5J0DA 3QDFA 2YLCA 3CPFA 4UC4A 2E3IA 5LJ3f 2EJ9A 1VQ4T 2C0IA 2P4TA 3QPHA 2I7KA 3EG9A 2EQIA 3K2JA 2DYIA 5E9IA 5F2PA 1QVFP 2MWOA 3RDVA 4L6V5 4OB3B 4BJXA 4PJMA 4LDXA 5L23A 3MPUB 3CC2A 3JCMd 1OOTA 3O36A 4PL6A 1YHQA 2GQIA 2KRNA 5DLQE 4AKHA 1RLQC 1X6GA 4BE2A 5GAMg 1KG1A 4NRCA 5KHMA 3UVYA 3G1JA 4QVCA 3M59A 5K29A 1Q81C 2DL5A 3CCQA 2FPEA 5CCAA 3WVDB 2IG0A 3X25B 4QR3A 5CZGA 4IUQA 2RJFA 3V7CA 9ATCB 2HSPA 4LDVA 1TG0A 2QEXT 2NXBA 1QKXA 3MEWA 1KD1C 5FE5A 2DXUA 5II1A 4NQNA 3OW2P 2RF0A 2HKNA 2DBKA 1QWEA 5EQ1A 2CS7A 4RTXA 2ZPBB 2QYZA 5CUAA 3PT9A 1R0BG 1ZSZB 5CS8A 4X1VA 4TQNA 2CP3A 3C94A 1Q86U 3O8VA 2DA9A 2KQWA 1KD1R 3QSUA 3EG3A 1H8KA 4XU2A 1PRMC 4Z6IA 3JCMh 2CDTA 4O7FA 2JZ2A 5EICA 1CSKA 2KVQG 2DILA 3OYMA 3OY9A 4F7UE 4OGCA 4LNPA 4M75F 4OUFA 4QVZA 2M51A 2DBMA 1GBRA 1YIJT 2MIOA 1UJ0A 2NUPA 5FE1A 4J6XA 4J8OA 3U5PA 3UW9A 4CUSA 4PK4A 3UT1A 4N4IA 3CMAA 3FEOA 3CD6A 1WXTA 3M56A 2EWNA 1G3TA 2ED0A 4OVAA 4FYXB 4C5IA 5L97A 1NLPC 4HXNA 2DXTA 2CP6A 1BCOA 2CZ0B 4HCKA 5KCOA 5FU6C 2DMOA 7AT1B 1FXXA 5GAOq 4M78F 3CMAQ 4M75G 1MMNA 5I21A 1EFNA 3UA6A 3MQMA 2H8HA 1T0JA 2DPPB 3T9NA 4D6WA 3PVQA 4JUVA 5E3DA 5FB0A 1M1FA 4QSXA 4LDFA 3HRTA 2RI2A 3SVFA 4DEYA 3CXCS 3VUZA 1SG5A 4O77A 2A0FB 2VVKA 4A9OA 1IGUA 2Y4YA 5EG2A 5FE0A 5LJ3h 2EYZA 2PTKA 4ME7A 1K4US 4WCIA 4XTZA 2D9EA 5C87A 4M7AB 2FL7A 2EPDA 2MCNA 4XK8E 1ZS5A 5FG5A 2NLUA 3UA7A 3UVDA 5EC7A 2X4WA 1KQSP 4BW2A 4K11A 2QQRA 3Q1JA 1TWBA 1ACMB 5GAOl 4C92D 2NUZA 1KQ2A 2J05A 1OI1A 1X43A 4M77F 3BE3A 4M78D 1WFWA 2COYA 4NL2A 5GMKe 3NXBA 2FVUA 3A8OB 1KFZA 1TOVA 1AOJA 3PIOA 1NE8A 2NUPB 1RAEB 2FB7A 4QQ6A 4JRQA 4BI4A 2LNVA 2FZCB 4QR4A 1K9MU 4HBWA 1UGRB 1OYXA 4LYSA 2PVGB 2DZCA 3H6ZA 1Z9QA 4HXRA 1KC8C 2K9GA 3TVTA 2OTLT 2KYBA 1D1AA 4CC7A 5CUBA 2RMOA 4X9CA 4Z1QA 3X28B 2EQUA 3Q2FA 2E4HA 3I55T 4UIWA 4NYVA 4X34A 2LQKA 5DKHA 2VGNA 2X4YA 5HELA 5CGPA 4LUEA 4O72A 2JN0A 5LJ3j 2YUOA 1MMAA 3QZ9B 2QXFA 2R58A 4QSUA 5FU6B 2YUQA 1JO8A 1HJDA 2RNXA 3UDCA 4F7UG 4ZTFA 3NGPA 3QBYA 4X9DA 4AT1B 5CKDA 1QVFS 2RA2A 5KYUB 4FYVB 4A4HA 1V1CA 1WLPB 2KSSA 4HCCA 2CH4W 4Z89A 4QNSA 4TT2A 1W70A 5J3BA 2F5TX 1Y96A 5GAN3 4PS5A 3CXCA 3OSVA 2J6OA 1I0CA 1H3HA 3H41A 1FWZA 1YI2T 4QSWA 5LKTA 4XTXA 5EU1A 1WHLA 3EG9B 2QI2A 2BTTA 3PMIA 3M58A 2DXCA 1M3AA 5GJWB 6AT1B 3UV2A 3ERRA 3VS6A 3PMTA 1U3OA 4J6WA 4EPCA 3CC4Q 1JRIA 1B34A 4RG2A 4PJJA 2BUDA 3BY7A 5FU7C 3HRUA 5A0GA 3QZSA 1ZBXA 5FH6A 3QZTA 2OAWA 2BZXA 3QXEB 4M77B 3PVLA 3SVGA 1TUDA 2LX9A 3X26B 3G4SA 1UG1A 5IGKA 3LXJA 5GAN2 2OUOA 1QMCA 4RKUE 4A4EA 5CAIA 2XKOC 5GAN4 3JB9I 2B86A 3TQ7P 2VXEA 2DD5A 3JCMb 5GAN7 4AKIA 3F70A 5HRWA 5DFBA 5TB6A 3S3MA 5HK3A 1PD1A 4A4FA 2ZPHB 4NXJA 1XTDA 1K8AU 3VV0A 4ZTJA 4NR7A 1SEMA 5GMKh 1KSWA 5LKXA 4J7FA 1E6IA 1GCQC 4J1PA 2X9HA 2DVRA 2EQMA 4ESRA 4J9BA 2EYQA 4YBMA 4GLKA 4KULA 2QEXQ 3JB9D 3GNGA 5I2MA 1RAGB 2JW4A 1W4SA 5E3GA 4BI3A 2KT8A 4DEXA 1QVFA 2P4RA 2PZ1A 2YDLA 2RB6A 4C0FA 1WJQA 4NUCA 2VASA 4HKEA 3SB2A 3EGDB 4Y92A 1OPLA 3CC7Q 3VUBA 2QEXA 5ENIA 1K8AC 5M9OA 4Y28E 1X69A 4MMKA 4ZN1A 4HXMA 4Z6HA 5LVRA 2JVVA 4MDWA 2YRCA 4B6MA 2DRMA 2DEQA 2O01E 2CH4A 3CXCP 5DYCA 4KH0B 1JM4B 4HBYA 1GFCA 4PJLA 4C92F 5DYUA 1VQOT 4BY6B 1X0JA 3CQTA 4B9WA 2F6NA 5C89A 4M77D 1QCFA 4XAXB 2SRCA 4NS5A 2V8JA 4C66A 5LJ5g 4QUUA 3OYYA 1Q86R 2Y90A 3OYKA 2HZYA 5GAOp 2QQ9A 3QYGB 3OYNA 2FO0A 4AKNA 1Q82R 2WSCE 4M7DE 3CCRA 2L84A 5J26A 3ZFJA 3O33A 3P1CA 4HXJA 5F3AA 2YLBA 5ENHA 1K73U 1MMDA 2LQ8A 3OA6A 5HRVA 2LCSA 3E9FA 4IKFA 1X75C 2KRMA 2DL8A
chains in the Genus database with same CATH topology
1BI2A 4A9IA 3OBWA 2E12A 5A2QE 2L5QA 2XDPA 5HJCA 1EQFA 5F1LA 4E7HA 5KTWA 5FE3A 1VQ4A 5GAOr 4FSXA 2VXFA 2ZPGB 5FE7A 4UYGA 5CU8A 5FRNA 3G71T 3FDRA 1UGPB 2DD4A 3DWYA 1QVPA 2OAUA 3UPUA 4XTVA 5CRZA 3RESA 2OSSA 2VC8A 4UYFA 4C92A 4B9XA 2E7NA 4O5VA 5D0CA 1BI3A 4PJOA 1G3SA 1K73C 5ENJA 2MJVB 4UIXA 2E10A 1AHJB 5D24A 5EWDA 3RMQA 2QQSA 2RD1A 3O34A 4TVRA 2L85A 1MHNA 1N9SA 1VQ7A 3FB9A 5EGUA 5FLXE 3M5AA 5F1HA 3PTAA 2JTMA 2QQBA 1JB0E 1M1KU 3MXFA 4O7EA 2OTJA 4WF2A 3X20B 3CCLT 5CUCA 5KO4A 4YATA 4O7AA 2XG8D 2KAFA 4YC9A 4F3IA 4RCCA 4BD3A 4QR5A 1Q82C 3I56T 5DLXA 5GANh 4TZ2A 1VQKT 4M7DC 5DW1A 4FU6A 4LC2A 3A8GB 4A9EA 4PJOC 2E7OA 4C8QG 4NUEA 1UGQB 2OTJT 3EAEA 3A8LB 3JAME 2YDWA 5GAN5 2XU8A 5C6SA 4LZRA 3L2VA 2JNGA 3E19A 4XQ3A 5A5OA 3HFNA 5CO7A 3OYBA 4QSQA 4M7AG 1Y07A 2E65A 4JLGA 1VQ5T 3C95A 1YJ9A 1JBMA 2CZ6B 3U5JA 4NYXA 2JOYA 4DA4A 4CFKA 4ZGDB 2G4AA 4LD9K 1KQSS 3GIBA 3JVKA 5ACYA 2PU9B 3MB4A 4J0SA 1WPYA 3CC4T 5GAMd 4QSVA 4XY9A 3RMSA 2GRCA 4LDWA 3G71A 4BUGA 2E1HA 2RK2A 1VQ9T 5KH6A 3JVJA 4C8QD 4HBVA 3KXTA 3JCMe 2KK4A 1VQMA 3CCSA 3JVMA 2MAMA 2E6ZA 4YYMA 4O78A 2RI7A 2R5AA 4IUPA 5CK9A 4O71A 3TEEA 4YH3A 1U8RA 3M57A 4EMKB 3M53A 4JS4A 2E70A 5LJ3e 3V8LA 4FT4A 5A0LA 3FKMX 5L8RE 3QJYA 1S72T 1QW1A 4PCEA 2R0SA 4E7IA 4CUQA 4GY5A 5JI8A 2RO1A 4QSPA 3RKYA 1XNIA 5FE8A 5CKEA 4IOQA 3P1EA 4O76A 2CZ7B 3OYGA 5EV9A 4UIYA 4YYHA 2XD0A 4ALGA 2DWWA 3RKXA 4IR6A 3ME9A 4N4HA 3A8HB 4M78B 1M8VA 5KE2A 4QYDA 4IR5A 4PKCC 4LZ2A 4ZGJB 4LRGA 3LYIA 5EWVA 3JCMX 2EFIA 4QZSA 2RI3A 2JUFA 1VQ5A 4M7DG 5AD2A 2LC4A 3G0JA 4PJOG 5LJ5f 4LD6A 4N0AC 4HBXA 4C92G 2H60A 2PQWA 3ASKA 4E7LA 2HQXA 2IVWA 1VQOA 5GAOn 5CQ5A 3OS5A 2RFJA 1YJNA 4HT8A 3PFSA 4ALHA 5HQ6A 1IREB 2R10A 3CC7T 5LKZA 1M90U 2WACA 1N72A 5LJ3g 5GMKi 5D3PA 3SWNB 5CTLA 3OQ5A 3D7CA 5LJ5e 4PLLA 5FG4A 4XTWA 3SWNA 1Y96B 5H1TA 3J7AF 3MEAA 1BIBA 4Z93A 4A4KA 4EMKC 2B8AA 5I80A 3HMEA 1U1TA 4HT9A 2RHYA 4YTLA 1NZ9A 5FB1A 1JSPB 4FT2A 2R57A 5D3LA 3OSSC 2RH2A 3UVXA 4C5HA 4QVDA 1F68A 2KTBB 4F7UA 3JCMQ 3QYHB 3PNWC 3RUXA 3OW2S 5HY6A 5GAN8 1KHIA 4XYAA 1S72A 3ER0A 3UVWA 1VQ8T 2MF2A 5BT5A 3ZYUA 4M78C 3OYEA 4XUAA 3LH0A 3JB9J 2V8KA 5GANf 3HRSA 3NTKA 4OGJA 2XICA 5EP7A 1LOJA 3CCJA 5GAMf 5FG6A 2K57A 5LL6S 2K3XA 4L59A 4O74A 4QC1A 3LX7A 3EFSA 3QZ5B 4TZ8A 1VQ6T 4TTEA 1QVGS 3U5KA 2EJGA 2A3LA 4O7CA 1WJSA 4BHWA 2RO0A 3OYLA 1YI2A 4PNOA 1NPPA 3CEYA 4LYIA 1BIAA 5LJ5j 4BE0A 2KDSA 4C92E 2DJZA 3J80E 2L3RA 2XIDA 2I8NA 5C85A 5DKDA 2CGHA 2E6NA 3UV5A 5IGNA 2PVDB 1G3YA 3HP9A 4Z02A 1VUBA 4C8QA 4IUTA 2YEKA 3G4ST 4C92C 5EA1A 5LJ1A 2D6FA 2M0OA 5HFRA 4JJNK 5EVAA 3X24B 4CI0C 4O70A 3FRNA 3OYJA 4OGIA 4Q0OA 5ENBA 4QSRA 5A5PA 2DZ9A 4M77E 1WUGA 4KUDK 5KTXA 3PIPA 4KT0E 4CUTA 3WVEB 4ZW1A 3RCWA 1JJ2S 1QP3A 4NR8A 2ZPEB 5L98A 2YHTA 2RM4A 5I40A 4MEQA 4A4GA 4MZMA 2DIGA 2XI9A 4M75C 5GANe 4XU3A 4BDYA 3JCMP 3JB9G 1Q82U 4A9MA 2K5IA 4C8QF 2FYKA 4MR6A 5I29A 3A8MB 5EWHA 3KUFA 3S91A 4N3WA 4E47A 4UYEA 4OMFB 5DY7A 2RJEA 2QA4T 4YABA 3JCMg 2D82A 3QIIA 5CY9A 4M78E 5HQ7A 5DYXA 4DQ2A 2C06A 3LWIA 4CL9A 1WJRA 4QB3A 3MB3A 4A9LA 1X01A 1RL2A 3OS2A 4QEVA 2ZGWA 5CIUA 4TYLA 3OMGA 5AD3A 4A53A 2RNYA 2V8IA 4O75A 2XDDA 1G3WA 4NQMA 5LJ0A 2RK1A 4EMHA 5A0DA 4HCBA 5CQXA 5CPEA 1M9SA 3VJPA 3EFRA 2DKGA 1VQLA 4OB0B 1H641 5GAMe 4F7UF 4WHUA 3G6EA 4YADA 4LZSA 3VKIA 4BB7A 5C0MA 1KQ1A 1N6AA 3JB9F 4YH4A 3A5ZB 2E41A 4BI8B 4YY4A 4M7AF 3M55A 2DTOA 4HXSA 5HENA 4C5EA 1NJIC 4UYFB 3HKSA 5F63A 2KMTA 4YYKA 2K5LA 4C0ZA 3CCRT 4IOOA 5E7DA 2YYNA 5DW2A 4KCXA 5IGMA 4X2IA 5CQ3A 5COIA 4UIZA 3L2WA 5EWCA 3P1FA 5DY9A 5I7YA 4II1A 3U5MA 3P8HA 2OO1A 1VQNA 5GMKm 4PY6A 3CBOA 5E74A 4NR4A 2JTFA 3L2ZA 2CZ1B 1VIEA 2LSPB 4LDUA 4C67A 5DLZA 3CCQT 2CKKA 2E3KA 1LNXA 4FLPA 4TS8A 4QEUA 5DKCA 5E9MA 2PUOB 4DONA 5FH8A 5BT4A 3J81E 1QVGA 4N4FA 5FFVA 1I81A 4KV4A 2FSAA 3P8DA 3E9GA 3L1AA 5G4SA 5J39A 5HRXA 2QDYB 1VQPA 1YJWA 4BY6C 1BI1A 2FHDA 2RHXA 5A5QA 4YYIA 4ELYC 2R0YA 4YAXA 5LKUA 5KU3A 1K9MC 3GG3A 1U1SA 5A5NA 5LJ5d 5A5SA 2GCXA 4Y91A 1OZ3A 3GP8A 4TT6A 3OB9A 3QKJA 3V8JA 2P0QA 5F61A 3CCMT 3M54A 2K2VA 3VYGA 2EIFA 4UYDA 3DLLA 5C8GA 3QHSA 3KBGA 5CKFA 3JCMV 4VUBA 3RKWA 4M75E 3VYHB 3FIFA 1WQWA 4A54A 1M90C 2PUKB 4OB2B 3GNFB 5E9VA 1B34B 3IU6A 4XTUA 3O35A 1NJIU 4NRBA 3OW2A 4CFLA 3CC2T 5IGLA 4YYNA 4NR5A 4CLBA 4HXOA 3Q2EA 1VQMT 3HMFA 