4NS5A

Crystal structure of human bs69 bromo-zinc finger-pwwp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
185
Chain Sequence
QEMGTYLRFIVSRMKEVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Zinc finger MYND domain-containing protein 11
publication title Crystal structure of human BS69 Bromo-ZnF-PWWP reveals its role in H3K36me3 nucleosome binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 185
sequence length 209
ec nomenclature
pdb deposition date 2013-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ns5A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ns5A02
4C67A 2RI7A 3DLMA 4YYNA 4QSRA 5A7CA 4QUUA 4IOOA 4LRGA 5HJCA 2DKWA 2F5KA 4QBMA 5EQ1A 3SVFA 3TLPA 4OVAA 3HMHA 3SVHA 5CIUA 3O37A 3Q2EA 3MQMA 3OQ5A 3UVXA 4A4HA 4C5GA 5D6XA 4LYIA 4BHWA 4A9KA 4MR3A 1X0JA 4Z6HA 2E3KA 5EV9A 4E7JA 5J39A 5E3DA 4E7IA 2RO0A 3HMFA 4KV1A 4UC4A 3S3OA 5CS8A 5A5QA 3MP6A 3M9QA 5FE9A 5BT3A 4PKLA 3UW9A 4UIXA 4QQGA 2D9TA 4NUCA 3ME9A 2G4AA 3OYBA 5E74A 3OA6A 2L8DA 4J0RA 4QC3A 5D6WA 2RNWA 3LQJA 2EQMA 5L8UA 2M1HA 5FRMA 5FE3A 4QW2A 4LR6A 5C8GA 4NQMA 5LKTA 5ENIA 2RFJA 4TT4A 5LVQA 2EQKA 5EWVA 4BE2A 1WGSA 4UYEA 2X4XA 5TB6A 3NTHA 2RJEA 5L96A 3FDRA 3UWNA 5D3SA 4NR8A 5HQ7A 4HXLA 3FEOA 4N4IA 5CZGA 2YDWA 4QQ6A 5DX4A 2GFUA 5HENA 2DVQA 2F6NA 5FE8A 2LCCA 5C87A 4A4FA 5D3TA 4HBXA 2M0OA 4QUTA 5DLZA 5IG6A 4LZRA 5L97A 2JTFA 5FE2A 5LUUA 3ONIA 5ENHA 4QB3A 2OO1A 5KE2A 4II1A 4NXJA 3IU5A 3NTKA 4TU6A 2B8AA 5E9KA 4YK0A 3U5JA 3L2WA 5KHMA 4TZ8A 5L8TA 2YQDA 3P8DA 3OYGA 5EICA 3QZVA 3U5MA 5C85A 4QZSA 2O4XA 3QIIA 5FDZA 5CRMA 4A9LA 4CUQA 4LD6A 4MENA 4A9OA 5CQAA 2R58A 4E7KA 1WJSA 3L42A 3Q2FA 4EDUA 3MEAA 4QSTA 4YYKA 2RHYA 4E7HA 3S91A 5FE0A 2HQEA 4E7LA 4IURA 4CFKA 5D25A 4YYIA 2VYTA 4UIUA 3L2UA 4C5HA 5HRXA 4E96A 5E73A 5ENJA 5HFRA 2P0KA 5I7YA 3PNWC 5A5NA 2KTBB 4BW2A 5DFBA 5FE1A 4A9MA 4LDFA 5HCLA 5KTUA 3LGFA 4C5EA 1E6IA 2FSAA 5H1VA 5CTLA 5CUCA 4C66A 5AD2A 2E7NA 4PCEA 3S3MA 2LDMA 5HRVA 5A85A 2YEKA 4CLBA 4QSSA 2EQUA 2RHIA 5IN1A 3C4SA 2LSPB 5FFWA 5J0DA 4YYJA 5CP5A 3OS2A 2RI2A 4HXRA 1H3ZA 5I1QA 4YADA 5LKUA 4YH4A 2GF7A 3QZSA 3OYEA 3QJ6A 4YATA 4F3IA 5F1LA 3BDLA 4YBSA 4KV4A 3ASKA 2RHXA 2L3RA 3OYLA 2E6NA 3PFSA 5EWDA 3MULA 4HBYA 5C7NA 3ZYUA 5J26A 4QC1A 4NRCA 3MEUA 3IU6A 4UYFA 4C5IA 5CUEA 4YYMA 5JWMA 5EWCA 4CRIA 3OYDA 4BACA 4WHWA 3JVKA 2X4WA 5FG5A 3KUFA 5D3HA 3LX7A 4UITA 5ENEA 3RCWA 4IUQA 3P1DA 4YY6A 2RJDA 5K29A 4MR4A 3FKMX 3UVYA 5DYXA 5CPEA 3U5KA 4IUVA 3OYAA 3U5LA 4TT6A 4HCZA 4Q0OA 2OSSA 3DB3A 5BT4A 5D3LA 2QQRA 4LC2A 3DAIA 3O36A 2FHDA 3PMTA 5A83A 5DYUA 4A9IA 5ETBA 4QEUA 3ZEHA 2RNXA 4IR5A 3U5OA 5LJ0A 2WP2A 4XY8A 4ZC9A 4ZQLA 5EGUA 3OYNA 3JVJA 3MO8A 3LQIA 5IIDA 4DONA 4QR3A 4YH3A 4A4GA 2RI5A 5D3JA 4FLPA 5E9YA 5EI4A 5E9LA 5H1TA 4CUSA 4LYWA 4Z1SA 3E9FA 3G0JA 1RI0A 5HFQA 1JSPB 4A9JA 4QY4A 2RJFA 5FG6A 5D0CA 4QNSA 3OYCA 4QR4A 5IGMA 3LYIA 4AKNA 4NUEA 5D7XA 5DFDA 3OB9A 2E7OA 4IUUA 2R0SA 5FH6A 3DWYA 4YC9A 5ETDA 4A9FA 5EA1A 4GY5A 5CUBA 4QSQA 4BDYA 4NRBA 3OYMA 2YRVA 4NRAA 5KTWA 5KU3A 3U5NA 1WUMA 4QSVA 5LJ2A 3P1FA 5DW2A 5G4RA 5KCHA 5L99A 4IR4A 5M9OA 4O74A 2WP1A 4QQDA 5EVAA 4QYDA 2RI3A 4NR4A 4BW4A 2HQXA 1WUGA 2N9GA 5EPRA 3JVLA 3P1EA 1OZ2A 5LVRA 1WJRA 5COIA 4LZSA 5LKXA 3UT1A 4TTEA 3LJWA 5LJ1A 5CY9A 3D7CA 5FH8A 5C89A 5KO4A 5KCOA 4CUPA 5DLXA 4MEQA 1N72A 2XK0A 3AQAA 3LXJA 5E9MA 4XYAA 2GRCA 3LLRA 4B9XA 2JZ2A 2H60A 3L2QA 4FU6A 4O7BA 5DW1A 2G3RA 2R0YA 3MB4A 4O72A 3SVGA 2YYNA 5DY7A 5IGKA 4NYWA 5ENBA 5F63A 3P8HA 2QQSA 3I3JA 3OYFA 5F36A 4NR5A 2X4YA 5KH6A 4HXKA 4HXNA 3UV4A 3JVMA 4QEVA 4IR6A 2RHZA 4MEPA 5KTXA 5F5ZA 2I7KA 2MWOA 5BT5A 4L59A 5E9IA 2DIGA 3G0LA 3DB4A 5FB1A 5EU1A 3UVWA 2IG0A 3E9GA 4NQNA 4O7EA 5FE5A 5HM0A 3H8ZA 2F6JA 5DKCA 2MJVB 4O7AA 5A5RA 4PLIA 4YAXA 3META 5DFCA 5DKHA 5E3GA 4YBMA 4YYHA 3PMIA 4MR5A 4QR5A 5EWWA 5F25A 5ENCA 4BW3A 5F61A 5CQ8A 4LZ2A 3S92A 5KE3A 2XDPA 4BW1A 5A5OA 2RS9B 4PTBA 1WJQA 5EISA 5D24A 5D3RA 5I40A 2R5AA 4UIZA 5CQ6A 2WACA 3K2JA 5CGPA 4Z6IA 4ZTFA 3SD4A 