3V7SA 4NR9A 4M7AE 2M16A 3NFCA 5EPBA 1M1KC 2DK3A 5FE6A 2EKOA 2XK0A 3G0LA 2F5KA 4DOWA 5EM3A 5IBNA 3GF5A 5A5RA 3SDZA 3LQHA 3DB3A 3U5OA 5D6WA 4UITA 2LDMA 5A81A 4R55A 2E64A 3VU3C 1O9SA 4TT4A 2YELA 4R56A 5G4RA 3FJPA 4C0DB 5KTUA 3CCST 3P5OA 4RG8A 4J5YA 4TU4A 3TLPA 4IUUA 3PGGA 2QA4A 4JS5A 4YYJA 1HXDA 2X4JA 2RHZA 3BFMA 4M75D 4IURA 3CCUA 4Q0NA 2RJCA 3RERA 1WQ7A 4M7AC 3QG1A 3CBPA 4A9JA 5GAMh 1D3BB 1YJWT 2LTOA 2R0VA 1D3BA 5GMKl 4QQDA 4ZC9A 4OP0A 1KD1U 2LVMA 4MZTA 5LJ5h 4C8QE 5LVQA 5GMKj 5D3RA 4MR4A 3TCJA 5L8TA 3LGFA 5I86A 4J0RA 3M4YA 1I5LA 1DJ7B 3S6WA 1Q81U 3OYAA 3TREA 4PJOB 4IR4A 3CMEA 3OYCA 5F25A 4N4GA 1YIJA 1EIFA 3FLGA 3INZA 4PJOD 3P1DA 3OMCA 1IZ6A 1WGSA 4RCBA 4M7AD 4Q5WA 4M77A 5D25A 5F60A 4OGEA 4RMOA 2BKDN 3CD6T 4IR3A 3TU4K 5EI4A 3MO8A 3CC7A 3CMET 4LDYA 5HQ5A 2DTHA 4BE1A 5D6XA 3V7RA 2DATA 4A9NA 5CQYA 4IORA 5HFQA 4E7KA 2F6JA 4ELZC 3HPWA 3CCEA 2EQKA 5A83A 5TCMA 4MR5A 3V8KA 4PJOE 3L2QA 3GOXA 2VYTA 2HAXA 2MI6A 3QZVA 3OS0A 3RIRA 4M78A 3UWNA 3SWNC 3SVHA 1VIFA 5F62A 1YCYA 1VQ8A 2M1HA 5GAN6 1BI0A 4OF1A 3CCLA 4ZQLA 4J7IA 5D26A 4UIUA 1H3ZA 3L42A 4MDXA 3LWHA 2L8DA 3GPLA 2M9UA 2RNWA 5DX4A 3DKMA 2ZPFB 3JB9H 1HK9A 4JRIA 2AHJB 5IT9E 4CUPA 2GF7A 4EMKA 1FX7A 4MMLA 1N9RA 1ZQ1A 5A82A 3S3OA 4QY4A 3ONIA 2DXBA 4O6JA 5D3TA 3I55A 5LJ2A 3N5BB 4KBMB 3OYFA 1XOVA 3R6OA 4XY8A 2X4XA 1PSFA 3OYHA 2DVEA 1TH7A 1YBYA 1JJ2A 4BACA 2RI5A 5FFWA 4NL3A 3L2RA 2DVSA 2MMPA 3CPWA 2K4YA 4FL6A 4QW2A 5BT3A 5GAOm 3JVLA 3OYIA 2A7YA 3HMHA 2P0PA 3P8BB 4O7BA 5I89A 4TU6A 5FH7A 4N0AA 4C0GA 2GQVA 4NOYA 5L8UA 4UYHA 5CFWA 1SSFA 4ZGEB 2HNIA 4HXKA 3CCVT 4HXLA 4C92B 4A9HA 5CKBA 5FBXA 3UV4A 5H85A 1I4K1 1Q7YC 2YRVA 3C12A 4QQGA 1XQHA 3E1SA 5EK9A 4P5NA 2LT4A 3ZBDA 3ZEHA 4A9FA 3CPWS 3CCET 5IAYA 5AMEA 3GLXA 4XU0A 3CCVA 2XDBA 4CURA 5HM0A 4CRIA 5FE2A 4GPJA 4J3IA 4JLIA 3M9QA 5E9KA 5ENCA 4E7JA 4NYWA 5E0RA 1Y71A 1GXIE 4HXPA 5CUGA 3JCMJ 5D3HA 4C5GA 1OZ2A 4YK0A 5ETDA 5E9LA 5D7XA 3LJWA 1YITA 2F69A 3MCAB 1G5VA 2DAQA 3QUIA 4YYDA 5CKHA 1X6OA 1UB4A 5CR2A 5CQAA 3NTHA 3S92A 2ZPIB 1O75A 2ZZDA 4UIVA 3CBMA 4MZPA 5F5ZA 2YW5A 4FM4B 4A9KA 5D3NA 4ZN3A 1YITT 4F7UB 3AQAA 4NUDA 5HCLA 2DTIA 4MR3A 5D6YA 2X35A 4V2SA 2OTLA 1VQPT 3LGLA 4XUBA 2N9GA 5EPSA 5F36A 5FROA 4M7AA 4M7DA 2LRQA 4Y03A 4BW1A 1MGQA 4HCZA 3MP8A 4J83A 4J6YA 3LLRA 5CRMA 5FU7B 4M78G 1UEBA 3MHXA 1VQ6A 5DBMA 1BYMA 5L96A 3CMAT 4QUTA 5IG6A 3CCMA 3LQIA 2DIQA 1WNLA 1P92A 4KV1A 1N8RU 4EDUA 5AMFA 3MEVA 2DVVA 5CQTA 5I1QA 1BKBA 1VQLT 1M5Q1 4M77C 4WIVA 4QEWA 3LW5E 3JCMc 5CP5A 5IN1A 5I83A 5ETBA 2O4XB 1VQNT 4EMGA 3MUKA 3OBYA 1PSEA 4RVRA 4C8QB 5EPRA 4YY6A 3IU5A 4DOVA 2DVQA 5EWWA 2RHUA 5DYAA 1YHQT 1LJOA 3U5NA 5GANg 1WUMA 5C7NA 1W2BS 2LCCA 1VQ7T 5CQ7A 2Y4XA 3FC3A 5IIDA 2E5QA 2KY9A 5I88A 5C4QA 3I3JA 2ZCFB 1N27A 3JCMW 5ENGA 4C8QC 4JRPA 4NRAA 2EQJA 1I8FA 4QSSA 2GFUA 5DLOA 3MULA 4PTBA 4BW3A 4PJOF 5HKCA 2P0KA 3WXMB 3DLMA 5LJ3d 2YQDA 2WP1A 5DM7R 2K3YA 3META 5H1VA 2VUBA 5HEMA 2LCLA 2RJDA 4QSTA 2RHIA 4BW4A 3BW1A 1Y7XA 3DAIA 4KUIA 2WSEE 2HQEA 5CUEA 4PCIA 3MEUA 4MEOA 4QC3A 5I7XA 5ENFA 1RI0A 3C4SA 5CQ6A 5KE3A 3CCUT 2LT1A 2CYZB 2GFAA 3DB4A 3S3NA 2YEMA 4HA8A 5FRMA 1KHCA 1YJ9T 2HD0A 5D3SA 2O4XA 3HFOA 3HSBA 4LYWA 1Q86C 5CUDA 3SFMA 5I2SA 3QJ6A 3O37A 3G6ET 5DFCA 4M7DD 4YBTA 3AHUA 3JSCA 4LR6A 3G7ZA 5II2A 5ENEA 5E9YA 1V29B 4IUVA 3OYDA 4ATOA 3JCMf 5LUUA 2L5EA 5FE4A 2RS9B 2K5FA 5EISA 5FDZA 4OB1B 1Q7YU 3OS1A 4QYLA 5DFDA 2G3RA 3H8ZA 3SD4A 4BDZA 2QQAA 4M75B 2D0QB 5KCHA 3CC4A 3L2UA 5CVIA 4NR6A 5FE9A 1M1GA 5A7CA 5GANd 4QBMA 5H1UA 3MP1A 1VQ9A 3M4GA 3QO3A 2R5MA 4JRKA 4YBSA 1R8OB 4M7DF 4M77G 4CUUA 3URGA 5AYFA 4XTYA 1KQSA 4MENA 2WSFE 2HBPA 2XHCA 4E96A 3BDLA 3NTIA 5D3JA 2MWPA 4PLIA 4C0DC 3HL8A 1W2BA 2VV5A 5L99A 1VQKA 4M7DB 3AADA 3QDRB 1NPRA 2WP2A 5CQ4A 4XU1A 5HK0A 2VGMA 3JRZA 2L89A 4L5GA 4FIBA 5FFYA 2DKWA 4WHWA 2DO3A 5A85A 3MP6A 1KC8U 5E73A 4PKLA 3I56A 3U5LA 2PVOB 3BDUA 3LQJA 2I2LA 3CCJT 4YYGA 1QP2A 5HLSA 4Z1SA 1M4ZA 2EAYA 5CQ8A 2H3JA 5GAMj 1ZHIA 1UGSB 5GANj 2D9TA 4MEPA 1YJNT 5JWMA 2BIVA 2QTXA 2EJFA 4JDSA 4M75A 1N8RC 3HHTB 5J0DA 2YLCA 3CPFA 4UC4A 5LJ3f 2EJ9A 1VQ4T 2P4TA 3QPHA 2I7KA 3K2JA 5E9IA 5F2PA 2MWOA 4L6V5 4OB3B 4BJXA 4LDXA 3CC2A 3JCMd 3O36A 4PL6A 1YHQA 5DLQE 4BE2A 5GAMg 1KG1A 4NRCA 5KHMA 3UVYA 4QVCA 3M59A 5K29A 1Q81C 3CCQA 5CCAA 3WVDB 2IG0A 3X25B 4QR3A 5CZGA 4IUQA 2RJFA 3V7CA 4LDVA 2QEXT 2NXBA 3MEWA 1KD1C 5FE5A 2DXUA 5II1A 4NQNA 2CS7A 5EQ1A 2ZPBB 5CUAA 3PT9A 5CS8A 4TQNA 3C94A 1Q86U 3O8VA 2KQWA 3QSUA 4XU2A 4Z6IA 3JCMh 4O7FA 2JZ2A 5EICA 2KVQG 3OYMA 3OY9A 4F7UE 4OGCA 4M75F 4OUFA 4QVZA 1YIJT 5FE1A 4J6XA 4J8OA 3U5PA 3UW9A 4CUSA 3UT1A 4N4IA 3CMAA 3FEOA 3CD6A 3M56A 2EWNA 1G3TA 4OVAA 4C5IA 5L97A 4HXNA 2DXTA 2CZ0B 5KCOA 5FU6C 1FXXA 5GAOq 4M78F 4M75G 5I21A 3MQMA 2DPPB 3T9NA 4D6WA 4JUVA 5E3DA 5FB0A 1M1FA 4QSXA 4LDFA 3HRTA 2RI2A 3SVFA 3CXCS 3VUZA 4O77A 4A9OA 2Y4YA 5EG2A 5FE0A 5LJ3h 4ME7A 4XTZA 4M7AB 2D9EA 5C87A 2FL7A 4XK8E 1ZS5A 5FG5A 2NLUA 3UVDA 2X4WA 4BW2A 2QQRA 3Q1JA 5GAOl 4C92D 1KQ2A 1OI1A 4M77F 4M78D 4NL2A 5GMKe 3NXBA 2FVUA 3A8OB 3PIOA 1NE8A 4JRQA 2FB7A 4QQ6A 4BI4A 2LNVA 4QR4A 1K9MU 4HBWA 1UGRB 1OYXA 4LYSA 2DZCA 2PVGB 3H6ZA 4HXRA 1KC8C 2OTLT 5CUBA 4X9CA 4Z1QA 3X28B 2EQUA 3Q2FA 3I55T 4UIWA 4NYVA 4X34A 2LQKA 5DKHA 2VGNA 2X4YA 5HELA 5CGPA 4O72A 2JN0A 5LJ3j 3QZ9B 2QXFA 2R58A 4QSUA 5FU6B 2RNXA 3UDCA 4F7UG 4ZTFA 4X9DA 3QBYA 5CKDA 1QVFS 2RA2A 4A4HA 2KSSA 4HCCA 4QNSA 4TT2A 5J3BA 2F5TX 1Y96A 5GAN3 4PS5A 3CXCA 3OSVA 1FWZA 1YI2T 4QSWA 5LKTA 4XTXA 5EU1A 2QI2A 3PMIA 3M58A 2DXCA 3UV2A 3PMTA 4J6WA 4EPCA 1JRIA 1B34A 4RG2A 2BUDA 3BY7A 5FU7C 3HRUA 5A0GA 3QZSA 1ZBXA 5FH6A 3QZTA 3QXEB 4M77B 3SVGA 2LX9A 3X26B 3G4SA 5IGKA 3LXJA 5GAN2 2OUOA 4RKUE 4A4EA 5CAIA 2XKOC 5GAN4 3JB9I 2VXEA 2DD5A 3JCMb 5GAN7 3F70A 5HRWA 5DFBA 5TB6A 3S3MA 5HK3A 4A4FA 2ZPHB 4NXJA 1XTDA 1K8AU 3VV0A 4ZTJA 4NR7A 5GMKh 5LKXA 4J7FA 1E6IA 4J1PA 2DVRA 2EQMA 2EYQA 4YBMA 4GLKA 4KULA 3JB9D 3GNGA 5I2MA 1W4SA 5E3GA 4BI3A 1QVFA 2RB6A 4C0FA 1WJQA 4NUCA 4HKEA 3SB2A 3VUBA 2QEXA 5ENIA 1K8AC 5M9OA 4Y28E 4MMKA 4ZN1A 4HXMA 4Z6HA 5LVRA 2JVVA 4MDWA 2DEQA 2O01E 5DYCA 1JM4B 4HBYA 4C92F 5DYUA 1VQOT 4BY6B 1X0JA 4B9WA 2F6NA 5C89A 4M77D 4XAXB 4NS5A 2V8JA 4C66A 5LJ5g 4QUUA 3OYYA 2Y90A 3OYKA 5GAOp 2QQ9A 3QYGB 3OYNA 4AKNA 2WSCE 4M7DE 3CCRA 2L84A 5J26A 3ZFJA 3O33A 3P1CA 5F3AA 2YLBA 5ENHA 1K73U 2LQ8A 3OA6A 5HRVA 3E9FA 4IKFA 1X75C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DX4 A;  1WUG A;  4A9I A;  5KTX A;  3LQJ A;  4CUT A;  2XDP A;  4ZW1 A;  5HJC A;  3RCW A;  1EQF A;  4YYG A;  5F1L A;  4CUP A;  2GF7 A;  4E7H A;  5KTW A;  5HLS A;  4Z1S A;  4NR8 A;  5FE3 A;  5L98 A;  5I40 A;  5FE7 A;  4MEQ A;  5CQ8 A;  5A82 A;  4A4G A;  4UYG A;  5CU8 A;  3S3O A;  5FRN A;  4QY4 A;  3ONI A;  2DIG A;  3FDR A;  2D9T A;  4MEP A;  5JWM A;  4BDY A;  2BIV A;  3DWY A;  5D3T A;  4A9M A;  5LJ2 A;  5CRZ A;  3OYF A;  2OSS A;  4MR6 A;  5I29 A;  4XY8 A;  4UYF A;  2X4X A;  5EWH A;  3KUF A;  3OYH A;  3S91 A;  4B9X A;  2E7N A;  4N3W A;  4UYE A;  5D0C A;  4BAC A;  2RI5 A;  5J0D A;  5DY7 A;  5FFW A;  3L2R A;  2DVS A;  5ENJ A;  2MJV B;  2RJE A;  4YAB A;  4UC4 A;  4FL6 A;  4QW2 A;  5BT3 A;  2D82 A;  4UIX A;  3QII A;  5CY9 A;  2I7K A;  3JVL A;  3OYI A;  5D24 A;  3K2J A;  5EWD A;  5HQ7 A;  5DYX A;  5E9I A;  2QQS A;  3HMH A;  3O34 A;  5F2P A;  4O7B A;  2L85 A;  5I89 A;  4CL9 A;  1MHN A;  4TU6 A;  2MWO A;  5FH7 A;  4QB3 A;  1WJR A;  3MB3 A;  4BJX A;  4A9L A;  5EGU A;  3OS2 A;  3O36 A;  4QEV A;  5CIU A;  4PL6 A;  4TYL A;  3OMG A;  5AD3 A;  5F1H A;  5L8U A;  4UYH A;  2RNY A;  5CFW A;  4O75 A;  1SSF A;  4BE2 A;  4NQM A;  4HXK A;  3MXF A;  4HXL A;  5LJ0 A;  4NRC A;  4O7E A;  5KHM A;  3UVY A;  4A9H A;  5CUC A;  5FBX A;  3UV4 A;  5H85 A;  5K29 A;  5KO4 A;  4YAT A;  2YRV A;  4QQG A;  5CPE A;  4O7A A;  2IG0 A;  5EK9 A;  