5II1A 4O71A 5HRWA 3UV2A 5C4QA 5JI8A 2EKOA 4TU4A 4UIVA 5G4SA 4PY6A 2L85A 5AMFA 4N4GA 4HXSA 5DYAA 2RJCA 4HXMA 4RG2A 5I89A 3GOXA 4QVZA 1G5VA 4FL6A 4ZW1A 3L2RA 1JM4B 3QKJA 5EPSA 4TZ2A 5D3PA 4NR9A 5ACYA 3HMEA 5F60A 4BD3A 5DYCA 5CQ5A 2CKKA 2BIVA 4X34A 4IOQA 3FC3A 4QSXA 2DVSA 5FBXA 4ALHA 4UIWA 4NR6A 5HQ5A 5CUDA 1KHCA 3LH0A 3FLGA 3O34A 5C6SA 1N27A 3S6WA 5HELA 4PL6A 3P1CA 4IR3A 5FE6A 4A9EA 4PS5A 5A82A 4HXOA 4QSPA 3UVDA 2EQJA 5IGNA 4MEOA 3F70A 5ENGA 5FFYA 2L89A 3GG3A 3QBYA 4UYHA 5A81A 2BKDN 4A9NA 2LTOA 3QZTA 5CQ4A 4YYGA 4IUPA 2MWPA 3MUKA 5TCMA 5CUGA 2R10A 2DIQA 1OYXA 5AMEA 4UYFB 5FB0A 4BE0A 2DWWA 4BJXA 2R57A 3MP1A 2DATA 2RNYA 5CRZA 3CEYA 5C0MA 4Q5WA 4CL9A 5I86A 5FH7A 2YW5A 2R0VA 4ZTJA 5I29A 4O78A 2EFIA 3OY9A 5FFVA 4QSUA 5A5SA 3Q1JA 4IUTA 1EQFA 2R5MA 4IORA 3O35A 5FG4A 4Q0NA 3EAEA 3MEWA 3L2VA 4HXPA 5EPBA 5EM3A 3MP8A 1OI1A 1OZ3A 5I80A 4B9WA 5II2A 5EP7A 5HEMA 5CU8A 4Y03A 3O8VA 3OYHA 4WHUA 2OUOA 5EK9A 5FE4A 3AADA 5CQ7A 2RHUA 2GFAA 5CQ3A 4N4HA 4TYLA 4UYDA 1XNIA 5IBNA 4TT2A 2BUDA 2K3XA 4XUAA 4NS5A 4NYVA 2M16A 4O77A 4Z93A 4YABA 4YYDA 3P5OA 2L84A 2D9EA 4TS8A 4N3WA 3OMGA 4UYGA 2LRQA 3MEVA 5H85A 4HBVA 5F1HA 5CFWA 3H6ZA 5D3NA 5IGLA 3NTIA 4XY9A 3OYJA 5D26A 4GPJA 4CFLA 4O7CA 4YY4A 3OYIA 2LVMA 3S3NA 5IAYA 4PLLA 4O76A 2X35A 4YBTA 1MHNA 3OS1A 3OS0A 5ENFA 3MB3A 3NXBA 4RVRA 2K3YA 5H1UA 3MXFA 2E5QA 4J0SA 5E9VA 5F2PA 5A5PA 4X2IA 5FROA 4MR6A 4A4EA 4Z1QA 5CQTA 4CUUA 5HLSA 3OMCA 3LQHA 2O4XB 4PCIA 5I83A 2RO1A 5L98A 2I8NA 5E0RA 4CURA 3LGLA 4QSWA 4WIVA 4O75A 5DKDA 2DVRA 4ALGA 5FE7A 1SSFA 1ZS5A 2DAQA 4CUTA 4Z02A 5D6YA 5HQ6A 4BE1A 4TQNA 4O7FA 4LYSA 4UIYA 4N4FA 3O33A 4OGJA 4OUFA 5E7DA 5FRNA 4NYXA 4NUDA 2L5EA 2NXBA 4XUBA 5F3AA 5I7XA 3U5PA 4QEWA 4NR7A 4OGIA 4BDZA 2DVVA 2D82A 3UV5A 4IKFA 1F68A 4O70A 5LKZA 5F62A 4KCXA 5EWHA 5AD3A 3OYKA 5I88A 5CUAA 4J3IA 4J1PA 2NLUA 2PQWA 2YEMA 2YELA 4A9HA 5DBMA 4HBWA 4QYLA
chains in the Genus database with same CATH superfamily
4C67A 1UEBA 3DLMA 4KULA 4OVAA 4AG2C 2E12A 2KT1A 3HMHA 3Q2EA 3MQMA 3UVXA 1BIAA 2O9SA 2EJFA 2DL4A 2XICA 3QHSA 4C5GA 4LYIA 3I5RA 2KE9A 4Z6HA 2QI2A 4UC4A 3S3OA 1WHGA 1QVFA 4LUEA 3MP6A 5FE9A 5GAN8 3G4ST 2F2VA 4Y91A 1YCSB 4M77A 2KRNA 4BI3A 3PE0A 3R6NA 3CCEQ 2PVGB 3OA6A 3G71T 2VB6A 3JB9J 2RNWA 1JQQA 2KQWA 3ZFJA 5C8GA 2PU9B 5LKTA 4DBQA 5KYXB 2NUZA 2RFJA 4TT4A 5LVQA 5EWVA 3CCJQ 1OU8A 1QKWA 1K76A 2X4XA 3NTHA 4C0ZA 2VV5A 1QMCA 1YJNQ 2J6OA 1Q81C 4HXLA 3CC2Q 4N4IA 1VQKA 4AMCA 2FL7A 1AEYA 5DLQE 3CPWS 3G7ZA 3CC7T 3CCLA 3CCLT 5DLZA 5IG6A 4OMMA 2CYZB 5FE2A 1R0BG 1PHTA 5LUUA 5KYUA 3ONIA 2X3XD 4M75D 1KFZA 1VQOQ 3EFOB 2ZGWA 4KRTA 4YK0A 2JVVA 5L8TA 1QVPA 3I5SA 5KYYB 1VQ6T 3OYGA 1VQ6A 4DOWA 5EICA 4EMKB 2CP2A 1YJ9T 4M78F 5GANd 5CRMA 2K79A 4ZGDB 4MENA 1QKXA 1P92A 4E7KA 4KGZB 1YHQA 2EWNA 3L42A 4EDUA 3MEAA 4MZMA 2OI3A 4QVCA 1N8RC 2JJ9A 2HBPA 4E7LA 3HRUA 1K9MU 1PUOA 1VQ4Q 2ZPEB 3LH5A 2A37A 1F1BB 1HJDA 4UIUA 3L2UA 1WXTA 4C5HA 1NPPA 4E96A 4F7UA 5GAOq 3CQTA 1KG1A 2KTBB 5DFBA 2EGEA 2JMCA 1VQLA 2QQAA 1B07A 4C5EA 4XTWA 2ROLA 3EGXA 2AKLA 2HSEB 1M3BA 2XMFA 5J0DA 5CP5A 3GF5A 1PRMC 3OS2A 2RI2A 4F14A 2M02A 3CCSA 4YADA 4YH4A 1OX9A 2RN8A 2COYA 2J6KA 3CCVT 2K5IA 4F3IA 5F1LA 4OMPA 3CCRA 2L3RA 4PJOB 3X25B 1WXBA 1SRMA 5EWDA 4M75E 3SB2A 3EHRA 5JWMA 4M75C 1PC0A 1VQNQ 5CKHA 4NL2A 2DXBA 3JCMg 1IGQA 2X4WA 5AYFA 3VV0A 2XDBA 5D3HA 1LPLA 2A7YA 1K8AR 1D09B 5IXBA 5ENEA 1QLYA 1GCQC 2DK3A 3VS2A 1U1TA 2DEQA 4MR4A 4HVVA 1KC8C 3ERRA 1MMAA 2KVQG 1AWOA 1SHGA 2LX9A 2X3WD 3L2ZA 1ZSZC 3HSBA 3DAIA 3PMTA 4A9IA 4QEUA 5FU7B 1WHKA 1G3YA 4M4ZA 5LJ0A 4JJBA 1K9MC 4ZQLA 5EGUA 1TU0B 3OSVA 3JVJA 3HFOA 5J3BA 2RD1A 2NYSA 2RI5A 4FLPA 2XIDA 8AT1B 5H1TA 3E9FA 1K9AA 5HFQA 1JSPB 4A9JA 4QY4A 3OYCA 1D1AA 4XTZA 5LJ5g 5IGMA 1W2BS 5DFDA 2JW4A 3A8HB 2R0SA 4AG1C 3DWYA 1TSFA 4DBHA 2ZZDA 5CUBA 1SRLA 4HVWA 2HQHA 4BDYA 2YRVA 5KTWA 1WUMA 2GBQA 4QSVA 1PKSA 2Z0WA 4J6YA 4O74A 4LE9A 1BI1A 2ZAEA 5GAMh 2L3QA 4NR4A 1XTDA 1WUGA 5DM7R 2N9GA 3E1SA 3EG0A 5COIA 1PD0A 4C8QA 1KQSA 2LP5A 