4QR3 A;  4YC9 A;  5CZG A;  4F3I A;  4IUQ A;  4QR5 A;  2RJF A;  4BD3 A;  3ZEH A;  4A9F A;  2NXB A;  4WHU A;  5DLX A;  3MEW A;  4YAD A;  4LZS A;  5IAY A;  5C0M A;  4TZ2 A;  5FE5 A;  5DW1 A;  5II1 A;  4NQN A;  5AME A;  4FU6 A;  4LC2 A;  4A9E A;  4YH4 A;  2E7O A;  4NUE A;  4CUR A;  5HM0 A;  3EAE A;  4CRI A;  5FE2 A;  2YDW A;  4GPJ A;  5EQ1 A;  5C6S A;  4YY4 A;  4LZR A;  4J3I A;  3L2V A;  3M9Q A;  5CUA A;  5E9K A;  5ENC A;  4HXS A;  4E7J A;  5HEN A;  4C5E A;  4NYW A;  5A5O A;  3OYB A;  5E0R A;  4UYF B;  5F63 A;  4QSQ A;  4HXP A;  5CS8 A;  4YYK A;  4TQN A;  4IOO A;  3O8V A;  5CUG A;  5D3H A;  5E7D A;  2YYN A;  5DW2 A;  4C5G A;  1OZ2 A;  4KCX A;  4YK0 A;  5ETD A;  5IGM A;  3U5J A;  5E9L A;  5D7X A;  3LJW A;  4NYX A;  4X2I A;  4Z6I A;  1G5V A;  2DAQ A;  4YYD A;  5CQ3 A;  5COI A;  4O7F A;  4UIZ A;  2JZ2 A;  5EIC A;  3L2W A;  5EWC A;  3P1F A;  5CQA A;  3NTH A;  3OY9 A;  4CFK A;  5I7Y A;  3S92 A;  2G4A A;  3OYM A;  4II1 A;  3JVK A;  4UIV A;  4OUF A;  3U5M A;  3P8H A;  4QVZ A;  5F5Z A;  2OO1 A;  5ACY A;  4PY6 A;  3MB4 A;  4J0S A;  5E74 A;  2YW5 A;  4QSV A;  4XY9 A;  5FE1 A;  4A9K A;  4NR4 A;  2GRC A;  2JTF A;  5D3N A;  3U5P A;  2LSP B;  3UW9 A;  4CUS A;  4C67 A;  5DLZ A;  3UT1 A;  4N4I A;  3AQA A;  4NUD A;  3FEO A;  5HCL A;  2CKK A;  5KH6 A;  2E3K A;  3JVJ A;  4FLP A;  4TS8 A;  4QEU A;  4MR3 A;  4HBV A;  5DKC A;  5E9M A;  4OVA A;  5D6Y A;  4DON A;  2X35 A;  4C5I A;  5FH8 A;  5L97 A;  5BT4 A;  3JVM A;  4HXN A;  4N4F A;  3LGL A;  4XUB A;  5FFV A;  2N9G A;  5EPS A;  4KV4 A;  2FSA A;  3P8D A;  5KCO A;  3E9G A;  5F36 A;  5FRO A;  5G4S A;  2LRQ A;  4YYM A;  4O78 A;  4Y03 A;  4BW1 A;  5J39 A;  5HRX A;  2RI7 A;  4HCZ A;  3MQM A;  2R5A A;  3MP8 A;  4IUP A;  2FHD A;  4O71 A;  2RHX A;  3LLR A;  5CRM A;  5A5Q A;  5E3D A;  4YH3 A;  5FB0 A;  4YYI A;  2R0Y A;  4QSX A;  4YAX A;  4LDF A;  5LKU A;  5KU3 A;  3GG3 A;  5DBM A;  5L96 A;  2RI2 A;  3SVF A;  5A5N A;  5A5S A;  4QUT A;  5IG6 A;  4O77 A;  1OZ3 A;  3LQI A;  2DIQ A;  4TT6 A;  4KV1 A;  3OB9 A;  4A9O A;  3FKM X;  4EDU A;  5FE0 A;  3QKJ A;  5AMF A;  3MEV A;  2DVV A;  4PCE A;  2D9E A;  2R0S A;  5CQT A;  5C87 A;  5F61 A;  4E7I A;  5I1Q A;  1ZS5 A;  4CUQ A;  4GY5 A;  5FG5 A;  5JI8 A;  2NLU A;  2RO1 A;  4QSP A;  4UYD A;  5C8G A;  4WIV A;  3UVD A;  5FE8 A;  1XNI A;  4QEW A;  4IOQ A;  3P1E A;  2X4W A;  4BW2 A;  2QQR A;  3Q1J A;  5CP5 A;  5IN1 A;  4O76 A;  3OYG A;  5I83 A;  5EV9 A;  4UIY A;  5ETB A;  4YYH A;  1OI1 A;  4ALG A;  2O4X B;  3MUK A;  4RVR A;  2DWW A;  5EPR A;  3NXB A;  4IR6 A;  3ME9 A;  4YY6 A;  5E9V A;  3IU5 A;  4N4H A;  3IU6 A;  5KE2 A;  2DVQ A;  4QQ6 A;  5EWW A;  3O35 A;  4QYD A;  4IR5 A;  2RHU A;  5DYA A;  4LZ2 A;  4NRB A;  4QR4 A;  4LRG A;  4HBW A;  4CFL A;  3U5N A;  1OYX A;  5IGL A;  4YYN A;  1WUM A;  4LYS A;  5C7N A;  3LYI A;  4NR5 A;  4CLB A;  2LCC A;  3H6Z A;  5EWV A;  4HXR A;  5CQ7 A;  4HXO A;  4QZS A;  3Q2E A;  2EFI A;  2RI3 A;  3FC3 A;  5IID A;  2E5Q A;  3HMF A;  5I88 A;  5C4Q A;  5CUB A;  3I3J A;  5AD2 A;  4NR9 A;  1N27 A;  4Z1Q A;  5ENG A;  3G0J A;  3Q2F A;  2EQU A;  2M16 A;  4LD6 A;  4NRA A;  4UIW A;  5EPB A;  4HBX A;  4NYV A;  2EQJ A;  2H60 A;  5DKH A;  2X4Y A;  4QSS A;  5FE6 A;  4X34 A;  5HEL A;  5CGP A;  4O72 A;  2EKO A;  2GFU A;  2PQW A;  2XK0 A;  3G0L A;  2F5K A;  3ASK A;  2R58 A;  3MUL A;  2HQX A;  4E7L A;  4QSU A;  4PTB A;  4BW3 A;  2RNX A;  2P0K A;  5EM3 A;  5IBN A;  4ZTF A;  3QBY A;  3DLM A;  5A5R A;  2YQD A;  2WP1 A;  2K3Y A;  5CQ5 A;  3MET A;  3LQH A;  3DB3 A;  3U5O A;  2RFJ A;  4A4H A;  5D6W A;  5H1V A;  4UIT A;  5HEM A;  2LDM A;  3PFS A;  2RJD A;  4QST A;  5A81 A;  4ALH A;  5HQ6 A;  4BW4 A;  2RHI A;  4QNS A;  4TT2 A;  2R10 A;  3DAI A;  5LKZ A;  2HQE A;  2WAC A;  1N72 A;  4PS5 A;  5CUE A;  5D3P A;  4TT4 A;  5CTL A;  2YEL A;  3OQ5 A;  4PCI A;  3D7C A;  3MEU A;  4MEO A;  5G4R A;  4QC3 A;  5I7X A;  4QSW A;  5LKT A;  4PLL A;  5ENF A;  1RI0 A;  5FG4 A;  5EU1 A;  5KTU A;  3PMI A;  3C4S A;  5H1T A;  3P5O A;  5CQ6 A;  5KE3 A;  2GFA A;  3DB4 A;  3MEA A;  4TU4 A;  3TLP A;  4Z93 A;  4IUU A;  3S3N A;  3UV2 A;  2YEM A;  2B8A A;  5I80 A;  3PMT A;  3HME A;  4YYJ A;  2RHZ A;  2RHY A;  4RG2 A;  5FRM A;  4IUR A;  1KHC A;  2BUD A;  4Q0N A;  2RJC A;  5D3S A;  5FB1 A;  1JSP B;  2O4X A;  4A9J A;  3QZS A;  4LYW A;  5CUD A;  5FH6 A;  3QZT A;  2R57 A;  3QJ6 A;  5D3L A;  3O37 A;  2LTO A;  3SVG A;  3UVX A;  4C5H A;  5DFC A;  2R0V A;  1F68 A;  4YBT A;  2KTB B;  4QQD A;  5IGK A;  4LR6 A;  3LXJ A;  4ZC9 A;  3PNW C;  5II2 A;  5ENE A;  2LVM A;  2OUO A;  5E9Y A;  4IUV A;  5LVQ A;  4A4E A;  3OYD A;  5D3R A;  4MR4 A;  4XYA A;  5LUU A;  2L5E A;  5L8T A;  3LGF A;  5FE4 A;  2RS9 B;  3UVW A;  5I86 A;  5EIS A;  3F70 A;  5HRW A;  4J0R A;  5DFB A;  5FDZ A;  5TB6 A;  3S3M A;  3S6W A;  5BT5 A;  3ZYU A;  3OYA A;  3OS1 A;  3OYE A;  4QYL A;  4A4F A;  4IR4 A;  4NXJ A;  5DFD A;  2G3R A;  4XUA A;  3H8Z A;  5F25 A;  3LH0 A;  3SD4 A;  4N4G A;  3OYC A;  4ZTJ A;  4NR7 A;  4BDZ A;  3FLG A;  5KCH A;  3P1D A;  5LKX A;  3OMC A;  1E6I A;  4J1P A;  3NTK A;  4OGJ A;  3L2U A;  5EP7 A;  2DVR A;  1WGS A;  4NR6 A;  4Q5W A;  2EQM A;  5FE9 A;  5D25 A;  5FG6 A;  5F60 A;  4YBM A;  5A7C A;  4QBM A;  5H1U A;  2K3X A;  3MP1 A;  2BKD N;  4L59 A;  4IR3 A;  4O74 A;  4QC1 A;  2R5M A;  5E3G A;  4YBS A;  3LX7 A;  5EI4 A;  4TZ8 A;  4CUU A;  3MO8 A;  4TTE A;  1WJQ A;  3U5K A;  4NUC A;  4O7C A;  1WJS A;  4MEN A;  5HQ5 A;  4BE1 A;  4BHW A;  2RO0 A;  5D6X A;  3OYL A;  2DAT A;  4A9N A;  4IOR A;  5ENI A;  5HFQ A;  4E96 A;  4LYI A;  3CEY A;  3BDL A;  5M9O A;  4E7K A;  3NTI A;  5D3J A;  4BE0 A;  2F6J A;  4HXM A;  4Z6H A;  2L3R A;  2EQK A;  5LVR A;  2MWP A;  5A83 A;  5TCM A;  4PLI A;  4MR5 A;  2I8N A;  5C85 A;  5DKD A;  3L2Q A;  3GOX A;  2E6N A;  2VYT A;  3UV5 A;  5DYC A;  5IGN A;  1JM4 B;  4HBY A;  5L99 A;  3QZV A;  3OS0 A;  5DYU A;  3UWN A;  4Z02 A;  1X0J A;  3AAD A;  4B9W A;  2F6N A;  5C89 A;  2WP2 A;  4NS5 A;  4IUT A;  2YEK A;  5CQ4 A;  4C66 A;  4QUU A;  3SVH A;  5F62 A;  5EA1 A;  2L89 A;  5LJ1 A;  3OYK A;  5FFY A;  2DKW A;  4WHW A;  2M0O A;  5HFR A;  3OYN A;  5EVA A;  2M1H A;  5A85 A;  4AKN A;  4O70 A;  4ZQL A;  3OYJ A;  3MP6 A;  5D26 A;  4UIU A;  4OGI A;  2L84 A;  4Q0O A;  5ENB A;  5J26 A;  4QSR A;  1H3Z A;  3O33 A;  3P1C A;  5A5P A;  3L42 A;  5E73 A;  5F3A A;  5ENH A;  3OA6 A;  4PKL A;  5HRV A;  2L8D A;  3E9F A;  4IKF A;  2RNW A;  3U5L A; 
#chains in the Genus database with same CATH topology
 1BI2 A;  4A9I A;  3OBW A;  2AK5 A;  2E12 A;  5A2Q E;  2L5Q A;  2XDP A;  5HJC A;  1EQF A;  5F1L A;  4IIO A;  4RTT A;  4E7H A;  5KTW A;  5FE3 A;  1VQ4 A;  5GAO r;  4FSX A;  2VXF A;  2ZPG B;  5FE7 A;  4UYG A;  5CU8 A;  5FRN A;  3G71 T;  1U06 A;  3FDR A;  4JZ4 A;  1UGP B;  1FMV A;  3DWY A;  1QVP A;  2DD4 A;  2OAU A;  3UPU A;  4XTV A;  5CRZ A;  3RES A;  2EKH A;  2OSS A;  2VC8 A;  4UYF A;  4C92 A;  1I07 A;  1WYX A;  4B9X A;  2E7N A;  4CC3 A;  4O5V A;  5D0C A;  1BI3 A;  4PJO A;  1G3S A;  1IHW A;  1T3L A;  2V1Q A;  1K73 C;  5ENJ A;  2MJV B;  2AKK A;  4UIX A;  1UHF A;  2AIR B;  2E10 A;  3M0Q A;  1AHJ B;  5D24 A;  5EWD A;  2RD1 A;  2QQS A;  3RMQ A;  3O34 A;  3UAT A;  1TUC A;  1LVK A;  4TVR A;  2L85 A;  4LN2 A;  1MHN A;  1N9S A;  1M2V B;  5KYW A;  1VQ7 A;  2ZAE A;  4LXC A;  3FB9 A;  1K1Z A;  5EGU A;  5FLX E;  2KGT A;  3M5A A;  5F1H A;  3PTA A;  2JTM A;  3D1B A;  2QQB A;  1JB0 E;  1M1K U;  3MXF A;  3G4S Q;  4O7E A;  3CD6 Q;  2OTJ A;  4WF2 A;  3X20 B;  3CCL T;  5CUC A;  2FPD A;  2MPX C;  5FW9 A;  2SEM A;  2J06 A;  5KO4 A;  4YAT A;  1VYV A;  1JU5 C;  4O7A A;  2I0N A;  1ZKR A;  2XG8 D;  2KAF A;  1WDX A;  4YC9 A;  4F3I A;  4RCC A;  4BD3 A;  4QR5 A;  1Q82 C;  1VQK Q;  2ABL A;  3I56 T;  5DLX A;  5GAN h;  2KR3 A;  4TZ2 A;  1VQK T;  1M3C A;  4M7D C;  5DW1 A;  2BZY A;  4QKU A;  4FU6 A;  4LC2 A;  3A8G B;  4A9E A;  3M0T A;  2VWF A;  2E7O A;  4C8Q G;  4NUE A;  1UGQ B;  2O9S A;  3EAE A;  3A8L B;  4PJO C;  2OTJ T;  3JAM E;  2YDW A;  5GAN 5;  2XU8 A;  5C6S A;  4LZR A;  3L2V A;  2JNG A;  3E19 A;  1UHC A;  4XQ3 A;  5A5O A;  3HFN A;  5CO7 A;  3EHR A;  2CUD A;  3OYB A;  1AWJ A;  2PNI A;  4QSQ A;  4KGX B;  1YWO A;  4M7A G;  1Y07 A;  2E65 A;  4JLG A;  1VQ5 T;  3C95 A;  1YJ9 A;  1JBM A;  2CZ6 B;  2LJ3 A;  3UF4 A;  3R6N A;  3U5J A;  1ZUU A;  4NYX A;  2FRY A;  2JOY A;  4OMM A;  5KYY B;  2LJ1 A;  1GCQ A;  4DA4 A;  4CFK A;  4ZGD B;  2G4A A;  4LD9 K;  1KQS S;  3GIB A;  3JVK A;  2BE7 D;  1IXD A;  5I22 A;  5ACY A;  2PU9 B;  3MB4 A;  4J0S A;  1WPY A;  3VS7 A;  3CC4 T;  1OU8 A;  5GAM d;  4QSV A;  4XY9 A;  3RMS A;  2GRC A;  4LDW A;  3G71 A;  4BUG A;  1RAB B;  2E1H A;  1D1C A;  2RK2 A;  1UJY A;  1VQ9 T;  5KH6 A;  3JVJ A;  4E7S A;  4C8Q D;  2O9V A;  3QWX X;  4GBQ A;  4HBV A;  3KXT A;  3JCM e;  2KK4 A;  4E2F B;  3CCS A;  1VQM A;  2DM1 A;  3JVM A;  2MAM A;  2RN8 A;  2E6Z A;  3CCJ Q;  2ED1 A;  4LE9 A;  1ZX6 A;  4YYM A;  4O78 A;  1M30 A;  2RI7 A;  3A98 A;  3G6E Q;  2R5A A;  4IUP A;  5CK9 A;  4O71 A;  3TEE A;  4YH3 A;  2AT1 B;  2J7I A;  2FZG B;  1U8R A;  3M57 A;  5KYX B;  4EMK B;  3M53 A;  4JS4 A;  2E70 A;  1K0X A;  5LJ3 e;  2CUB A;  3V8L A;  1GFD A;  4FT4 A;  2D1X A;  3RBB B;  5A0L A;  3FKM X;  5L8R E;  3QJY A;  1S72 T;  1QW1 A;  1IGQ A;  3EGU A;  4PCE A;  2C0O A;  2EGC A;  2R0S A;  4E7I A;  1HD3 A;  4KH1 B;  4CUQ A;  4GY5 A;  5JI8 A;  2RO1 A;  4QSP A;  3RKY A;  1XNI A;  5FE8 A;  5CKE A;  4IOQ A;  3P1E A;  1RAA B;  5KYN A;  2W0Z A;  4O76 A;  2CZ7 B;  3OYG A;  5EV9 A;  4UIY A;  4YYH A;  2XD0 A;  4ALG A;  1FMW A;  2DWW A;  3RKX A;  4IR6 A;  2DRK A;  3ME9 A;  1Y0M A;  4N4H A;  2NUT A;  2JT4 A;  3A8H B;  1TU0 B;  3C0C A;  4M78 B;  1MND A;  1M8V A;  5KE2 A;  1GCP A;  4QYD A;  4IR5 A;  4PKC C;  4LZ2 A;  4ZGJ B;  4LRG A;  3LYI A;  1VQO Q;  5EWV A;  1JXO A;  3JCM X;  2EFI A;  4QZS A;  2RI3 A;  2JUF A;  2DNU A;  1VQ5 A;  1MV3 A;  4M7D G;  1M2O A;  5AD2 A;  1K76 A;  2LC4 A;  3G0J A;  2CSQ A;  4PJO G;  5LJ5 f;  3LH5 A;  4LD6 A;  4N0A C;  2LNH B;  4HBX A;  4C92 G;  2OI3 A;  2H60 A;  1VOM A;  2PQW A;  2KEA A;  3ASK A;  4E7L A;  2HQX A;  2IVW A;  1VQO A;  5GAO n;  1RUW A;  1PRL C;  4OMP A;  2GTO A;  5CQ5 A;  3OS5 A;  2RFJ A;  4EIK A;  1BB9 A;  1YJN A;  4HT8 A;  1ARK A;  3PFS A;  2A37 A;  2A08 A;  2HL5 C;  4ALH A;  5HQ6 A;  1IRE B;  1G83 A;  1YIT Q;  2R10 A;  3CC7 T;  3EH1 A;  5LKZ A;  1M90 U;  2WAC A;  2DVJ A;  1N72 A;  2QK0 A;  5LJ3 g;  5GMK i;  5D3P A;  1OEB A;  5CTL A;  3SWN B;  3OQ5 A;  3D7C A;  1UGV A;  2DE0 X;  5LJ5 e;  1M90 R;  4KGZ B;  1PCX A;  4PLL A;  5FG4 A;  4XTW A;  3SWN A;  1Y96 B;  5H1T A;  3J7A F;  3MEA A;  3VS4 A;  1BIB A;  4Z93 A;  4A4K A;  2L2P A;  4EMK C;  2B8A A;  5I80 A;  3HME A;  1U1T A;  2CSI A;  2FG0 A;  4JJB A;  2RHY A;  4HT9 A;  2JS0 A;  2GNC A;  4YTL A;  1NZ9 A;  5FB1 A;  2QDL A;  1JSP B;  4FT2 A;  2R57 A;  5D3L A;  3OSS C;  2D0N A;  1ZSZ C;  2RH2 A;  3UVX A;  4C5H A;  2DJQ A;  4QVD A;  1F68 A;  2KTB B;  2OX7 A;  4F7U A;  3JCM Q;  3QYH B;  3PNW C;  3RUX A;  3OW2 S;  1RAI B;  1WHM A;  5HY6 A;  3FJ5 A;  2KXC A;  5GAN 8;  1B7T A;  1KHI A;  4XYA A;  1S72 A;  3G71 Q;  3ER0 A;  1VQL Q;  2E5K A;  3UVW A;  1VQ8 T;  2MF2 A;  1C0M A;  2DFU A;  3CC2 Q;  1KJW A;  5BT5 A;  3ZYU A;  4M78 C;  1C6V X;  3OYE A;  4CC2 A;  4XUA A;  2NUT B;  3LH0 A;  2K2M A;  3JB9 J;  2V8K A;  2VKN A;  5GAN f;  1WXU A;  3HRS A;  3NTK A;  4OGJ A;  2XIC A;  5EP7 A;  1LOJ A;  3CCJ A;  5GAM f;  5FG6 A;  2K57 A;  5LL6 S;  2FPF A;  2K3X A;  3EH2 A;  3VKG A;  4L59 A;  4O74 A;  4QC1 A;  1NEG A;  3LX7 A;  3EFS A;  1A0N B;  3QZ5 B;  4TZ8 A;  1VQ6 T;  4TTE A;  1QVG S;  3U5K A;  1XJW B;  2EJG A;  2A3L A;  4O7C A;  1WJS A;  1Z9Z A;  4BHW A;  2RO0 A;  3OYL A;  1YI2 A;  4PNO A;  3KFV A;  1NPP A;  2ROL A;  4LYI A;  3CEY A;  4WTO B;  1BIA A;  5LJ5 j;  4BE0 A;  2KDS A;  4C92 E;  2DJZ A;  3J80 E;  2L3R A;  4E7Z A;  1NLO C;  2XID A;  2I8N A;  5C85 A;  5DKD A;  1AEY A;  4AFQ C;  2CGH A;  2IPO B;  2D8J A;  4F17 A;  2E6N A;  3UV5 A;  4OMQ A;  5FWB A;  5IGN A;  2CT3 A;  2PVD B;  1G3Y A;  3HP9 A;  1H92 A;  4Z02 A;  1VUB A;  4C8Q A;  4IUT A;  2YEK A;  1N5Z A;  3G4S T;  4C92 C;  5EA1 A;  5LJ1 A;  2D6F A;  2C0T A;  2OTJ Q;  2M0O A;  5HFR A;  4JJN K;  5EVA A;  1G2B A;  2QAZ A;  4Z8A A;  3X24 B;  4FYW B;  4CI0 C;  4O70 A;  1C1A A;  2DF6 A;  3FRN A;  3OYJ A;  4OGI A;  4Q0O A;  5ENB A;  4QSR A;  5A5P A;  2JM9 A;  2DZ9 A;  1ZA1 B;  1NYF A;  1YN8 A;  1PM3 A;  1FMK A;  4HVV A;  4M77 E;  1WUG A;  4KUD K;  5KTX A;  4HVW A;  4PFO A;  4KT0 E;  3PIP A;  4CUT A;  8AT1 B;  1YIJ Q;  3WVE B;  4ZW1 A;  3RCW A;  4FW1 A;  1JJ2 S;  1QP3 A;  4NR8 A;  2ZPE B;  5L98 A;  2YHT A;  4PFZ A;  2RM4 A;  5I40 A;  4MEQ A;  2KXD A;  4A4G A;  3O5Z A;  4MZM A;  2DIG A;  1GL5 A;  1ZSG A;  2XI9 A;  4M75 C;  5GAN e;  4XU3 A;  4BDY A;  3JCM P;  1OQK A;  3JB9 G;  1Q82 U;  4A9M A;  1IB8 A;  2DER A;  2K5I A;  2M0Y A;  4C8Q F;  2FYK A;  4J9D A;  4MR6 A;  5I29 A;  2A36 A;  1LCK A;  3A8M B;  2V26 A;  1NM7 A;  5EWH A;  1ZSZ A;  3KUF A;  1K73 R;  3S91 A;  3IQL A;  4N3W A;  1TTH B;  1ABQ A;  4E47 A;  4UYE A;  1B3Q A;  4OMF B;  3A1P A;  5DY7 A;  2V1R A;  4AFS C;  1VYU A;  1PG5 B;  2RJE A;  2QA4 T;  4YAB A;  2HMA A;  3JCM g;  2D82 A;  3QII A;  5CY9 A;  2FEI A;  4M78 E;  5HQ7 A;  5DYX A;  4DQ2 A;  2C06 A;  3LWI A;  2YXY A;  4CL9 A;  3QWY A;  2RQT A;  1WJR A;  4QB3 A;  3MB3 A;  4A9L A;  3EGD A;  1X01 A;  1RL2 A;  3OS2 A;  4QEV A;  2ZGW A;  5CIU A;  4TYL A;  2EYX A;  3OMG A;  5AD3 A;  4A53 A;  2RNY A;  2V8I A;  1SPK A;  4O75 A;  2XDD A;  1G3W A;  4NQM A;  5LJ0 A;  2F2V A;  1YHQ Q;  2RK1 A;  2NWM A;  1QLY A;  1YJ9 Q;  2RQW A;  4EMH A;  1GBQ A;  1CKA A;  2YT6 A;  1M3B A;  5A0D A;  4HCB A;  5CQX A;  5CPE A;  1M8M A;  1M9S A;  3VJP A;  3EFR A;  2DKG A;  1AZG B;  1VQL A;  1W1F A;  1WHG A;  4OB0 B;  1H64 1;  5GAM e;  1M2V A;  5KYW B;  1YI2 Q;  4F7U F;  4WHU A;  4F16 A;  3G6E A;  4YAD A;  4LZS A;  3VKI A;  4BB7 A;  5C0M A;  1KQ1 A;  1N6A A;  1UEC A;  3JB9 F;  1SRL A;  3EGX B;  4YH4 A;  2J6F A;  3A5Z B;  2CP5 A;  2E41 A;  2ENM A;  3EGX A;  4BI8 B;  4YY4 A;  4M7A F;  3M55 A;  2DTO A;  4HXS A;  5HEN A;  4C5E A;  1JQQ A;  1NJI C;  4UYF B;  2CRE A;  5F63 A;  3HKS A;  2KMT A;  4YYK A;  2K5L A;  4C0Z A;  3I55 Q;  3MJX A;  3CCR T;  4IOO A;  5E7D A;  2YYN A;  5DW2 A;  2BZ8 A;  4KCX A;  2KI7 A;  1BU1 A;  5IGM A;  3M0P A;  4X2I A;  4AG1 C;  1YFN A;  5CQ3 A;  5COI A;  4UIZ A;  2GBQ A;  3L2W A;  5EWC A;  3P1F A;  5DY9 A;  5I7Y A;  4II1 A;  3U5M A;  3P8H A;  1PKS A;  2OO1 A;  4ANJ A;  1VQN A;  5GMK m;  4PY6 A;  3CBO A;  1M27 C;  2QG9 B;  5E74 A;  2K7A A;  4NR4 A;  2JTF A;  3L2Z A;  2CZ1 B;  1VIE A;  2LSP B;  4LDU A;  4C67 A;  5DLZ A;  3CCQ T;  2EGE A;  2CKK A;  2E3K A;  1LNX A;  4FLP A;  4TS8 A;  3EG1 A;  4QEU A;  5DKC A;  5E9M A;  2LQW A;  2PUO B;  4DON A;  2JMC A;  5FH8 A;  5BT4 A;  3J81 E;  1QVG A;  4N4F A;  5FFV A;  2ECZ A;  3VRY A;  1YCS B;  1I81 A;  4KV4 A;  2FSA A;  1OX9 A;  3P8D A;  3E9G A;  1SKU B;  3L1A A;  5G4S A;  1X2K A;  4J9I A;  4J9F A;  5J39 A;  1BBZ A;  5HRX A;  2QDY B;  2COW A;  1VQP A;  1YJW A;  4BY6 C;  1BI1 A;  4RUG A;  2FHD A;  2RHX A;  5A5Q A;  4DBR A;  4YYI A;  4ELY C;  2R0Y A;  4YAX A;  4RTU A;  5LKU A;  5KU3 A;  1K9M C;  3GG3 A;  1PHT A;  1U1S A;  5A5N A;  5LJ5 d;  5A5S A;  2GCX A;  4Y91 A;  1OZ3 A;  3GP8 A;  4TT6 A;  3OB9 A;  1VQP Q;  1AVZ C;  5GJV B;  3QKJ A;  1WHK A;  5IXF A;  3CCE Q;  3V8J A;  2P0Q A;  