2K5LA 1ZQ1A 2MMPA 1I0CA 3RMSA 3RBBB 5C89A 5KO4A 2XG8D 4CUPA 4AT1B 5A0GA 3CBOA 4M7AF 3AQAA 3FIFA 4JJCA 1EIFA 4B9XA 4M78A 4JS5A 1QCNA 2DXTA 3L2QA 5GAN7 2D0NA 2CH4A 3M0RA 1M90U 4ELZC 3QDRB 5DY7A 5IGKA 2ZPIB 4NYWA 5F63A 3TU4K 5I2SA 2X4YA 2EYZA 1YFNA 2FZGB 1VQMQ 1RABB 4IR6A 4MEPA 2MWOA 5F5ZA 1GXIE 5GJWB 5BT5A 3MJXA 5E9IA 2J06A 4M7DG 3OBYA 4NQNA 1JU5C 3H8ZA 4HVUA 4D8DA 3CCEA 2MJVB 4O7AA 5A5RA 1QWFA 2DJQA 3META 2ESWA 4PLIA 3CD6Q 5DFCA 5DKHA 2LX7A 2KRMA 2CGHA 3PMIA 2K3BA 5F25A 4BW3A 2EJ9A 4LDVA 2DTIA 1UUEA 3C12A 5KE3A 2XDPA 1JJ2P 3VRYA 4IIOA 1YJNA 3CC2A 3OW2A 2EW3A 2E64A 3FJ5A 5GMKm 3CCUT 1V76A 4Z6IA 3G1JA 4ZTFA 1VYTA 2E10A 4F7UB 4JRPA 3UV2A 5JI8A 2VWFA 2EKOA 1KJWA 4TU4A 4PY6A 4N4GA 4HXSA 2L5QA 4FT2A 3GOXA 4QVZA 4FL6A 4ZW1A 3L2RA 3JB9D 3QKJA 3EGXB 4NR9A 3HMEA 4L6V5 1NEGA 2BIVA 3FC3A 4QSXA 3I55Q 4ME7A 4ALHA 4RUGA 3QZ5B 4PL6A 4IR3A 1K0SA 3CBMA 4C0DC 3F70A 1M27C 2L89A 2KRSA 2QK0A 4A9NA 1VQ4A 2GTOA 5IHKA 1GL5A 3GP8A 4ZNXA 4IUPA 1AZEA 1M90C 5TCMA 2R10A 2FZCB 3UF4A 3N5BB 4OGEA 2KDSA 2MYSA 4RKUE 5CRZA 1MNDA 1UDLA 1FYNA 4O78A 3OY9A 2EYQA 1AWWA 4FYXB 4QSUA 4K11A 3PVQA 1WZOA 4IUTA 5FG4A 1BU1A 2FYKA 4BUGA 1W4SA 3L2VA 2IVWA 3MP8A 1NJIR 1WI7A 1OZ3A 1U1SA 2JT4A 3EGUA 2E1HA 1SF9A 4B9WA 4DEXA 1N6AA 1SG5A 4Y03A 3O8VA 2IPOB 2AHJB 5EK9A 5FE4A 5CKBA 5CQ7A 5IHIA 5I21A 3HTRA 5CQ3A 4A63B 4HT9A 5EG2A 4TT2A 1NPRA 2LCLA 3G4SQ 4C92A 5KYWA 4XUAA 4XU2A 4NS5A 5GANh 4O77A 4Z93A 4YABA 4YYDA 2CT4A 3G71Q 1Y71A 3HFNA 2NUPB 2OJ2A 5H85A 4PJOD 2AT1B 2RM4A 1KC8R 4GPJA 4CFLA 2X9HA 4YY4A 1PWTA 2A3LA 5LJ3f 4O76A 4YBTA 2H3EB 5L23A 3OS1A 4RVRA 1M2VA 5A5PA 4LDUA 5FROA 1U06A 4X2IA 2NUTA 4E2FB 2JTEA 1K9MR 2QYZA 4Z1QA 4EMKC 5CQTA 3CCLQ 4BY6B 4AFQC 4M7AA 2I8NA 1Q86U 4CURA 3JCMW 2RK1A 1CSKA 4EMGA 5FE7A 1SSFA 1WXUA 4BI8B 1NYFA 1SHFA 4CUTA 3NPFA 4F17A 4TQNA 5FWCA 3GBQA 4C8QB 4XTVA 1BCOA 1OV3A 4OUFA 1VQ6Q 4NYXA 4NUDA 2NXBA 1YBYA 3A98A 1EFNA 1YJ9Q 2HBWA 1MGQA 2QTXA 4QEWA 5GAN5 4NR7A 2E3IA 3VS0A 1M1KR 4GLKA 2D82A 3QSUA 3UV5A 4M78B 5LJ3j 4IKFA 1K8AU 3M55A 5F62A 2KGTA 1FX7A 1HD3A 2NLUA 4J1PA 4OB2B 4OMLA 3X20B 3EFRA 2YELA 4A4KA 1PG5B 4HBWA 4C0FA 4M77F 4KT0E 2JM9A 3RKWA 1UGSB 2Y4YA 3SVHA 5CIUA 3OQ5A 3C95A 1M1FA 2FRYA 8ATCB 2F2XA 3QWXX 2DO3A 1C1AA 4A9KA 2JN0A 2E3KA 5EV9A 5E3DA 4E7IA 4RMOA 2RO0A 4KV1A 1WHJA 2CZ7B 3EG9A 5A5QA 3M9QA 1W70A 4PJOC 4UIXA 4NUCA 3ME9A 3VUZA 4FM4B 2MIOA 2QEXT 4M7DE 4NOYA 1YITT 3RNJA 3OYBA 4OF1A 4JDSA 3MCAB 1BK2A 2L8DA 4J0RA 2FO0A 3LQJA 2EQMA 2M1HA 3CCVQ 4QW2A 4NQMA 2KEAA 1GFCA 2OAUA 2CP5A 2RJEA 3FDRA 4Y92A 4NR8A 3OW2P 4N0AA 1VQMA 1Q86C 2GFUA 5HENA 2F6NA 5FE8A 5C87A 3URGA 5GJVB 2HL3A 5LL6S 1ZUYA 2P4TA 1VQ7T 5ECAA 4BI4A 3CD6A 5FU7C 3CMAA 2OO1A 5KE2A 3CMAT 4JLGA 3EGDB 3L2WA 3HPWA 5HKCA 2YDLA 4LXCA 3X24B 4M75G 3QZVA 5DLOA 1VQ9T 3QIIA 1K8AC 2KXCA 2EBPA 5CQYA 4LD6A 4A9OA 2YRDA 2LQKA 5A0LA 2HQEA 4R56A 1G2BA 4YYIA 2ED0A 1WPYA 2QQBA 4J9CA 2COWA 2QQ9A 2HD0A 2PTKA 4DEYA 4JRIA 5E73A 5ENJA 5HFRA 2P0KA 3PNWC 5GAN6 1WLPB 4J8OA 3CCQA 2YUOA 1D1CA 3CCQT 2HAXA 3I55A 4XQ3A 3KBGA 3PGGA 3M0TA 2O88A 1W2BP 1AOJA 1M90R 5KTUA 3NGPA 1E6IA 5H1VA 4C66A 1MV0B 4J9GA 4J9HA 4QVDA 3S3MA 2DILA 5A85A 2DYBA 2YEKA 5KYNA 2YRCA 4L5GA 4QSSA 4C92B 5KYWB 2RHIA 5FFWA 3CMET 3J7AF 3PIOA 1XJWB 2LT1A 1H3ZA 2QDLA 5LKUA 3QZSA 4XU3A 3OYEA 4ATOA 4JS4A 1I1JA 4YATA 2KYMA 3BDLA 4YBSA 1OULA 4KV4A 3ASKA 1QW1A 3OYLA 2ABLA 3PFSA 4HBYA 2NWMA 4PJJA 5C7NA 1QVGS 3ZYUA 2NUTB 3D1BA 3IU6A 5CUEA 5EWCA 4M7AB 3CBPA 4WHWA 3SEMA 2D1XA 3HP9A 3KUFA 1U8RA 3V7RA 1PSFA 3BFMA 2DD4A 2DTOA 1DJ7B 1IRXA 2ZCFB 2L2PA 5GAMf 3G4SA 3U5KA 4X9CA 3VUBA 3QDFA 3OYAA 2LT4A 2JMAA 2QQRA 1ZSGA 4GBQA 3G71A 2FHDA 3O36A 2E3HA 5DYUA 5A2QE 5ETBA 1TUGB 3I56T 2GNCA 3I56A 3JV3A 3ZEHA 4IR5A 1NBEB 4A53A 3U5OA 2DRKA 4CC4B 2QGGA 2WP2A 4XY8A 5CQXA 3OYNA 3LQIA 2KAFA 4QR3A 3OS5A 1BI3A 4EPCA 5LJ3g 1UTIA 1NJIU 5E9LA 2CZ1B 3CCUQ 1OU9A 4Z1SA 3G0JA 1RI0A 1Y57A 3RKXA 3CC7A 4PJNA 5FG6A 4Z89A 1VA7A 3LYIA 2XDDA 3OB9A 2E7OA 3RKYA 4C8QF 4GY5A 2VGNA 5GAMj 4QSQA 1KIKA 3U5NA 5LJ2A 5DW2A 1O9SA 1FMVA 2H3JA 3EG9B 5L99A 1JJ2A 2OTLT 1YJ9A 4QQDA 1T3SA 2K5FA 5EVAA 2DX1A 1KC8U 4BW4A 2HQXA 2ROTA 5GMKj 2RQVA 5EPRA 1KQ1A 3P1EA 3A5ZB 4PKCC 2DZCA 4PFPA 4LZSA 4TTEA 5LJ1A 5CY9A 4RG8A 4M78D 4HCKA 2CSQA 4ELYC 5DLXA 2DNUA 4FYWB 2XK0A 3LXJA 5E9MA 4QKUA 2GRCA 1VQ8T 4MZPA 2H60A 2E5KA 4FU6A 4O7BA 2YSQA 2QASA 2R0YA 3MB4A 2DBKA 3VYGA 4HCBA 2YYNA 3UATA 5ENBA 4XAXB 3I3JA 5I11A 2GCXA 3VS7A 2DBMA 2H8HA 5KH6A 4A54A 4QEVA 2BE7D 2RHZA 3NFCA 2LJ3A 2LJ0A 2DIGA 1M1KU 4Z8AA 1ZUKA 4O7EA 2EAYA 3M56A 2F6JA 3JCMh 2LJ1A 4OMNA 1ABOA 2RB6A 1TUCA 4XU1A 3JCMQ 3SWNA 3CCVA 1Q86R 2PNIA 3CXCS 2YXYA 1U5SA 2FPDA 1NJIC 1EX4A 1M3AA 2RQTA 5A5OA 1G3WA 2RS9B 1ABQA 1QP2A 1Y0MA 5D24A 1S72T 2WACA 4UIZA 4E6RA 3K2JA 5CGPA 4BY6C 1I07A 3SD4A 4J83A 4O71A 1VOMA 2GQVA 3M0PA 5G4SA 4TVRA 1MMNA 5AMFA 2CREA 4J9FA 1YCYA 1E6GA 4C8QC 1G5VA 5CCAA 1GRIA 1JM4B 2DA9A 3M0SA 5ACYA 3JB9G 5DYCA 5LJ3e 2W0ZA 5LJ5h 2F1LA 3JCMb 4M78C 1YJWT 2KYBA 3LH0A 1KHCA 2MPXC 2KT8A 3FLGA 1N27A 4QT7A 2L3PA 5HELA 3P1CA 5FE6A 1ZHIA 4HXOA 2HKQB 4R0KA 4P5NA 4AFZC 3GG3A 3QBYA 2LTOA 4PK4A 5CQ4A 2DM1A 5AMEA 1ARKA 4KH0B 2DATA 4AFSC 2RNYA 4FSXA 3CEYA 3M54A 3CPWA 5I86A 2R0VA 3LWIA 1SEMA 1D1BA 5FFVA 4B6MA 4C92F 3BDUA 3Q1JA 3UPUA 1M1KC 1WFWA 4ESRA 3GLXA 4AKHA 2VUBA 4RTYA 4LUDA 2DTHA 2M9UA 4M77B 1M8VA 1H92A 3OYHA 4WHUA 2OUOA 2XKOC 2ATCB 1ACMB 4N4HA 4TYLA 4UYDA 5IBNA 2CT3A 4J6WA 2DYIA 2QEXQ 4M75A 3P5OA 1YITQ 2FVUA 2L84A 3MEVA 5CFWA 3H6ZA 3CC4T 3NTIA 1N9RA 3OYJA 2DPPB 1PSEA 4LN2A 3OYIA 1GCQA 2LVMA 1X27A 4PJOG 5KYUB 2QXFA 3S3NA 2A0FB 1ZUUA 1MHNA 1VIFA 4M7AD 3JSCA 2K3YA 2E5QA 5E9VA 4A4EA 4CUUA 5HLSA 3OMCA 3LQHA 1ZX6A 5L98A 1VQ7Q 4QSWA 1PNJA 2HDAA 1Z9ZA 2YUNA 2DVRA 3CMAQ 4IIMA 2D8HA 5D6YA 2KNBB 3THKA 4BE1A 2VASA 1H641 1VQ9Q 2ENMA 1ZA2B 3U5PA 3CCUA 3V8LA 4PNOA 4XK8E 1WQWA 1LOJA 1T3LA 2VGMA 5GMKi 4O70A 4KCXA 3OYKA 4J3IA 3VS1A 3EG2A 2YEMA 2DJZA 2J7IA 2E4HA 1JO8A 4XTUA 1Q7YU 5L8RE 5DBMA 2RF0A 4RCBA 4QYLA 4YYNA 2DFUA 4QSRA 5A7CA 1AD5A 1X2KA 4C92C 4IOOA 1D0YA 2DKWA 3TLPA 3SVFA 2CZ6B 5LJ3d 3CCQQ 2HNIA 4KUIA 2V8IA 3NHNA 1HYOA 4DA4A 4A4HA 3TVTA 4BHWA 3SWNB 5DY9A 3VKGA 4MR3A 1X0JA 3M4YA 3HMFA 1VQOT 3M4GA 5CS8A 1I8FA 1X2QA 4PKLA 3UW9A 5CR2A 4QQGA 2D9TA 3CMEQ 2ZPFB 5FW9A 1RAEB 1RL2A 5CKDA 4ZGEB 1C6VX 1K4US 2F69A 5HK0A 4QC3A 2HEQA 4M7AC 1K73U 4RTTA 2G6FX 5ENIA 2LQ8A 2MK5A 1UE9A 5IHNA 1VQPT 1W2BA 2EQKA 2K4YA 1I4K1 2DMOA 1Q95G 4O5VA 1XOVA 2XHCA 3DKMA 5CAIA 5D3SA 3FEOA 2DL5A 3LWHA 4BB7A 1M30A 2LCCA 2K9GA 3RIRA 4A4FA 4LZRA 2DZ9A 2JTFA 2BE9B 2K2MA 1QWEA 1KSWA 3JAME 3TSZA 2HKNA 3IU5A 2PVDB 3NTKA 1WX6A 4TU6A 5E9KA 3PT9A 3U5JA 3TEEA 3VKIA 5KHMA 1B34A 1G83A 2RA2A 1FMKA 5C85A 2O4XA 1CKAA 2YUQA 4A9LA 4NL3A 3I56Q 2KROA 2R58A 5GAMe 1TXQA 4FSSA 1Q7YC 1Y07A 4QSTA 4YYKA 4MMKA 4J9DA 4CI0C 4E7HA 3S91A 2RQWA 5FE0A 4KBMB 1RLPC 3V7CA 4IURA 1OQKA 1ZLMA 3WVEB 1UFFA 4F7UG 2JS0A 2VYTA 4M7DF 2XI9A 5GMKe 3CC7Q 2QGFB 1IXDA 1M3CA 3A8LB 1UJYA 5A5NA 4BW2A 5FE1A 2RNAA 3CPWP 4LDFA 2X4JA 4E7SA 2O01E 3LGFA 5AD2A 5CTLA 5CUCA 2LDMA 3V8KA 5HRVA 1D3BA 2K2VA 1WDXA 4J9EA 5CKFA 1W6XA 2OTLQ 4CLBA 1WQ7A 1N5ZA 3O5ZA 4CC7A 1MUZA 3C4SA 4N0AC 3SHWA 1K73C 4AI6A 2JOYA 4HXRA 3NMZC 2LQWA 2DVEA 1UGPB 5CKEA 5HCKA 1YN8A 4FW2A 1GBRA 1LVKA 2YLCA 5CVIA 3FB9A 3QPHA 1RADB 2E6NA 3A1PA 4ZN1A 3V8JA 1OPKA 1VQ8Q 1VYVA 4QC1A 2DVJA 1QCOA 4NRCA 2YT6A 4WCIA 1K0XA 4CRIA 1YWPA 3JVKA 4RCCA 1TOVA 2C06A 1CKBA 5KYXA 1YIJT 4M77D 2VXFA 3RCWA 4PJOE 4IUQA 1NM7A 3P1DA 5K29A 3UDCA 2WSCE 3FKMX 1GBQA 2QDYB 5DYXA 1ZA1B 2KY9A 2V8JA 4IUVA 2W10A 3U5LA 1HK9A 5IT9E 4TT6A 2O2OA 2QEXA 2OSSA 3G6ET 1YITA 5BT4A 2CZ0B 4LC2A 1FXXA 4FYVB 2IIMA 4HKEA 1QVFS 1TS9A 2RNXA 1E7OA 3A8GB 3GNGA 1BI2A 3MO8A 5IIDA 3J80E 4DONA 6AT1B 4YH3A 4A4GA 2FB7A 3CCMT 5D3JA 4EMKA 4KUDK 1H3HA 2FPFA 4LYWA 1NZ9A 3VS5A 2HL5C 2ECZA 2RJFA 5D0CA 4QNSA 2P0QA 4QR4A 4NUEA 5D7XA 2EJNA 1HXDA 1VQ7A 5ETDA 4A9FA 1KK7A 5EA1A 4WTOB 2QG9B 1WHMA 4NRAA 1ZKRA 5KU3A 1TWBA 3MKDA 3P1FA 4AKIA 5G4RA 2CP6A 4IR4A 5M9OA 1VQ9A 