5F61 A;  3CCM T;  3M54 A;  2K2V A;  3AT1 B;  3VYG A;  2EIF A;  4UYD A;  1Q7Y R;  3DLL A;  5C8G A;  3QHS A;  4CC4 B;  3KBG A;  1D0Y A;  2J6K A;  2JMA A;  4ORZ A;  5CKF A;  3JCM V;  3U23 A;  4VUB A;  3RKW A;  4M75 E;  3VYH B;  3FIF A;  5IH2 A;  1WQW A;  4A54 A;  1M90 C;  2YUN A;  2PUK B;  3M0R A;  1K8A R;  4OB2 B;  3GNF B;  2AKL A;  5E9V A;  1B34 B;  1OU9 A;  1MMG A;  3IU6 A;  4XTU A;  2QGG A;  2L3P A;  3O35 A;  4RTZ A;  1NJI U;  4NRB A;  3CCL Q;  1UE9 A;  3OW2 A;  1FYN A;  4CFL A;  1YP5 A;  3E2U A;  3CC2 T;  5IGL A;  4YYN A;  4NR5 A;  4CLB A;  2JM8 A;  2HDA A;  1YWP A;  4HXO A;  3Q2E A;  3ZL7 C;  1VQM T;  1RAC B;  3I5S A;  3HMF A;  1OUL A;  3V7S A;  3I9Q A;  4NR9 A;  1G8X A;  4M7A E;  2X3W D;  1W6X A;  2M16 A;  3NFC A;  5EPB A;  1M1K C;  2DK3 A;  5FE6 A;  2EKO A;  2XK0 A;  3G0L A;  2F5K A;  3H0I A;  4DOW A;  3MKD A;  3CPW P;  5EM3 A;  5IBN A;  4HVU A;  2JS2 A;  3GF5 A;  5A5R A;  4R0K A;  3SDZ A;  3LQH A;  3DB3 A;  3U5O A;  2DL7 A;  5D6W A;  2NYS A;  4UIT A;  3VS5 A;  2LDM A;  1VQ6 Q;  5A81 A;  2H3E B;  4R55 A;  2E64 A;  3VU3 C;  1AT1 B;  1AD5 A;  4JPB W;  1B07 A;  4TT4 A;  1O9S A;  2YEL A;  4R56 A;  3H0F A;  1D1B A;  5G4R A;  3FJP A;  4C0D B;  4Z88 A;  5KTU A;  3CCS T;  4RTV A;  3THK A;  3P5O A;  4RG8 A;  1OPK A;  4J5Y A;  4TU4 A;  3TLP A;  4IUU A;  4QT7 A;  3PGG A;  2X51 A;  2QA4 A;  4JS5 A;  4YYJ A;  1HXD A;  2X4J A;  2RHZ A;  3VS1 A;  2CP0 A;  3BFM A;  4M75 D;  1PNJ A;  4IUR A;  3CCU A;  4Q0N A;  2RJC A;  3RER A;  1WQ7 A;  2X3X D;  4M7A C;  3QG1 A;  3CBP A;  4A9J A;  5GAM h;  3I56 Q;  1D3B B;  1YJW T;  1AWO A;  1NJI R;  1JJ2 P;  2LTO A;  1PUO A;  1QVG P;  1TUG B;  1VA7 A;  2R0V A;  1D3B A;  5GMK l;  2GTJ A;  8ATC B;  4QQD A;  1VQN Q;  4ZC9 A;  1D0Z A;  4OP0 A;  1KD1 U;  2FZK B;  2KE9 A;  2LVM A;  1MNE A;  3NPF A;  4MZT A;  5LJ5 h;  4C8Q E;  5LVQ A;  1WHH A;  2KNB B;  5GMK j;  5D3R A;  4MR4 A;  3TCJ A;  1TSF A;  5L8T A;  3LGF A;  1VQ7 Q;  5I86 A;  1V76 A;  4J0R A;  3M4Y A;  1I5L A;  1DJ7 B;  3S6W A;  1Q81 U;  3OYA A;  3TRE A;  4PJO B;  5HCK A;  4IR4 A;  3CME A;  3OYC A;  5F25 A;  1MUZ A;  4N4G A;  1U5S A;  2KBT A;  1YIJ A;  1EIF A;  1OX8 A;  3FLG A;  3INZ A;  4PJO D;  3P1D A;  3OMC A;  1IZ6 A;  1WGS A;  4RCB A;  4M7A D;  4Q5W A;  4M77 A;  1JEG A;  5D25 A;  5F60 A;  4OGE A;  1QQJ A;  2OJ2 A;  4RMO A;  2BKD N;  3CD6 T;  4IR3 A;  3TU4 K;  1R77 A;  5EI4 A;  2RNA A;  3MO8 A;  2RQV A;  2KT1 A;  3CC7 A;  3CME T;  2HSE B;  2QAS A;  3ULR B;  4LDY A;  5HQ5 A;  2DTH A;  4BE1 A;  5D6X A;  3V7R A;  2DAT A;  4A9N A;  5CQY A;  4IOR A;  5HFQ A;  4E7K A;  2COZ A;  1I1J A;  2F6J A;  1EZZ B;  4ELZ C;  3HPW A;  4F04 B;  3CCE A;  3VKH A;  2EQK A;  5A83 A;  5TCM A;  4MR5 A;  1UTI A;  3V8K A;  4PJO E;  1WI7 A;  1WX6 A;  3EFO B;  2FRW A;  3L2Q A;  1K9M R;  1AWW A;  3GOX A;  2VYT A;  2F2X A;  1MV0 B;  2DET A;  4J9H A;  2HAX A;  2MI6 A;  3QZV A;  3OS0 A;  3RIR A;  4M78 A;  3UWN A;  1SHF A;  1RAF B;  4J9E A;  3SWN C;  3SVH A;  1VIF A;  3SHW A;  5F62 A;  1YNZ A;  2P84 A;  2BE9 B;  1ZLM A;  1YCY A;  1IHV A;  1NBE B;  2EYW A;  2M1H A;  1VQ8 A;  5GAN 6;  1BI0 A;  4OF1 A;  3CCL A;  4ZQL A;  2Z0W A;  5D26 A;  4UIU A;  4J7I A;  4AFU C;  1H3Z A;  3L42 A;  4MDX A;  3LWH A;  2L8D A;  3GPL A;  3CCR Q;  2M9U A;  2RNW A;  4DBQ A;  5DX4 A;  4F14 A;  1WXB A;  3DKM A;  1HSQ A;  2ZPF B;  3JB9 H;  4GLM A;  1HK9 A;  4JRI A;  2AHJ B;  5IT9 E;  4CUP A;  2GF7 A;  4EMK A;  1D0X A;  2HL3 A;  1FX7 A;  4MML A;  1N9R A;  2LMJ A;  2LP5 A;  1ZQ1 A;  5A82 A;  3S3O A;  1E7O A;  4QY4 A;  3ONI A;  2DLP A;  3NMZ C;  5I11 A;  1RAH B;  2DXB A;  2OTL Q;  3JV3 A;  4O6J A;  5D3T A;  3I55 A;  5LJ2 A;  3N5B B;  4KBM B;  1ABO A;  3OYF A;  1XOV A;  4AG2 C;  3R6O A;  1E6G A;  4XY8 A;  2X4X A;  1PSF A;  3OYH A;  2DVE A;  1TH7 A;  1YBY A;  1JJ2 A;  4BAC A;  2RI5 A;  5FFW A;  3VS0 A;  4NL3 A;  3L2R A;  2DVS A;  1K0S A;  2MMP A;  3CPW A;  2K4Y A;  1S1N A;  4FL6 A;  4QW2 A;  5BT3 A;  5GAO m;  2CP2 A;  3JVL A;  3OYI A;  2DX1 A;  3VS3 A;  2A7Y A;  3HMH A;  2P0P A;  3P8B B;  4O7B A;  5I89 A;  4TU6 A;  5FH7 A;  4N0A A;  3M0S A;  4C0G A;  2GQV A;  2LJ0 A;  4NOY A;  1LPL A;  5L8U A;  4UYH A;  5CFW A;  1SSF A;  4ZGE B;  2W10 A;  2HNI A;  4HXK A;  1Q95 G;  3CCV T;  4HXL A;  4C92 B;  4A9H A;  4OMN A;  3EHQ A;  5CKB A;  2E3H A;  5FBX A;  3UV4 A;  2HBW A;  5H85 A;  1I4K 1;  1Q7Y C;  2YRV A;  3C12 A;  1JXM A;  3CCV Q;  2ATC B;  4RTW A;  4QQG A;  1XQH A;  2EBP A;  3E1S A;  5ECA A;  5IHK A;  5EK9 A;  4P5N A;  2LT4 A;  3ZBD A;  1PD0 A;  3ZEH A;  2MOX A;  4A9F A;  3CPW S;  3CCE T;  2O31 A;  5IAY A;  2QGF B;  2CP7 A;  4FCY A;  5AME A;  3GLX A;  4XU0 A;  2ESW A;  1GRI A;  3CCV A;  4AMC A;  4D8K A;  2XDB A;  1QWF A;  4CUR A;  5HM0 A;  4CRI A;  5FE2 A;  4GPJ A;  3D1D A;  4J3I A;  4JLI A;  3M9Q A;  5E9K A;  1WA7 A;  5ENC A;  4E7J A;  4NYW A;  5E0R A;  1Y71 A;  4M4Z A;  1GXI E;  4HXP A;  2F2W A;  5CUG A;  3JCM J;  5D3H A;  4RTY A;  4C5G A;  1OZ2 A;  2DL3 A;  3CCQ Q;  4YK0 A;  1YJN Q;  5ETD A;  5E9L A;  5D7X A;  3LJW A;  1YIT A;  1NYG A;  2F69 A;  1HYO A;  3MCA B;  1VQ8 Q;  4IIM A;  2DAQ A;  3QUI A;  1G5V A;  4YYD A;  5CKH A;  2GGR A;  1F1B B;  1R0C B;  1X6O A;  4J9G A;  1UB4 A;  1K9A A;  5CR2 A;  1M1K R;  2KRS A;  1ZUY A;  5CQA A;  3NTH A;  3S92 A;  2ZPI B;  1O75 A;  2ZZD A;  4UIV A;  3CBM A;  4MZP A;  5F5Z A;  1PKT A;  2YW5 A;  1KC8 R;  4FM4 B;  4A9K A;  5D3N A;  2EVR A;  2JTE A;  4ZN3 A;  2MK5 A;  1OV3 A;  1YIT T;  1VQM Q;  1J3T A;  4F7U B;  3AQA A;  4NUD A;  5HCL A;  4OMO A;  2DTI A;  1IO6 A;  4MR3 A;  5D6Y A;  1VQ4 Q;  2X35 A;  2DYB A;  4V2S A;  2OTL A;  2HCK A;  1VQP T;  3LGL A;  4JJD A;  4XUB A;  1RAD B;  2N9G A;  5EPS A;  1ZA2 B;  3PE0 A;  5F36 A;  1T0H A;  5FRO A;  4M7A A;  3CCS Q;  4M7D A;  2LRQ A;  3CCM Q;  4Y03 A;  4BW1 A;  1MGQ A;  2EJN A;  4HCZ A;  4ZNX A;  2HEQ A;  3MP8 A;  4J83 A;  3EFO A;  4J6Y A;  2L3Q A;  3LLR A;  5CRM A;  5FU7 B;  4M78 G;  1UEB A;  3MHX A;  1VQ6 A;  1QCO A;  5DBM A;  2YSQ A;  5L96 A;  3CMA T;  1BYM A;  2K3B A;  4QUT A;  3VRZ A;  5IG6 A;  3CCM A;  3LQI A;  2DIQ A;  1WNL A;  1P92 A;  5IHN A;  4KV1 A;  1WZO A;  1N8R U;  4EDU A;  5AMF A;  5AT1 B;  3MEV A;  2DVV A;  3RNJ A;  1ZBJ A;  1T3S A;  5CQT A;  5KYY A;  5I1Q A;  1BKB A;  4KRT A;  1WIE A;  3HTR A;  1VQL T;  1Q81 R;  1M5Q 1;  4M77 C;  4WIV A;  1BCM A;  1SSH A;  4QEW A;  2QTV A;  3LW5 E;  3JCM c;  2YWW A;  5CP5 A;  3CCU Q;  1TXQ A;  5IN1 A;  5I83 A;  5ETB A;  2O4X B;  1VQN T;  2CT4 A;  3SEM A;  4EMG A;  3MUK A;  3OBY A;  1PSE A;  4RVR A;  4C8Q B;  2O88 A;  5EPR A;  4FYY B;  4YY6 A;  3IU5 A;  4AKG A;  2LX7 A;  4DOV A;  2RQU A;  1PWT A;  3REA B;  2DVQ A;  5EWW A;  4KGV B;  2RHU A;  5DYA A;  5IHI A;  1YHQ T;  1LJO A;  3U5N A;  5GAN g;  1X6B A;  1WUM A;  5C7N A;  1W2B S;  2LCC A;  1SRM A;  1VQ7 T;  5CQ7 A;  2Y4X A;  3I35 A;  3FC3 A;  2KYM A;  1X2Q A;  5IID A;  2E5Q A;  2KY9 A;  5I88 A;  5C4Q A;  3I3J A;  2ZCF B;  1N27 A;  3JCM W;  5ENG A;  4C8Q C;  4JRP A;  4NRA A;  2EQJ A;  1NG2 A;  1I8F A;  3CME Q;  4QSS A;  1VQ5 Q;  2LZ6 B;  4JJC A;  1N8R R;  1QCN A;  1UDL A;  2L0A A;  1IRX A;  2GFU A;  5DLO A;  3MUL A;  1AZE A;  5KYU A;  4PTB A;  4BW3 A;  2AZV A;  4PJO F;  5HKC A;  2LQN A;  2P0K A;  5FWC A;  3WXM B;  4FW2 A;  3DLM A;  5LJ3 d;  2YQD A;  2WP1 A;  5DM7 R;  2G6F X;  2K3Y A;  3MET A;  1Y57 A;  5H1V A;  2VUB A;  1BK2 A;  2YRD A;  5HEM A;  2LCL A;  2RJD A;  4QST A;  2RHI A;  4BW4 A;  3BW1 A;  1Y7X A;  3DAI A;  4KUI A;  2WSE E;  4A63 B;  3NHN A;  2HQE A;  5CUE A;  4PCI A;  1NEB A;  3MEU A;  4MEO A;  1RLP C;  4QC3 A;  1UFF A;  5I7X A;  5KYX A;  2L3S A;  5ENF A;  1RI0 A;  1EX4 A;  2YUP A;  3C4S A;  4D8D A;  4DBF A;  5CQ6 A;  5KE3 A;  