2DLPA 2D8JA 2WP1A 1JRIA 3OBWA 4OB3B 2OTJT 1YJWQ 2P0PA 3JVLA 1OZ2A 5GAMd 1KD1R 5LVRA 4C8QG 1RACB 1WJRA 4MDXA 4ORZA 1QP3A 5LKXA 2K6DA 1TUDA 2HSPA 2DD5A 3UT1A 5KCOA 1B3QA 3LW5E 1TG0A 1C0MA 2FRWA 1N72A 3OYYA 2F5TX 4M78G 1XQHA 2EJGA 4M77C 3LLRA 2COZA 3HKSA 4RTWA 1BIBA 3EG1A 2KK4A 4OMFB 1SPKA 1G3SA 2GTJA 2EVRA 4O72A 4LNPA 4JRQA 1Q82U 3RESA 2MI6A 3P8HA 2QQSA 3OYFA 4VUBA 1AWJA 2BZXA 1X75C 2QA4T 2FG0A 1UGQB 2ZPBB 3JCMV 3DB4A 3CMEA 5EU1A 4DBRA 2VKNA 3UVWA 4M7DA 1OX8A 2IG0A 1MV3A 3E9GA 5FE5A 1KHIA 5DKCA 1M8MA 3MPUB 2CP3A 3JCMP 4V2SA 2F2WA 4YYHA 4MR5A 5ENCA 5F61A 3GNFB 5CQ8A 4LZ2A 3S92A 1M5Q1 4BW1A 3AHUA 1Y96A 2QAZA 2E6ZA 5EISA 1M2VB 5D3RA 2J05A 5I40A 5CQ6A 2EGAA 3QJYA 1ZBXA 2A28A 2D0QB 1BCMA 2ZPGB 3CC4Q 2DEUA 5II1A 5C4QA 2YLBA 4UIVA 5GAN3 1YI2T 2QTVA 2RJCA 4HXMA 5LJ5j 3TSWA 3EHQA 5EPSA 1D3BB 5LJ3h 1Q7YR 1UGVA 4TZ2A 1KQ2A 3QG1A 5F60A 4BD3A 3SDZA 4F7UE 2DL7A 1UHFA 4X1VA 2DVSA 1I5OB 2JUFA 5CUDA 3IQLA 1WYXA 3S6WA 2YUPA 3H41A 4A9EA 2OX7A 4PS5A 3JRZA 1S1NA 4QSPA 2V1QA 4MEOA 1VUBA 4J9BA 5ENGA 4FW1A 3M58A 4UYHA 5A81A 1BI0A 2BKDN 1RAGB 2KI7A 4YYGA 2MWPA 3MUKA 2DIQA 4KH1B 1Q82C 4JJDA 3JCMc 1Y7XA 3MP1A 2PVOB 4Q5WA 4CL9A 4J5YA 3UA7A 3SWNC 1K73R 4ZTJA 2EFIA 2KXDA 3QXEB 2I0NA 2O9VA 4WF2A 1EQFA 4HA8A 3O35A 2CP7A 5HY6A 4Q0NA 4M75F 1LJOA 2DE0X 3TCJA 2OTLA 3PTAA 1VQKT 4MMLA 4HXPA 5EM3A 2C0IA 4AKGA 4C8QD 3U23A 5II2A 5FLXE 3E2UA 5A0DA 1OOTA 1I5LA 2DXCA 1R8OB 2RHUA 2HMAA 2AZSA 1BBZA 2CDTA 2BUDA 4C92G 2GGRA 3QYHB 4MZTA 4RTVA 2K3XA 2GQIA 4NYVA 1JBMA 1BKBA 3D1DA 4FCYA 4FIBA 2D9EA 2HZYA 1VQ8A 1T0JA 4N3WA 3OMGA 2LRQA 1KQSS 5F1HA 5IGLA 1G3TA 5D26A 3P8BB 5GAOn 1YHQT 1X43A 1VQPQ 1JXOA 2J6FA 2DETA 5IAYA 4PLLA 3VS6A 1VIEA 4PJMA 3OS0A 3MB3A 3NXBA 2FZKB 4JPBW 5H1UA 3MXFA 4MR6A 1X6OA 5IH2A 4M7AG 1U3OA 4PCIA 2PZ1A 2DL8A 3MHXA 4WIVA 4O75A 5DKDA 2FEIA 2MF2A 2CP0A 1ZS5A 1VQLT 2JNGA 1PKTA 2DAQA 4Z02A 5HQ6A 4ANJA 4O7FA 4LYSA 4UIYA 4N4FA 3O33A 4OGJA 1H8KA 2L5EA 4XUBA 2JTMA 5F3AA 3EH2A 1I81A 1S72A 4OGIA 2DVVA 3BW1A 1TTHB 1RI9A 2M51A 3CCST 1F68A 5LKZA 1QVGA 3RDVA 4E47A 5EWHA 3HHTB 4RTZA 5I88A 4F04B 4C8QE 3OW2S 5GAN2 1IREB 3CCRT 5CO7A 4ZGJB 2RI7A 3EG3A 4QUUA 4LRGA 5HJCA 2F5KA 4QBMA 5EQ1A 4M78E 3O37A 3H9NA 3M59A 4M7DB 1QQJA 1MMGA 2P84A 1PD1A 1YJWA 2CUDA 2DERA 5D6XA 3GIBA 1AVZC 1M2OA 3REAB 5GANf 4E7JA 5J39A 3VS4A 4JZ4A 4CC3A 2EYXA 2VC8A 4J7FA 1YWOA 5BT3A 2C0OA 1Y96B 2G4AA 3I9QA 5E74A 4RTUA 1GFDA 3H0FA 5D6WA 5FRMA 5L8UA 3KXTA 4RTXA 5FE3A 3E19A 4LR6A 1SKUB 1VQ5T 1VQ5A 4BE2A 1WGSA 2D6FA 4UYEA 3UWNA 5TB6A 5L96A 1X6GA 5HQ7A 5CZGA 1UGRB 2YDWA 1WIEA 2EQIA 4QQ6A 5DX4A 2JXBA 2NUPA 1N9SA 2DVQA 1D0XA 4X9DA 5D3TA 1KD1U 4HBXA 2M0OA 4QUTA 2WSEE 2LQNA 3EH1A 3QWYA 4AFUC 4D8KA 5L97A 5GANj 4C92D 1YIJQ 2BZ8A 4JLIA 5ENHA 4QB3A 2BZYA 1V29B 4II1A 4NXJA 1Z9QA 2B8AA 2LNHB 3TREA 3BE3A 4TZ8A 2YQDA 2VXEA 2K57A 5EC7A 3P8DA 3U5MA 4QZSA 3G6EQ 1UECA 4PFOA 5FDZA 1WNLA 4CUQA 3CC4A 4XTXA 4J9IA 5CQAA 1WJSA 3Q2FA 2RHYA 4HXJA 4XU0A 1SSHA 1QVFP 3CCMQ 4CFKA 5D25A 5GMKh 4LD9K 1X6BA 3VS3A 3FJPA 5FU6B 1M1GA 1ZSZA 2Y90A 3RUXA 5GAOl 1MMDA 3RERA 5HRXA 2SEMA 5GAMg 9ATCB 2LC4A 5I7YA 2AKKA 1QCFA 2Y4XA 3L1AA 2LZ6B 4A9MA 5HCLA 1IO6A 1PM3A 2FSAA 1Q82R 1K1ZA 2EYYA 2E7NA 2CSIA 4PCEA 1IHWA 3VRZA 3A8MB 2RH2A 2AZVA 4MDWA 1AWXA 1AHJB 2EQUA 2V1RA 5IN1A 3CXCA 2LSPB 4YYJA 2OTJQ 2FPEA 1WA7A 3BY7A 3SFMA 1FMWA 5I1QA 1Q81R 3CCET 4LDXA 3T9NA 2RK2A 2GF7A 1UHCA 5IXFA 2E41A 2V8KA 4OMQA 3JCMe 3QJ6A 4KGXB 2I2LA 3CCJA 2RHXA 4C92E 4PJLA 3CCJT 1G8XA 1V1CA 3MULA 1YJNT 1KD1C 1YP5A 2EGCA 3CC2T 1NLPC 4HCCA 1TH7A 2CS7A 5J26A 3HL8A 3MEUA 3JB9F 4UYFA 1RAIB 4PFZA 4C5IA 4YYMA 2CH4W 3M5AA 3OYDA 4BACA 5I22A 5FG5A 3LX7A 1IB8A 3FRNA 4UITA 3UA6A 1FWZA 2QA4Q 4YY6A 2JS2A 2RJDA 3QZ9B 1VQOA 1HSQA 4M77G 3UVYA 2RPNA 5CPEA 4JJNK 1PRLC 1N8RR 4OMOA 4HCZA 4Q0OA 4M7AE 3DB3A 5D3LA 3QUIA 5A83A 5LJ5e 3JCMX 4ZC9A 3EGDA 4D6WA 1VQPA 2DRMA 4HT8A 3M0UA 2CUBA 1R0CB 3CPFA 1X01A 2K7AA 2BTTA 5E9YA 5EI4A 2L0AA 4CUSA 1VQ4T 2YWWA 2KBTA 4FT4A 4AKNA 2C0TA 1QVGP 4LDYA 4IUUA 5FH6A 2MCNA 1YI2Q 4YC9A 3OSSC 3ER0A 4NRBA 3OYMA 3D7SB 2P4RA 2AK5A 5KCHA 2L3SA 1AZGB 3VJPA 4QYDA 2WSFE 2RI3A 3VKHA 1VYUA 2M0YA 4Y28E 3C0CA 1RAAB 3EFSA 5GAN4 1JXMA 4PJOF 4OB1B 3LJWA 3QYGB 2DXUA 3D7CA 5FH8A 1NYGA 3C94A 7AT1B 4E7ZA 4MEQA 2O31A 2X51A 1WHLA 4XYAA 2A08A 2JZ2A 1VQNA 2PUKB 1VQNT 5DW1A 2EIFA 2G3RA 1M4ZA 3SVGA 1ZBJA 2PUOB 4CC2A 5F36A 4M7DD 4NR5A 3JB9I 2RQRA 4HXKA 4HXNA 3UV4A 3JVMA 1PCXA 3PIPA 5KTXA 1YNZA 1VQKQ 2I7KA 5GANg 2ED1A 4L59A 3R6OA 3G0LA 5FB1A 3WXMB 3KFVA 1E6HA 4M75B 5HM0A 1T0HA 3GPLA 5GAOr 4YAXA 3RMQA 3JCMd 5E3GA 4YBMA 4R55A 4JZ3A 3V7SA 1RLQC 4QR5A 5EWWA 1IGUA 3A8OB 1W1FA 3DLLA 2DF6A 4DOVA 4PTBA 1WJQA 4O6JA 1GCPA 2R5AA 4DBFA 1ZSZB 1JB0E 4C0GA 1WHHA 1YHQQ 2XD0A 5HRWA 1KQSP 1YIJA 3PVLA 2L85A 1EZZB 1A0NB 5DYAA 2YHTA 4RG2A 5I89A 3ULRB 3H0IA 3X26B 1IHVA 4OB0B 5D3PA 3G6EA 1J3TA 4F16A 5CQ5A 2CKKA 4X34A 4IOQA 5FBXA 1X69A 4UIWA 4NR6A 5HQ5A 5C6SA 4J7IA 5LJ5d 1VQLQ 3O34A 3M53A 1O75A 2LMJA 3EFOA 1JEGA 5GAOp 5A82A 4YTLA 3UVDA 2EQJA 5IGNA 3X28B 4OGCA 5KYYA 5FFYA 3CCMA 1UJ0A 3CXCP 2JM8A 1S72Q 3QZTA 4J6XA 5CUGA 3CCSQ 1OYXA 4EMHA 4UYFB 5FB0A 4BE0A 2DWWA 4BJXA 1UG1A 2R57A 3WVDB 4M7DC 4EIKA 5C0MA 2AIRB 3I35A 5FH7A 2YW5A 5AT1B 2EYWA 5I29A 1NLOC 2SRCA 3QO3A 3CCRQ 5A5SA 2XU8A 1NEBA 4IORA 2R5MA 2MOXA 4OP0A 3EAEA 1VQMT 3JCMf 3MEWA 5EPBA 5FWBA 4JUVA 1OEBA 1OI1A 5I80A 2OTJA 5EP7A 5HEMA 2DKGA 5CU8A 3TQ7P 3RR6A 5I2MA 3AADA 3JCMJ 3INZA 3CD6T 2GFAA 1JJ2S 2A36A 2B86A 3J81E 1XNIA 3HRSA 2V26A 4M77E 2OAWA 2M16A 2LCSA 3M0QA 4F7UF 2LNVA 3HRTA 4TS8A 5GANe 4UYGA 4HBVA 1MNEA 5D3NA 4XY9A 1VQ5Q 3M57A 4FYYB 2KMTA 3AT1B 4O7CA 2VVKA 4JRKA 2X35A 4PJOA 2QA4A 5ENFA 3ZBDA 1NG2A 5LJ5f 4J0SA 5F2PA 4Z88A 2E65A 2ZPHB 1B34B 2EPDA 3ZL7C 1Q81U 2O4XB 3H0HA 1IZ6A 5I83A 2RO1A 5E0RA 3LGLA 1OPLA 1NE8A 1UB4A 4LDWA 4DQ2A 1RUWA 5GMKl 3I55T 5D7UA 4ALGA 1BYMA 5HK3A 3VU3C 2KR3A 5CK9A 4KGVB 5E7DA 2HCKA 1RAHB 5GAOm 1LCKA 1RAFB 1LNXA 5FRNA 4ZN3A 3JB9H 1AT1B 2MAMA 5I7XA 4GLMA 2RQUA 5FU6C 2KSSA 2EKHA 4BDZA 2DL3A 3REBB 5AD3A 4XTYA 5CUAA 1BB9A 1D0ZA 2PQWA 1YI2A 2E70A 2RMOA 1M9SA 3VYHB 1B7TA 4C0DB 4A9HA 1R77A 1N8RU
chains in the Genus database with same CATH topology
4C67A 1UEBA 3DLMA 4KULA 4OVAA 2E12A 3HMHA 3Q2EA 3MQMA 3UVXA 1BIAA 2EJFA 2XICA 3QHSA 4C5GA 4LYIA 4Z6HA 2QI2A 4UC4A 3S3OA 1QVFA 3MP6A 5FE9A 5GAN8 3G4ST 4Y91A 4M77A 4BI3A 2PVGB 3OA6A 3G71T 3JB9J 2RNWA 2KQWA 3ZFJA 5C8GA 2PU9B 5LKTA 2RFJA 4TT4A 5LVQA 5EWVA 2X4XA 3NTHA 4C0ZA 2VV5A 1Q81C 4HXLA 4N4IA 1VQKA 2FL7A 5DLQE 3CPWS 3G7ZA 3CC7T 3CCLA 3CCLT 5DLZA 5IG6A 2CYZB 5FE2A 5LUUA 3ONIA 4M75D 2ZGWA 4YK0A 2JVVA 5L8TA 1QVPA 1VQ6A 1VQ6T 3OYGA 4DOWA 5EICA 4EMKB 1YJ9T 4M78F 5GANd 5CRMA 4ZGDB 4MENA 1P92A 4E7KA 1YHQA 2EWNA 3L42A 4EDUA 3MEAA 4MZMA 4QVCA 1N8RC 2HBPA 4E7LA 3HRUA 1K9MU 2ZPEB 4UIUA 3L2UA 4C5HA 1NPPA 4E96A 4F7UA 5GAOq 1KG1A 2KTBB 5DFBA 1VQLA 2QQAA 4C5EA 4XTWA 5J0DA 5CP5A 3GF5A 3OS2A 2RI2A 3CCSA 4YADA 4YH4A 3CCVT 2K5IA 4F3IA 5F1LA 3CCRA 2L3RA 4PJOB 3X25B 5EWDA 4M75E 3SB2A 5JWMA 4M75C 5CKHA 4NL2A 2DXBA 3JCMg 5AYFA 2X4WA 3VV0A 2XDBA 5D3HA 2A7YA 5ENEA 2DK3A 1U1TA 2DEQA 4MR4A 1KC8C 2KVQG 2LX9A 3L2ZA 3HSBA 3DAIA 3PMTA 4A9IA 4QEUA 5FU7B 1G3YA 5LJ0A 1K9MC 4ZQLA 5EGUA 3OSVA 3JVJA 3HFOA 5J3BA 2RD1A 2RI5A 4FLPA 2XIDA 5H1TA 3E9FA 5HFQA 1JSPB 4A9JA 4QY4A 3OYCA 4XTZA 5LJ5g 5IGMA 1W2BS 5DFDA 3A8HB 2R0SA 3DWYA 2ZZDA 5CUBA 4BDYA 2YRVA 5KTWA 1WUMA 4QSVA 4J6YA 4O74A 1BI1A 5GAMh 4NR4A 1XTDA 1WUGA 5DM7R 2N9GA 3E1SA 5COIA 4C8QA 1KQSA 2K5LA 1ZQ1A 2MMPA 3RMSA 5C89A 5KO4A 2XG8D 4CUPA 5A0GA 3CBOA 4M7AF 3AQAA 3FIFA 1EIFA 4B9XA 4M78A 4JS5A 2DXTA 3L2QA 5GAN7 1M90U 4ELZC 3QDRB 5DY7A 5IGKA 2ZPIB 4NYWA 5F63A 3TU4K 5I2SA 2X4YA 4IR6A 4MEPA 2MWOA 5F5ZA 1GXIE 5BT5A 5E9IA 4M7DG 3OBYA 4NQNA 3H8ZA 3CCEA 2MJVB 4O7AA 5A5RA 4PLIA 3META 5DFCA 5DKHA 2CGHA 3PMIA 5F25A 4BW3A 2EJ9A 4LDVA 2DTIA 3C12A 5KE3A 2XDPA 1YJNA 3CC2A 3OW2A 2E64A 5GMKm 3CCUT 4Z6IA 4ZTFA 2E10A 4F7UB 4JRPA 3UV2A 5JI8A 2EKOA 4TU4A 4PY6A 4N4GA 4HXSA 2L5QA 4FT2A 3GOXA 4QVZA 