3CCU T;  2LT1 A;  2CYZ B;  2GFA A;  3REB B;  3DB4 A;  4E6R A;  1YJW Q;  3S3N A;  2YEM A;  2EGA A;  2RQR A;  3EG0 A;  1WHJ A;  2EYY A;  4HA8 A;  5FRM A;  3H9N A;  1SHG A;  1KHC A;  3M0U A;  2HD0 A;  1YJ9 T;  5D3S A;  2O4X A;  3HFO A;  3HSB A;  2XMF A;  2JXB A;  4LYW A;  1Q86 C;  5CUD A;  3SFM A;  5I2S A;  3QJ6 A;  3O37 A;  3G6E T;  5DFC A;  2DEU A;  4M7D D;  4YBT A;  3H0H A;  3JSC A;  3AHU A;  4PFP A;  4LR6 A;  3G7Z A;  4LUD A;  5II2 A;  5ENE A;  5E9Y A;  1V29 B;  4IUV A;  1AWX A;  3OYD A;  4ATO A;  3JCM f;  5LUU A;  2L5E A;  5FE4 A;  2RS9 B;  2K5F A;  5EIS A;  1I5O B;  5FDZ A;  4OB1 B;  1Q7Y U;  1VQ9 Q;  3OS1 A;  4QYL A;  3I5R A;  1S72 Q;  5DFD A;  1PC0 A;  2G3R A;  4DBH A;  3H8Z A;  2K6D A;  3SD4 A;  4BDZ A;  1W2B P;  2QQA A;  4M75 B;  2D0Q B;  5KCH A;  3CC4 A;  4JZ3 A;  3L2U A;  5CVI A;  4NR6 A;  5FE9 A;  2K79 A;  1M1G A;  5A7C A;  5GAN d;  4QBM A;  5H1U A;  3MP1 A;  1VQ9 A;  3M4G A;  3TSW A;  3QO3 A;  2R5M A;  4JRK A;  4YBS A;  1VYT A;  2VB6 A;  1R8O B;  4M7D F;  2F1L A;  4CUU A;  1UUE A;  4M77 G;  3URG A;  5AYF A;  5IXB A;  2EW3 A;  4XTY A;  1KQS A;  4MEN A;  1CKB A;  2WSF E;  2HBP A;  2XHC A;  4E96 A;  3BDL A;  3NTI A;  2KRO A;  5D3J A;  3EG2 A;  3D7S B;  2MWP A;  1ZUK A;  4PLI A;  1TS9 A;  1E6H A;  4C0D C;  3GBQ A;  3HL8 A;  1D09 B;  1W2B A;  2VV5 A;  2MYS A;  3RR6 A;  5L99 A;  1VQK A;  4M7D B;  2HKQ B;  3VS2 A;  3AAD A;  3QDR B;  1NPR A;  2WP2 A;  5CQ4 A;  4FSS A;  4XU1 A;  5HK0 A;  2VGM A;  1X27 A;  2L89 A;  3JRZ A;  4FIB A;  5FFY A;  2DKW A;  4WHW A;  2DO3 A;  4L5G A;  3TSZ A;  5D7U A;  2HQH A;  5A85 A;  2QA4 Q;  3MP6 A;  4OML A;  1KC8 U;  2A28 A;  2DL4 A;  5E73 A;  4J9C A;  4PKL A;  3I56 A;  1RI9 A;  1KIK A;  4PJN A;  3U5L A;  2PVO B;  1KK7 A;  3BDU A;  3LQJ A;  2I2L A;  3CCJ T;  4YYG A;  1QP2 A;  5HLS A;  4Z1S A;  2JJ9 A;  2M02 A;  1M4Z A;  2ROT A;  2O2O A;  2EAY A;  5CQ8 A;  2H3J A;  1QKW A;  5GAM j;  2AZS A;  1SF9 A;  1ZHI A;  1UGS B;  4AI6 A;  5GAN j;  2D9T A;  4MEP A;  1YJN T;  5JWM A;  4AFZ C;  2BIV A;  2QTX A;  2D8H A;  2EJF A;  4JDS A;  4M75 A;  1N8R C;  3HHT B;  2RPN A;  2IIM A;  5J0D A;  3QDF A;  2YLC A;  3CPF A;  4UC4 A;  2E3I A;  5LJ3 f;  2EJ9 A;  1VQ4 T;  2C0I A;  2P4T A;  3QPH A;  2I7K A;  3EG9 A;  2EQI A;  3K2J A;  2DYI A;  5E9I A;  5F2P A;  1QVF P;  2MWO A;  3RDV A;  4L6V 5;  4OB3 B;  4BJX A;  4PJM A;  4LDX A;  5L23 A;  3MPU B;  3CC2 A;  3JCM d;  1OOT A;  3O36 A;  4PL6 A;  1YHQ A;  2GQI A;  2KRN A;  5DLQ E;  4AKH A;  1RLQ C;  1X6G A;  4BE2 A;  5GAM g;  1KG1 A;  4NRC A;  5KHM A;  3UVY A;  3G1J A;  4QVC A;  3M59 A;  5K29 A;  1Q81 C;  2DL5 A;  3CCQ A;  2FPE A;  5CCA A;  3WVD B;  2IG0 A;  3X25 B;  4QR3 A;  5CZG A;  4IUQ A;  2RJF A;  3V7C A;  9ATC B;  2HSP A;  4LDV A;  1TG0 A;  2QEX T;  2NXB A;  1QKX A;  3MEW A;  1KD1 C;  5FE5 A;  2DXU A;  5II1 A;  4NQN A;  3OW2 P;  2RF0 A;  2HKN A;  2DBK A;  1QWE A;  5EQ1 A;  2CS7 A;  4RTX A;  2ZPB B;  2QYZ A;  5CUA A;  3PT9 A;  1R0B G;  1ZSZ B;  5CS8 A;  4X1V A;  4TQN A;  2CP3 A;  3C94 A;  1Q86 U;  3O8V A;  2DA9 A;  2KQW A;  1KD1 R;  3QSU A;  3EG3 A;  1H8K A;  4XU2 A;  1PRM C;  4Z6I A;  3JCM h;  2CDT A;  4O7F A;  2JZ2 A;  5EIC A;  1CSK A;  2KVQ G;  2DIL A;  3OYM A;  3OY9 A;  4F7U E;  4OGC A;  4LNP A;  4M75 F;  4OUF A;  4QVZ A;  2M51 A;  2DBM A;  1GBR A;  1YIJ T;  2MIO A;  1UJ0 A;  2NUP A;  5FE1 A;  4J6X A;  4J8O A;  3U5P A;  3UW9 A;  4CUS A;  4PK4 A;  3UT1 A;  4N4I A;  3CMA A;  3FEO A;  3CD6 A;  1WXT A;  3M56 A;  2EWN A;  1G3T A;  2ED0 A;  4OVA A;  4FYX B;  4C5I A;  5L97 A;  1NLP C;  4HXN A;  2DXT A;  2CP6 A;  1BCO A;  2CZ0 B;  4HCK A;  5KCO A;  5FU6 C;  2DMO A;  7AT1 B;  1FXX A;  5GAO q;  4M78 F;  3CMA Q;  4M75 G;  1MMN A;  5I21 A;  1EFN A;  3UA6 A;  3MQM A;  2H8H A;  1T0J A;  2DPP B;  3T9N A;  4D6W A;  3PVQ A;  4JUV A;  5E3D A;  5FB0 A;  1M1F A;  4QSX A;  4LDF A;  3HRT A;  2RI2 A;  3SVF A;  4DEY A;  3CXC S;  3VUZ A;  1SG5 A;  4O77 A;  2A0F B;  2VVK A;  4A9O A;  1IGU A;  2Y4Y A;  5EG2 A;  5FE0 A;  5LJ3 h;  2EYZ A;  2PTK A;  4ME7 A;  1K4U S;  4WCI A;  4XTZ A;  2D9E A;  5C87 A;  4M7A B;  2FL7 A;  2EPD A;  2MCN A;  4XK8 E;  1ZS5 A;  5FG5 A;  2NLU A;  3UA7 A;  3UVD A;  5EC7 A;  2X4W A;  1KQS P;  4BW2 A;  4K11 A;  2QQR A;  3Q1J A;  1TWB A;  1ACM B;  5GAO l;  4C92 D;  2NUZ A;  1KQ2 A;  2J05 A;  1OI1 A;  1X43 A;  4M77 F;  3BE3 A;  4M78 D;  1WFW A;  2COY A;  4NL2 A;  5GMK e;  3NXB A;  2FVU A;  3A8O B;  1KFZ A;  1TOV A;  1AOJ A;  3PIO A;  1NE8 A;  2NUP B;  1RAE B;  2FB7 A;  4QQ6 A;  4JRQ A;  4BI4 A;  2LNV A;  2FZC B;  4QR4 A;  1K9M U;  4HBW A;  1UGR B;  1OYX A;  4LYS A;  2PVG B;  2DZC A;  3H6Z A;  1Z9Q A;  4HXR A;  1KC8 C;  2K9G A;  3TVT A;  2OTL T;  2KYB A;  1D1A A;  4CC7 A;  5CUB A;  2RMO A;  4X9C A;  4Z1Q A;  3X28 B;  2EQU A;  3Q2F A;  2E4H A;  3I55 T;  4UIW A;  4NYV A;  4X34 A;  2LQK A;  5DKH A;  2VGN A;  2X4Y A;  5HEL A;  5CGP A;  4LUE A;  4O72 A;  2JN0 A;  5LJ3 j;  2YUO A;  1MMA A;  3QZ9 B;  2QXF A;  2R58 A;  4QSU A;  5FU6 B;  2YUQ A;  1JO8 A;  1HJD A;  2RNX A;  3UDC A;  4F7U G;  4ZTF A;  3NGP A;  3QBY A;  4X9D A;  4AT1 B;  5CKD A;  1QVF S;  2RA2 A;  5KYU B;  4FYV B;  4A4H A;  1V1C A;  1WLP B;  2KSS A;  4HCC A;  2CH4 W;  4Z89 A;  4QNS A;  4TT2 A;  1W70 A;  5J3B A;  2F5T X;  1Y96 A;  5GAN 3;  4PS5 A;  3CXC A;  3OSV A;  2J6O A;  1I0C A;  1H3H A;  3H41 A;  1FWZ A;  1YI2 T;  4QSW A;  5LKT A;  4XTX A;  5EU1 A;  1WHL A;  3EG9 B;  2QI2 A;  2BTT A;  3PMI A;  3M58 A;  2DXC A;  1M3A A;  5GJW B;  6AT1 B;  3UV2 A;  3ERR A;  3VS6 A;  3PMT A;  1U3O A;  4J6W A;  4EPC A;  3CC4 Q;  1JRI A;  1B34 A;  4RG2 A;  4PJJ A;  2BUD A;  3BY7 A;  5FU7 C;  3HRU A;  5A0G A;  3QZS A;  1ZBX A;  5FH6 A;  3QZT A;  2OAW A;  2BZX A;  3QXE B;  4M77 B;  3PVL A;  3SVG A;  1TUD A;  2LX9 A;  3X26 B;  3G4S A;  1UG1 A;  5IGK A;  3LXJ A;  5GAN 2;  2OUO A;  1QMC A;  4RKU E;  4A4E A;  5CAI A;  2XKO C;  5GAN 4;  3JB9 I;  2B86 A;  3TQ7 P;  2VXE A;  2DD5 A;  3JCM b;  5GAN 7;  4AKI A;  3F70 A;  5HRW A;  5DFB A;  5TB6 A;  3S3M A;  5HK3 A;  1PD1 A;  4A4F A;  2ZPH B;  4NXJ A;  1XTD A;  1K8A U;  3VV0 A;  4ZTJ A;  4NR7 A;  1SEM A;  5GMK h;  1KSW A;  5LKX A;  4J7F A;  1E6I A;  1GCQ C;  4J1P A;  2X9H A;  2DVR A;  2EQM A;  4ESR A;  4J9B A;  2EYQ A;  4YBM A;  4GLK A;  4KUL A;  2QEX Q;  3JB9 D;  3GNG A;  5I2M A;  1RAG B;  2JW4 A;  1W4S A;  5E3G A;  4BI3 A;  2KT8 A;  4DEX A;  1QVF A;  2P4R A;  2PZ1 A;  2YDL A;  2RB6 A;  4C0F A;  1WJQ A;  4NUC A;  2VAS A;  4HKE A;  3SB2 A;  3EGD B;  4Y92 A;  1OPL A;  3CC7 Q;  3VUB A;  2QEX A;  5ENI A;  1K8A C;  5M9O A;  4Y28 E;  1X69 A;  4MMK A;  4ZN1 A;  4HXM A;  4Z6H A;  5LVR A;  2JVV A;  4MDW A;  2YRC A;  4B6M A;  2DRM A;  2DEQ A;  2O01 E;  2CH4 A;  3CXC P;  5DYC A;  4KH0 B;  1JM4 B;  4HBY A;  1GFC A;  4PJL A;  4C92 F;  5DYU A;  1VQO T;  4BY6 B;  1X0J A;  3CQT A;  4B9W A;  2F6N A;  5C89 A;  4M77 D;  1QCF A;  4XAX B;  2SRC A;  4NS5 A;  2V8J A;  4C66 A;  5LJ5 g;  4QUU A;  3OYY A;  1Q86 R;  2Y90 A;  3OYK A;  2HZY A;  5GAO p;  2QQ9 A;  3QYG B;  3OYN A;  2FO0 A;  4AKN A;  1Q82 R;  2WSC E;  4M7D E;  3CCR A;  2L84 A;  5J26 A;  3ZFJ A;  3O33 A;  3P1C A;  4HXJ A;  5F3A A;  2YLB A;  5ENH A;  1K73 U;  1MMD A;  2LQ8 A;  3OA6 A;  5HRV A;  2LCS A;  3E9F A;  4IKF A;  1X75 C;  2KRM A;  2DL8 A; 
#chains in the Genus database with same CATH homology