4FL6A 4ZW1A 3L2RA 3JB9D 3QKJA 4NR9A 3HMEA 4L6V5 2BIVA 3FC3A 4QSXA 4ME7A 4ALHA 3QZ5B 4PL6A 4IR3A 3CBMA 4C0DC 3F70A 2L89A 4A9NA 1VQ4A 3GP8A 4IUPA 1M90C 5TCMA 2R10A 3N5BB 4OGEA 2KDSA 4RKUE 5CRZA 4O78A 3OY9A 2EYQA 4QSUA 4IUTA 5FG4A 2FYKA 4BUGA 1W4SA 3L2VA 2IVWA 3MP8A 1OZ3A 1U1SA 4B9WA 2E1HA 1N6AA 3O8VA 4Y03A 2AHJB 5EK9A 5FE4A 5CKBA 5CQ7A 5I21A 5CQ3A 4HT9A 5EG2A 4TT2A 1NPRA 2LCLA 4C92A 4XUAA 4XU2A 4NS5A 5GANh 4O77A 4Z93A 4YABA 4YYDA 1Y71A 3HFNA 5H85A 4PJOD 2RM4A 4GPJA 4CFLA 4YY4A 2A3LA 5LJ3f 4O76A 4YBTA 3OS1A 4RVRA 5A5PA 4LDUA 5FROA 4X2IA 4EMKC 4Z1QA 5CQTA 4BY6B 4M7AA 2I8NA 1Q86U 4CURA 3JCMW 2RK1A 4EMGA 5FE7A 1SSFA 4BI8B 4CUTA 4TQNA 4C8QB 4XTVA 4OUFA 4NYXA 4NUDA 2NXBA 1YBYA 1MGQA 2QTXA 4QEWA 5GAN5 4NR7A 4GLKA 2D82A 3QSUA 3UV5A 4M78B 5LJ3j 4IKFA 1K8AU 3M55A 5F62A 1FX7A 2NLUA 4J1PA 4OB2B 3X20B 3EFRA 2YELA 4A4KA 4HBWA 4C0FA 4M77F 4KT0E 3RKWA 1UGSB 2Y4YA 3SVHA 5CIUA 3OQ5A 3C95A 1M1FA 2DO3A 4A9KA 2JN0A 2E3KA 5EV9A 5E3DA 4E7IA 4RMOA 2RO0A 4KV1A 2CZ7B 5A5QA 3M9QA 4PJOC 4UIXA 4NUCA 3ME9A 3VUZA 4FM4B 2QEXT 4M7DE 4NOYA 1YITT 3OYBA 4OF1A 4JDSA 3MCAB 2L8DA 4J0RA 3LQJA 2EQMA 2M1HA 4QW2A 4NQMA 2OAUA 2RJEA 3FDRA 4NR8A 4N0AA 1VQMA 1Q86C 2GFUA 5HENA 2F6NA 5FE8A 5C87A 3URGA 5LL6S 2P4TA 1VQ7T 4BI4A 3CD6A 5FU7C 3CMAA 2OO1A 5KE2A 3CMAT 4JLGA 3L2WA 3HPWA 5HKCA 3X24B 4M75G 3QZVA 5DLOA 1VQ9T 3QIIA 1K8AC 5CQYA 4LD6A 4A9OA 2LQKA 5A0LA 2HQEA 4R56A 4YYIA 1WPYA 2QQBA 2QQ9A 2HD0A 4JRIA 5E73A 5ENJA 5HFRA 2P0KA 3PNWC 5GAN6 4J8OA 3CCQA 2HAXA 3CCQT 3I55A 4XQ3A 3KBGA 3PGGA 5KTUA 1E6IA 5H1VA 4C66A 4QVDA 3S3MA 5A85A 2YEKA 4L5GA 4C92B 4QSSA 2RHIA 5FFWA 3CMET 3J7AF 3PIOA 2LT1A 1H3ZA 5LKUA 3QZSA 4XU3A 3OYEA 4ATOA 4JS4A 4YATA 3BDLA 4YBSA 4KV4A 3ASKA 1QW1A 3OYLA 3PFSA 4HBYA 5C7NA 1QVGS 3ZYUA 3IU6A 5CUEA 5EWCA 4M7AB 3CBPA 4WHWA 3HP9A 3KUFA 1U8RA 3V7RA 1PSFA 3BFMA 2DD4A 2DTOA 1DJ7B 2ZCFB 5GAMf 3G4SA 3U5KA 4X9CA 3VUBA 3OYAA 2LT4A 2QQRA 3G71A 2FHDA 3O36A 5DYUA 5A2QE 5ETBA 3I56T 3I56A 3ZEHA 4IR5A 4A53A 3U5OA 2WP2A 4XY8A 5CQXA 3OYNA 3LQIA 2KAFA 4QR3A 3OS5A 1BI3A 4EPCA 5LJ3g 1NJIU 5E9LA 2CZ1B 4Z1SA 3G0JA 1RI0A 3RKXA 3CC7A 5FG6A 3LYIA 2XDDA 3OB9A 2E7OA 3RKYA 4C8QF 4GY5A 2VGNA 5GAMj 4QSQA 3U5NA 5LJ2A 5DW2A 1O9SA 2H3JA 5L99A 1JJ2A 2OTLT 1YJ9A 4QQDA 2K5FA 5EVAA 1KC8U 4BW4A 2HQXA 5GMKj 5EPRA 1KQ1A 3P1EA 3A5ZB 4PKCC 2DZCA 4LZSA 4TTEA 5LJ1A 5CY9A 4RG8A 4M78D 4ELYC 5DLXA 2XK0A 3LXJA 5E9MA 2GRCA 1VQ8T 4MZPA 2H60A 4FU6A 4O7BA 2R0YA 3MB4A 3VYGA 4HCBA 2YYNA 5ENBA 4XAXB 3I3JA 2GCXA 5KH6A 4A54A 4QEVA 2RHZA 3NFCA 2DIGA 1M1KU 4O7EA 2EAYA 3M56A 2F6JA 3JCMh 2RB6A 4XU1A 3JCMQ 3SWNA 3CCVA 3CXCS 1NJIC 5A5OA 1G3WA 2RS9B 1QP2A 5D24A 1S72T 2WACA 4UIZA 3K2JA 5CGPA 4BY6C 3SD4A 4J83A 4O71A 2GQVA 5G4SA 4TVRA 5AMFA 1YCYA 4C8QC 1G5VA 5CCAA 1JM4B 5ACYA 3JB9G 5DYCA 5LJ3e 5LJ5h 3JCMb 4M78C 1YJWT 3LH0A 1KHCA 3FLGA 1N27A 5HELA 3P1CA 5FE6A 1ZHIA 4HXOA 4P5NA 3GG3A 3QBYA 2LTOA 5CQ4A 5AMEA 2DATA 2RNYA 4FSXA 3CEYA 3M54A 3CPWA 5I86A 2R0VA 3LWIA 5FFVA 4C92F 3BDUA 3Q1JA 3UPUA 1M1KC 3GLXA 2VUBA 2DTHA 2M9UA 4M77B 1M8VA 3OYHA 4WHUA 2OUOA 2XKOC 4N4HA 4TYLA 4UYDA 5IBNA 4J6WA 4M75A 3P5OA 2FVUA 2L84A 3MEVA 5CFWA 3H6ZA 3CC4T 3NTIA 1N9RA 3OYJA 2DPPB 1PSEA 3OYIA 2LVMA 3S3NA 4PJOG 2QXFA 1MHNA 1VIFA 4M7AD 3JSCA 2K3YA 2E5QA 5E9VA 4A4EA 4CUUA 5HLSA 3OMCA 3LQHA 5L98A 4QSWA 2DVRA 5D6YA 4BE1A 1H641 3U5PA 3CCUA 3V8LA 4PNOA 4XK8E 1WQWA 1LOJA 2VGMA 5GMKi 4O70A 4KCXA 3OYKA 4J3IA 2YEMA 2DJZA 4XTUA 1Q7YU 5L8RE 5DBMA 4RCBA 4QYLA 4YYNA 4QSRA 5A7CA 4C92C 4IOOA 2DKWA 3TLPA 3SVFA 2CZ6B 5LJ3d 2HNIA 4KUIA 2V8IA 4DA4A 4A4HA 4BHWA 3SWNB 5DY9A 4MR3A 1X0JA 3M4YA 3HMFA 1VQOT 3M4GA 5CS8A 1I8FA 4PKLA 3UW9A 5CR2A 4QQGA 2D9TA 2ZPFB 1RL2A 5CKDA 4ZGEB 2F69A 5HK0A 4QC3A 4M7AC 1K73U 5ENIA 2LQ8A 1VQPT 1W2BA 2EQKA 2K4YA 1I4K1 4O5VA 1XOVA 2XHCA 3DKMA 5CAIA 5D3SA 3FEOA 3LWHA 4BB7A 2LCCA 3RIRA 4A4FA 4LZRA 2DZ9A 2JTFA 3JAME 2PVDB 3IU5A 3NTKA 4TU6A 5E9KA 3PT9A 3U5JA 3TEEA 3VKIA 5KHMA 1B34A 2RA2A 5C85A 2O4XA 4A9LA 4NL3A 2R58A 5GAMe 1Q7YC 