 1BI2 A;  4A9I A;  3OBW A;  2E12 A;  5A2Q E;  2L5Q A;  2XDP A;  5HJC A;  1EQF A;  5F1L A;  4E7H A;  5KTW A;  5FE3 A;  1VQ4 A;  5GAO r;  4FSX A;  2VXF A;  2ZPG B;  5FE7 A;  4UYG A;  5CU8 A;  5FRN A;  3G71 T;  3FDR A;  1UGP B;  2DD4 A;  3DWY A;  1QVP A;  2OAU A;  3UPU A;  4XTV A;  5CRZ A;  3RES A;  2OSS A;  2VC8 A;  4UYF A;  4C92 A;  4B9X A;  2E7N A;  4O5V A;  5D0C A;  1BI3 A;  4PJO A;  1G3S A;  1K73 C;  5ENJ A;  2MJV B;  4UIX A;  2E10 A;  1AHJ B;  5D24 A;  5EWD A;  3RMQ A;  2QQS A;  2RD1 A;  3O34 A;  4TVR A;  2L85 A;  1MHN A;  1N9S A;  1VQ7 A;  3FB9 A;  5EGU A;  5FLX E;  3M5A A;  5F1H A;  3PTA A;  2JTM A;  2QQB A;  1JB0 E;  1M1K U;  3MXF A;  4O7E A;  2OTJ A;  4WF2 A;  3X20 B;  3CCL T;  5CUC A;  5KO4 A;  4YAT A;  4O7A A;  2XG8 D;  2KAF A;  4YC9 A;  4F3I A;  4RCC A;  4BD3 A;  4QR5 A;  1Q82 C;  3I56 T;  5DLX A;  5GAN h;  4TZ2 A;  1VQK T;  4M7D C;  5DW1 A;  4FU6 A;  4LC2 A;  3A8G B;  4A9E A;  4PJO C;  2E7O A;  4C8Q G;  4NUE A;  1UGQ B;  2OTJ T;  3EAE A;  3A8L B;  3JAM E;  2YDW A;  5GAN 5;  2XU8 A;  5C6S A;  4LZR A;  3L2V A;  2JNG A;  3E19 A;  4XQ3 A;  5A5O A;  3HFN A;  5CO7 A;  3OYB A;  4QSQ A;  4M7A G;  1Y07 A;  2E65 A;  4JLG A;  1VQ5 T;  3C95 A;  1YJ9 A;  1JBM A;  2CZ6 B;  3U5J A;  4NYX A;  2JOY A;  4DA4 A;  4CFK A;  4ZGD B;  2G4A A;  4LD9 K;  1KQS S;  3GIB A;  3JVK A;  5ACY A;  2PU9 B;  3MB4 A;  4J0S A;  1WPY A;  3CC4 T;  5GAM d;  4QSV A;  4XY9 A;  3RMS A;  2GRC A;  4LDW A;  3G71 A;  4BUG A;  2E1H A;  2RK2 A;  1VQ9 T;  5KH6 A;  3JVJ A;  4C8Q D;  4HBV A;  3KXT A;  3JCM e;  2KK4 A;  1VQM A;  3CCS A;  3JVM A;  2MAM A;  2E6Z A;  4YYM A;  4O78 A;  2RI7 A;  2R5A A;  4IUP A;  5CK9 A;  4O71 A;  3TEE A;  4YH3 A;  1U8R A;  3M57 A;  4EMK B;  3M53 A;  4JS4 A;  2E70 A;  5LJ3 e;  3V8L A;  4FT4 A;  5A0L A;  3FKM X;  5L8R E;  3QJY A;  1S72 T;  1QW1 A;  4PCE A;  2R0S A;  4E7I A;  4CUQ A;  4GY5 A;  5JI8 A;  2RO1 A;  4QSP A;  3RKY A;  1XNI A;  5FE8 A;  5CKE A;  4IOQ A;  3P1E A;  4O76 A;  2CZ7 B;  3OYG A;  5EV9 A;  4UIY A;  4YYH A;  2XD0 A;  4ALG A;  2DWW A;  3RKX A;  4IR6 A;  3ME9 A;  4N4H A;  3A8H B;  4M78 B;  1M8V A;  5KE2 A;  4QYD A;  4IR5 A;  4PKC C;  4LZ2 A;  4ZGJ B;  4LRG A;  3LYI A;  5EWV A;  3JCM X;  2EFI A;  4QZS A;  2RI3 A;  2JUF A;  1VQ5 A;  4M7D G;  5AD2 A;  2LC4 A;  3G0J A;  4PJO G;  5LJ5 f;  4LD6 A;  4N0A C;  4HBX A;  4C92 G;  2H60 A;  2PQW A;  3ASK A;  4E7L A;  2HQX A;  2IVW A;  1VQO A;  5GAO n;  5CQ5 A;  3OS5 A;  2RFJ A;  1YJN A;  4HT8 A;  3PFS A;  4ALH A;  5HQ6 A;  1IRE B;  2R10 A;  3CC7 T;  5LKZ A;  1M90 U;  2WAC A;  1N72 A;  5LJ3 g;  5GMK i;  5D3P A;  3SWN B;  5CTL A;  3OQ5 A;  3D7C A;  5LJ5 e;  4PLL A;  5FG4 A;  4XTW A;  3SWN A;  1Y96 B;  5H1T A;  3J7A F;  3MEA A;  1BIB A;  4Z93 A;  4A4K A;  4EMK C;  2B8A A;  5I80 A;  3HME A;  1U1T A;  4HT9 A;  2RHY A;  4YTL A;  1NZ9 A;  5FB1 A;  1JSP B;  4FT2 A;  2R57 A;  5D3L A;  3OSS C;  2RH2 A;  3UVX A;  4C5H A;  4QVD A;  1F68 A;  2KTB B;  4F7U A;  3JCM Q;  3QYH B;  3PNW C;  3RUX A;  3OW2 S;  5HY6 A;  5GAN 8;  1KHI A;  4XYA A;  1S72 A;  3ER0 A;  3UVW A;  1VQ8 T;  2MF2 A;  5BT5 A;  3ZYU A;  4M78 C;  3OYE A;  4XUA A;  3LH0 A;  3JB9 J;  2V8K A;  5GAN f;  3HRS A;  3NTK A;  4OGJ A;  2XIC A;  5EP7 A;  1LOJ A;  3CCJ A;  5GAM f;  5FG6 A;  2K57 A;  5LL6 S;  2K3X A;  4L59 A;  4O74 A;  4QC1 A;  3LX7 A;  3EFS A;  3QZ5 B;  4TZ8 A;  1VQ6 T;  4TTE A;  1QVG S;  3U5K A;  2EJG A;  2A3L A;  4O7C A;  1WJS A;  4BHW A;  2RO0 A;  3OYL A;  1YI2 A;  4PNO A;  1NPP A;  3CEY A;  4LYI A;  1BIA A;  5LJ5 j;  4BE0 A;  2KDS A;  4C92 E;  2DJZ A;  3J80 E;  2L3R A;  2XID A;  2I8N A;  5C85 A;  5DKD A;  2CGH A;  2E6N A;  3UV5 A;  5IGN A;  2PVD B;  1G3Y A;  3HP9 A;  4Z02 A;  1VUB A;  4C8Q A;  4IUT A;  2YEK A;  3G4S T;  4C92 C;  5EA1 A;  5LJ1 A;  2D6F A;  2M0O A;  5HFR A;  4JJN K;  5EVA A;  3X24 B;  4CI0 C;  4O70 A;  3FRN A;  3OYJ A;  4OGI A;  4Q0O A;  5ENB A;  4QSR A;  5A5P A;  2DZ9 A;  4M77 E;  1WUG A;  4KUD K;  5KTX A;  3PIP A;  4KT0 E;  4CUT A;  3WVE B;  4ZW1 A;  3RCW A;  1JJ2 S;  1QP3 A;  4NR8 A;  2ZPE B;  5L98 A;  2YHT A;  2RM4 A;  5I40 A;  4MEQ A;  4A4G A;  4MZM A;  2DIG A;  2XI9 A;  4M75 C;  5GAN e;  4XU3 A;  4BDY A;  3JCM P;  3JB9 G;  1Q82 U;  4A9M A;  2K5I A;  4C8Q F;  2FYK A;  4MR6 A;  5I29 A;  3A8M B;  5EWH A;  3KUF A;  3S91 A;  4N3W A;  4E47 A;  4UYE A;  4OMF B;  5DY7 A;  2RJE A;  2QA4 T;  4YAB A;  3JCM g;  2D82 A;  3QII A;  5CY9 A;  4M78 E;  5HQ7 A;  5DYX A;  4DQ2 A;  2C06 A;  3LWI A;  4CL9 A;  1WJR A;  4QB3 A;  3MB3 A;  4A9L A;  1X01 A;  1RL2 A;  3OS2 A;  4QEV A;  2ZGW A;  5CIU A;  4TYL A;  3OMG A;  5AD3 A;  4A53 A;  2RNY A;  2V8I A;  4O75 A;  2XDD A;  1G3W A;  4NQM A;  5LJ0 A;  2RK1 A;  4EMH A;  5A0D A;  4HCB A;  5CQX A;  5CPE A;  1M9S A;  3VJP A;  3EFR A;  2DKG A;  1VQL A;  4OB0 B;  1H64 1;  5GAM e;  4F7U F;  4WHU A;  3G6E A;  4YAD A;  4LZS A;  3VKI A;  4BB7 A;  5C0M A;  1KQ1 A;  1N6A A;  3JB9 F;  4YH4 A;  3A5Z B;  2E41 A;  4BI8 B;  4YY4 A;  4M7A F;  3M55 A;  2DTO A;  4HXS A;  5HEN A;  4C5E A;  1NJI C;  4UYF B;  3HKS A;  5F63 A;  2KMT A;  4YYK A;  2K5L A;  4C0Z A;  3CCR T;  4IOO A;  5E7D A;  2YYN A;  5DW2 A;  4KCX A;  5IGM A;  4X2I A;  5CQ3 A;  5COI A;  4UIZ A;  3L2W A;  5EWC A;  3P1F A;  5DY9 A;  5I7Y A;  4II1 A;  3U5M A;  3P8H A;  2OO1 A;  1VQN A;  5GMK m;  4PY6 A;  3CBO A;  5E74 A;  4NR4 A;  2JTF A;  3L2Z A;  2CZ1 B;  1VIE A;  2LSP B;  4LDU A;  4C67 A;  5DLZ A;  3CCQ T;  2CKK A;  2E3K A;  1LNX A;  4FLP A;  4TS8 A;  4QEU A;  5DKC A;  5E9M A;  2PUO B;  4DON A;  5FH8 A;  5BT4 A;  3J81 E;  1QVG A;  4N4F A;  5FFV A;  1I81 A;  4KV4 A;  2FSA A;  3P8D A;  3E9G A;  3L1A A;  5G4S A;  5J39 A;  5HRX A;  2QDY B;  1VQP A;  1YJW A;  4BY6 C;  1BI1 A;  2FHD A;  2RHX A;  5A5Q A;  4YYI A;  4ELY C;  2R0Y A;  4YAX A;  5LKU A;  5KU3 A;  1K9M C;  3GG3 A;  1U1S A;  5A5N A;  5LJ5 d;  5A5S A;  2GCX A;  4Y91 A;  1OZ3 A;  3GP8 A;  4TT6 A;  3OB9 A;  3QKJ A;  3V8J A;  2P0Q A;  5F61 A;  3CCM T;  3M54 A;  2K2V A;  3VYG A;  2EIF A;  4UYD A;  3DLL A;  5C8G A;  3QHS A;  3KBG A;  5CKF A;  3JCM V;  4VUB A;  3RKW A;  4M75 E;  3VYH B;  3FIF A;  1WQW A;  4A54 A;  1M90 C;  2PUK B;  4OB2 B;  3GNF B;  5E9V A;  1B34 B;  3IU6 A;  4XTU A;  3O35 A;  1NJI U;  4NRB A;  3OW2 A;  4CFL A;  3CC2 T;  5IGL A;  4YYN A;  4NR5 A;  4CLB A;  4HXO A;  3Q2E A;  1VQM T;  3HMF A;  3V7S A;  4NR9 A;  4M7A E;  2M16 A;  3NFC A;  5EPB A;  1M1K C;  2DK3 A;  5FE6 A;  2EKO A;  2XK0 A;  3G0L A;  2F5K A;  4DOW A;  5EM3 A;  5IBN A;  3GF5 A;  5A5R A;  3SDZ A;  3LQH A;  3DB3 A;  3U5O A;  5D6W A;  4UIT A;  2LDM A;  5A81 A;  4R55 A;  2E64 A;  3VU3 C;  1O9S A;  4TT4 A;  2YEL A;  4R56 A;  5G4R A;  3FJP A;  4C0D B;  5KTU A;  3CCS T;  3P5O A;  4RG8 A;  4J5Y A;  4TU4 A;  3TLP A;  4IUU A;  3PGG A;  2QA4 A;  4JS5 A;  4YYJ A;  1HXD A;  2X4J A;  2RHZ A;  3BFM A;  4M75 D;  4IUR A;  3CCU A;  4Q0N A;  2RJC A;  3RER A;  1WQ7 A;  4M7A C;  3QG1 A;  3CBP A;  4A9J A;  5GAM h;  1D3B B;  1YJW T;  2LTO A;  2R0V A;  1D3B A;  5GMK l;  4QQD A;  4ZC9 A;  4OP0 A;  1KD1 U;  2LVM A;  4MZT A;  5LJ5 h;  4C8Q E;  5LVQ A;  5GMK j;  5D3R A;  4MR4 A;  3TCJ A;  5L8T A;  3LGF A;  5I86 A;  4J0R A;  3M4Y A;  1I5L A;  1DJ7 B;  3S6W A;  1Q81 U;  3OYA A;  3TRE A;  4PJO B;  4IR4 A;  3CME A;  3OYC A;  5F25 A;  4N4G A;  1YIJ A;  1EIF A;  3FLG A;  3INZ A;  4PJO D;  3P1D A;  3OMC A;  1IZ6 A;  1WGS A;  4RCB A;  4M7A D;  4Q5W A;  4M77 A;  5D25 A;  5F60 A;  4OGE A;  4RMO A;  2BKD N;  3CD6 T;  4IR3 A;  3TU4 K;  5EI4 A;  3MO8 A;  3CC7 A;  3CME T;  4LDY A;  5HQ5 A;  2DTH A;  4BE1 A;  5D6X A;  3V7R A;  2DAT A;  4A9N A;  5CQY A;  4IOR A;  5HFQ A;  4E7K A;  2F6J A;  4ELZ C;  3HPW A;  3CCE A;  2EQK A;  5A83 A;  5TCM A;  4MR5 A;  3V8K A;  4PJO E;  3L2Q A;  3GOX A;  2VYT A;  2HAX A;  2MI6 A;  3QZV A;  3OS0 A;  3RIR A;  4M78 A;  3UWN A;  3SWN C;  3SVH A;  1VIF A;  5F62 A;  1YCY A;  1VQ8 A;  2M1H A;  5GAN 6;  1BI0 A;  4OF1 A;  3CCL A;  4ZQL A;  4J7I A;  5D26 A;  4UIU A;  1H3Z A;  3L42 A;  4MDX A;  3LWH A;  2L8D A;  3GPL A;  2M9U A;  2RNW A;  5DX4 A;  3DKM A;  2ZPF B;  3JB9 H;  1HK9 A;  4JRI A;  2AHJ B;  5IT9 E;  4CUP A;  2GF7 A;  4EMK A;  1FX7 A;  4MML A;  1N9R A;  1ZQ1 A;  5A82 A;  3S3O A;  4QY4 A;  3ONI A;  2DXB A;  4O6J A;  5D3T A;  3I55 A;  5LJ2 A;  3N5B B;  4KBM B;  3OYF A;  1XOV A;  3R6O A;  4XY8 A;  2X4X A;  1PSF A;  3OYH A;  2DVE A;  1TH7 A;  1YBY A;  1JJ2 A;  4BAC A;  2RI5 A;  5FFW A;  4NL3 A;  3L2R A;  2DVS A;  2MMP A;  3CPW A;  2K4Y A;  4FL6 A;  4QW2 A;  5BT3 A;  5GAO m;  3JVL A;  3OYI A;  2A7Y A;  3HMH A;  2P0P A;  3P8B B;  4O7B A;  5I89 A;  4TU6 A;  5FH7 A;  4N0A A;  4C0G A;  2GQV A;  4NOY A;  5L8U A;  4UYH A;  5CFW A;  1SSF A;  4ZGE B;  2HNI A;  4HXK A;  3CCV T;  4HXL A;  4C92 B;  4A9H A;  5CKB A;  5FBX A;  3UV4 A;  5H85 A;  1I4K 1;  1Q7Y C;  2YRV A;  3C12 A;  4QQG A;  1XQH A;  3E1S A;  5EK9 A;  4P5N A;  2LT4 A;  3ZBD A;  3ZEH A;  4A9F A;  3CPW S;  3CCE T;  5IAY A;  5AME A;  3GLX A;  4XU0 A;  3CCV A;  2XDB A;  4CUR A;  5HM0 A;  4CRI A;  5FE2 A;  4GPJ A;  4J3I A;  4JLI A;  3M9Q A;  5E9K A;  5ENC A;  4E7J A;  4NYW A;  5E0R A;  1Y71 A;  1GXI E;  4HXP A;  5CUG A;  3JCM J;  5D3H A;  4C5G A;  1OZ2 A;  4YK0 A;  5ETD A;  5E9L A;  5D7X A;  3LJW A;  1YIT A;  2F69 A;  3MCA B;  1G5V A;  2DAQ A;  3QUI A;  4YYD A;  5CKH A;  1X6O A;  1UB4 A;  5CR2 A;  5CQA A;  3NTH A;  3S92 A;  2ZPI B;  1O75 A;  2ZZD A;  4UIV A;  3CBM A;  4MZP A;  5F5Z A;  2YW5 A;  4FM4 B;  4A9K A;  5D3N A;  4ZN3 A;  1YIT T;  4F7U B;  3AQA A;  4NUD A;  5HCL A;  2DTI A;  4MR3 A;  5D6Y A;  2X35 A;  4V2S A;  2OTL A;  1VQP T;  3LGL A;  4XUB A;  2N9G A;  5EPS A;  5F36 A;  5FRO A;  4M7A A;  4M7D A;  2LRQ A;  4Y03 A;  4BW1 A;  1MGQ A;  4HCZ A;  3MP8 A;  4J83 A;  4J6Y A;  3LLR A;  5CRM A;  5FU7 B;  4M78 G;  1UEB A;  3MHX A;  1VQ6 A;  5DBM A;  1BYM A;  5L96 A;  3CMA T;  4QUT A;  5IG6 A;  3CCM A;  3LQI A;  2DIQ A;  1WNL A;  1P92 A;  4KV1 A;  1N8R U;  4EDU A;  5AMF A;  3MEV A;  2DVV A;  5CQT A;  5I1Q A;  1BKB A;  1VQL T;  1M5Q 1;  4M77 C;  4WIV A;  4QEW A;  3LW5 E;  3JCM c;  5CP5 A;  5IN1 A;  5I83 A;  5ETB A;  2O4X B;  1VQN T;  4EMG A;  3MUK A;  3OBY A;  1PSE A;  4RVR A;  4C8Q B;  5EPR A;  4YY6 A;  3IU5 A;  4DOV A;  2DVQ A;  5EWW A;  2RHU A;  5DYA A;  1YHQ T;  1LJO A;  3U5N A;  5GAN g;  1WUM A;  5C7N A;  1W2B S;  2LCC A;  1VQ7 T;  5CQ7 A;  2Y4X A;  3FC3 A;  5IID A;  2E5Q A;  2KY9 A;  5I88 A;  5C4Q A;  3I3J A;  2ZCF B;  1N27 A;  3JCM W;  5ENG A;  4C8Q C;  4JRP A;  4NRA A;  2EQJ A;  1I8F A;  4QSS A;  2GFU A;  5DLO A;  3MUL A;  4PTB A;  4BW3 A;  4PJO F;  5HKC A;  2P0K A;  3WXM B;  3DLM A;  5LJ3 d;  2YQD A;  2WP1 A;  5DM7 R;  2K3Y A;  3MET A;  5H1V A;  2VUB A;  5HEM A;  2LCL A;  2RJD A;  4QST A;  2RHI A;  4BW4 A;  3BW1 A;  1Y7X A;  3DAI A;  4KUI A;  2WSE E;  2HQE A;  5CUE A;  4PCI A;  3MEU A;  4MEO A;  4QC3 A;  5I7X A;  5ENF A;  1RI0 A;  3C4S A;  5CQ6 A;  5KE3 A;  3CCU T;  2LT1 A;  2CYZ B;  2GFA A;  3DB4 A;  3S3N A;  2YEM A;  4HA8 A;  5FRM A;  1KHC A;  1YJ9 T;  2HD0 A;  5D3S A;  2O4X A;  3HFO A;  3HSB A;  4LYW A;  1Q86 C;  5CUD A;  3SFM A;  5I2S A;  3QJ6 A;  3O37 A;  3G6E T;  5DFC A;  4M7D D;  4YBT A;  3AHU A;  3JSC A;  4LR6 A;  3G7Z A;  5II2 A;  5ENE A;  5E9Y A;  1V29 B;  4IUV A;  3OYD A;  4ATO A;  3JCM f;  5LUU A;  2L5E A;  5FE4 A;  2RS9 B;  2K5F A;  5EIS A;  5FDZ A;  4OB1 B;  1Q7Y U;  3OS1 A;  4QYL A;  5DFD A;  2G3R A;  3H8Z A;  3SD4 A;  4BDZ A;  2QQA A;  4M75 B;  2D0Q B;  5KCH A;  3CC4 A;  3L2U A;  5CVI A;  4NR6 A;  5FE9 A;  1M1G A;  5A7C A;  5GAN d;  4QBM A;  5H1U A;  3MP1 A;  1VQ9 A;  3M4G A;  3QO3 A;  2R5M A;  4JRK A;  4YBS A;  1R8O B;  4M7D F;  4M77 G;  4CUU A;  3URG A;  5AYF A;  4XTY A;  1KQS A;  4MEN A;  2WSF E;  2HBP A;  2XHC A;  4E96 A;  3BDL A;  3NTI A;  5D3J A;  2MWP A;  4PLI A;  4C0D C;  3HL8 A;  1W2B A;  2VV5 A;  5L99 A;  1VQK A;  4M7D B;  3AAD A;  3QDR B;  1NPR A;  2WP2 A;  5CQ4 A;  4XU1 A;  5HK0 A;  2VGM A;  3JRZ A;  2L89 A;  4L5G A;  4FIB A;  5FFY A;  2DKW A;  4WHW A;  2DO3 A;  5A85 A;  3MP6 A;  1KC8 U;  5E73 A;  4PKL A;  3I56 A;  3U5L A;  2PVO B;  3BDU A;  3LQJ A;  2I2L A;  3CCJ T;  4YYG A;  1QP2 A;  5HLS A;  4Z1S A;  1M4Z A;  2EAY A;  5CQ8 A;  2H3J A;  5GAM j;  1ZHI A;  1UGS B;  5GAN j;  2D9T A;  4MEP A;  1YJN T;  5JWM A;  2BIV A;  2QTX A;  2EJF A;  4JDS A;  4M75 A;  1N8R C;  3HHT B;  5J0D A;  2YLC A;  3CPF A;  4UC4 A;  5LJ3 f;  2EJ9 A;  1VQ4 T;  2P4T A;  3QPH A;  2I7K A;  3K2J A;  5E9I A;  5F2P A;  2MWO A;  4L6V 5;  4OB3 B;  4BJX A;  4LDX A;  3CC2 A;  3JCM d;  3O36 A;  4PL6 A;  1YHQ A;  5DLQ E;  4BE2 A;  5GAM g;  1KG1 A;  4NRC A;  5KHM A;  3UVY A;  4QVC A;  3M59 A;  5K29 A;  1Q81 C;  3CCQ A;  5CCA A;  3WVD B;  2IG0 A;  3X25 B;  4QR3 A;  5CZG A;  4IUQ A;  2RJF A;  3V7C A;  4LDV A;  2QEX T;  2NXB A;  3MEW A;  1KD1 C;  5FE5 A;  2DXU A;  5II1 A;  4NQN A;  2CS7 A;  5EQ1 A;  2ZPB B;  5CUA A;  3PT9 A;  5CS8 A;  4TQN A;  3C94 A;  1Q86 U;  3O8V A;  2KQW A;  3QSU A;  4XU2 A;  4Z6I A;  3JCM h;  4O7F A;  2JZ2 A;  5EIC A;  2KVQ G;  3OYM A;  3OY9 A;  4F7U E;  4OGC A;  4M75 F;  4OUF A;  4QVZ A;  1YIJ T;  5FE1 A;  4J6X A;  4J8O A;  3U5P A;  3UW9 A;  4CUS A;  3UT1 A;  4N4I A;  3CMA A;  3FEO A;  3CD6 A;  3M56 A;  2EWN A;  1G3T A;  4OVA A;  4C5I A;  5L97 A;  4HXN A;  2DXT A;  2CZ0 B;  5KCO A;  5FU6 C;  1FXX A;  5GAO q;  4M78 F;  4M75 G;  5I21 A;  3MQM A;  2DPP B;  3T9N A;  4D6W A;  4JUV A;  5E3D A;  5FB0 A;  1M1F A;  4QSX A;  4LDF A;  3HRT A;  2RI2 A;  3SVF A;  3CXC S;  3VUZ A;  4O77 A;  4A9O A;  2Y4Y A;  5EG2 A;  5FE0 A;  5LJ3 h;  4ME7 A;  4XTZ A;  4M7A B;  2D9E A;  5C87 A;  2FL7 A;  4XK8 E;  1ZS5 A;  5FG5 A;  2NLU A;  3UVD A;  2X4W A;  4BW2 A;  2QQR A;  3Q1J A;  5GAO l;  4C92 D;  1KQ2 A;  1OI1 A;  4M77 F;  4M78 D;  4NL2 A;  5GMK e;  3NXB A;  2FVU A;  3A8O B;  3PIO A;  1NE8 A;  4JRQ A;  2FB7 A;  4QQ6 A;  4BI4 A;  2LNV A;  4QR4 A;  1K9M U;  4HBW A;  1UGR B;  1OYX A;  4LYS A;  2DZC A;  2PVG B;  3H6Z A;  4HXR A;  1KC8 C;  2OTL T;  5CUB A;  4X9C A;  4Z1Q A;  3X28 B;  2EQU A;  3Q2F A;  3I55 T;  4UIW A;  4NYV A;  4X34 A;  2LQK A;  5DKH A;  2VGN A;  2X4Y A;  5HEL A;  5CGP A;  4O72 A;  2JN0 A;  5LJ3 j;  3QZ9 B;  2QXF A;  2R58 A;  4QSU A;  5FU6 B;  2RNX A;  3UDC A;  4F7U G;  4ZTF A;  4X9D A;  3QBY A;  5CKD A;  1QVF S;  2RA2 A;  4A4H A;  2KSS A;  4HCC A;  4QNS A;  4TT2 A;  5J3B A;  2F5T X;  1Y96 A;  5GAN 3;  4PS5 A;  3CXC A;  3OSV A;  1FWZ A;  1YI2 T;  4QSW A;  5LKT A;  4XTX A;  5EU1 A;  2QI2 A;  3PMI A;  3M58 A;  2DXC A;  3UV2 A;  3PMT A;  4J6W A;  4EPC A;  1JRI A;  1B34 A;  4RG2 A;  2BUD A;  3BY7 A;  5FU7 C;  3HRU A;  5A0G A;  3QZS A;  1ZBX A;  5FH6 A;  3QZT A;  3QXE B;  4M77 B;  3SVG A;  2LX9 A;  3X26 B;  3G4S A;  5IGK A;  3LXJ A;  5GAN 2;  2OUO A;  4RKU E;  4A4E A;  5CAI A;  2XKO C;  5GAN 4;  3JB9 I;  2VXE A;  2DD5 A;  3JCM b;  5GAN 7;  3F70 A;  5HRW A;  5DFB A;  5TB6 A;  3S3M A;  5HK3 A;  4A4F A;  2ZPH B;  4NXJ A;  1XTD A;  1K8A U;  3VV0 A;  4ZTJ A;  4NR7 A;  5GMK h;  5LKX A;  4J7F A;  1E6I A;  4J1P A;  2DVR A;  2EQM A;  2EYQ A;  4YBM A;  4GLK A;  4KUL A;  3JB9 D;  3GNG A;  5I2M A;  1W4S A;  5E3G A;  4BI3 A;  1QVF A;  2RB6 A;  4C0F A;  1WJQ A;  4NUC A;  4HKE A;  3SB2 A;  3VUB A;  2QEX A;  5ENI A;  1K8A C;  5M9O A;  4Y28 E;  4MMK A;  4ZN1 A;  4HXM A;  4Z6H A;  5LVR A;  2JVV A;  4MDW A;  2DEQ A;  2O01 E;  5DYC A;  1JM4 B;  4HBY A;  4C92 F;  5DYU A;  1VQO T;  4BY6 B;  1X0J A;  4B9W A;  2F6N A;  5C89 A;  4M77 D;  4XAX B;  4NS5 A;  2V8J A;  4C66 A;  5LJ5 g;  4QUU A;  3OYY A;  2Y90 A;  3OYK A;  5GAO p;  2QQ9 A;  3QYG B;  3OYN A;  4AKN A;  2WSC E;  4M7D E;  3CCR A;  2L84 A;  5J26 A;  3ZFJ A;  3O33 A;  3P1C A;  5F3A A;  2YLB A;  5ENH A;  1K73 U;  2LQ8 A;  3OA6 A;  5HRV A;  3E9F A;  4IKF A;  1X75 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...