1Y07A 4QSTA 4YYKA 4MMKA 4CI0C 4E7HA 3S91A 5FE0A 4KBMB 3V7CA 4IURA 3WVEB 4F7UG 2VYTA 4M7DF 2XI9A 5GMKe 3A8LB 5A5NA 4BW2A 5FE1A 4LDFA 2X4JA 2O01E 3LGFA 5AD2A 5CTLA 5CUCA 2LDMA 3V8KA 5HRVA 1D3BA 2K2VA 5CKFA 4CLBA 1WQ7A 3C4SA 4N0AC 1K73C 2JOYA 4HXRA 2DVEA 1UGPB 5CKEA 2YLCA 5CVIA 3FB9A 3QPHA 2E6NA 4ZN1A 3V8JA 4QC1A 4NRCA 4CRIA 3JVKA 4RCCA 2C06A 1YIJT 4M77D 2VXFA 3RCWA 4PJOE 4IUQA 3P1DA 5K29A 3UDCA 2WSCE 3FKMX 2QDYB 5DYXA 2KY9A 2V8JA 4IUVA 3U5LA 1HK9A 5IT9E 4TT6A 2QEXA 2OSSA 3G6ET 1YITA 5BT4A 2CZ0B 4LC2A 1FXXA 4HKEA 1QVFS 2RNXA 3A8GB 3GNGA 1BI2A 3MO8A 5IIDA 3J80E 4DONA 4YH3A 4A4GA 2FB7A 3CCMT 5D3JA 4EMKA 4KUDK 4LYWA 1NZ9A 2RJFA 5D0CA 4QNSA 2P0QA 4QR4A 4NUEA 5D7XA 1HXDA 1VQ7A 5ETDA 4A9FA 5EA1A 4NRAA 5KU3A 3P1FA 5G4RA 4IR4A 5M9OA 1VQ9A 2WP1A 1JRIA 3OBWA 4OB3B 2OTJT 2P0PA 3JVLA 1OZ2A 5GAMd 5LVRA 4C8QG 1WJRA 4MDXA 1QP3A 5LKXA 2DD5A 3UT1A 5KCOA 3LW5E 1N72A 3OYYA 2F5TX 4M78G 1XQHA 2EJGA 4M77C 3LLRA 3HKSA 1BIBA 2KK4A 4OMFB 4JRQA 1G3SA 1Q82U 4O72A 3RESA 2MI6A 3P8HA 2QQSA 3OYFA 4VUBA 1X75C 2QA4T 1UGQB 2ZPBB 3JCMV 3DB4A 3CMEA 5EU1A 3UVWA 4M7DA 2IG0A 3E9GA 5FE5A 1KHIA 5DKCA 3JCMP 4V2SA 4YYHA 4MR5A 5ENCA 5F61A 3GNFB 5CQ8A 4LZ2A 3S92A 1M5Q1 4BW1A 3AHUA 1Y96A 2E6ZA 5EISA 5D3RA 5I40A 5CQ6A 3QJYA 1ZBXA 2ZPGB 2D0QB 5II1A 5C4QA 2YLBA 4UIVA 5GAN3 1YI2T 2RJCA 4HXMA 5LJ5j 5EPSA 1D3BB 5LJ3h 4TZ2A 1KQ2A 3QG1A 5F60A 4BD3A 3SDZA 4F7UE 2DVSA 2JUFA 5CUDA 3S6WA 4A9EA 3JRZA 4PS5A 4QSPA 4MEOA 1VUBA 5ENGA 3M58A 4UYHA 5A81A 1BI0A 2BKDN 4YYGA 2MWPA 3MUKA 2DIQA 1Q82C 3JCMc 1Y7XA 3MP1A 2PVOB 4Q5WA 4CL9A 4J5YA 3SWNC 4ZTJA 2EFIA 3QXEB 4WF2A 1EQFA 4HA8A 3O35A 5HY6A 4Q0NA 4M75F 1LJOA 3TCJA 2OTLA 3PTAA 1VQKT 4MMLA 4HXPA 5EM3A 4C8QD 5II2A 5FLXE 5A0DA 1I5LA 2DXCA 1R8OB 2RHUA 2BUDA 4C92G 3QYHB 4MZTA 2K3XA 4NYVA 1JBMA 1BKBA 4FIBA 2D9EA 1VQ8A 4N3WA 3OMGA 2LRQA 1KQSS 5F1HA 5IGLA 1G3TA 5D26A 3P8BB 5GAOn 1YHQT 5IAYA 4PLLA 1VIEA 3OS0A 3MB3A 3NXBA 5H1UA 3MXFA 4MR6A 1X6OA 4M7AG 4PCIA 3MHXA 4WIVA 4O75A 5DKDA 2MF2A 1ZS5A 1VQLT 2JNGA 2DAQA 4Z02A 5HQ6A 4O7FA 4LYSA 4UIYA 4N4FA 3O33A 4OGJA 2L5EA 4XUBA 2JTMA 5F3AA 1I81A 1S72A 4OGIA 2DVVA 3BW1A 3CCST 1F68A 5LKZA 1QVGA 4E47A 5EWHA 3HHTB 5I88A 4C8QE 3OW2S 5GAN2 1IREB 3CCRT 5CO7A 4ZGJB 2RI7A 4QUUA 4LRGA 5HJCA 2F5KA 4QBMA 5EQ1A 4M78E 3O37A 3M59A 4M7DB 1YJWA 3GIBA 5D6XA 5GANf 4E7JA 5J39A 2VC8A 4J7FA 5BT3A 1Y96B 2G4AA 5E74A 5D6WA 5FRMA 5L8UA 3KXTA 5FE3A 3E19A 4LR6A 1VQ5T 1VQ5A 4BE2A 1WGSA 2D6FA 4UYEA 3UWNA 5TB6A 5L96A 5HQ7A 5CZGA 1UGRB 2YDWA 4QQ6A 5DX4A 1N9SA 2DVQA 4X9DA 5D3TA 1KD1U 4HBXA 2M0OA 4QUTA 2WSEE 5L97A 5GANj 4C92D 4JLIA 5ENHA 4QB3A 1V29B 4II1A 4NXJA 2B8AA 3TREA 4TZ8A 2YQDA 2VXEA 2K57A 3P8DA 3U5MA 4QZSA 5FDZA 1WNLA 4CUQA 3CC4A 4XTXA 5CQAA 1WJSA 3Q2FA 2RHYA 4XU0A 4CFKA 5D25A 5GMKh 4LD9K 3FJPA 5FU6B 1M1GA 2Y90A 3RUXA 5GAOl 3RERA 5HRXA 5GAMg 2LC4A 5I7YA 2Y4XA 3L1AA 4A9MA 5HCLA 2FSAA 2E7NA 4PCEA 3A8MB 2RH2A 4MDWA 2EQUA 1AHJB 5IN1A 3CXCA 2LSPB 4YYJA 3BY7A 3SFMA 5I1QA 3CCET 4LDXA 3T9NA 2RK2A 2GF7A 2E41A 2V8KA 3JCMe 3QJ6A 2I2LA 3CCJA 2RHXA 4C92E 3CCJT 3MULA 1YJNT 1KD1C 3CC2T 4HCCA 1TH7A 2CS7A 5J26A 3HL8A 3MEUA 3JB9F 4UYFA 4C5IA 4YYMA 3M5AA 3OYDA 4BACA 5FG5A 3LX7A 3FRNA 4UITA 1FWZA 4YY6A 2RJDA 3QZ9B 1VQOA 4M77G 3UVYA 5CPEA 4JJNK 4HCZA 4Q0OA 4M7AE 3DB3A 5D3LA 3QUIA 5A83A 5LJ5e 3JCMX 4ZC9A 4D6WA 1VQPA 4HT8A 3CPFA 1X01A 5E9YA 5EI4A 4CUSA 1VQ4T 4FT4A 4AKNA 4LDYA 4IUUA 5FH6A 4YC9A 3OSSC 3ER0A 4NRBA 3OYMA 5KCHA 3VJPA 4QYDA 2WSFE 2RI3A 4Y28E 3EFSA 5GAN4 4PJOF 4OB1B 3LJWA 3QYGB 2DXUA 3D7CA 5FH8A 3C94A 4MEQA 4XYAA 2JZ2A 1VQNA 2PUKB 1VQNT 5DW1A 2EIFA 2G3RA 1M4ZA 3SVGA 2PUOB 5F36A 4M7DD 4NR5A 3JB9I 4HXKA 4HXNA 3UV4A 3JVMA 3PIPA 5KTXA 2I7KA 5GANg 4L59A 3R6OA 3G0LA 5FB1A 3WXMB 4M75B 5HM0A 3GPLA 5GAOr 4YAXA 3RMQA 3JCMd 5E3GA 4YBMA 4R55A 3V7SA 4QR5A 5EWWA 3A8OB 3DLLA 4DOVA 4PTBA 1WJQA 4O6JA 2R5AA 1JB0E 4C0GA 2XD0A 5HRWA 1YIJA 2L85A 5DYAA 2YHTA 4RG2A 5I89A 3X26B 4OB0B 5D3PA 3G6EA 5CQ5A 2CKKA 4X34A 4IOQA 5FBXA 4UIWA 4NR6A 5HQ5A 5C6SA 4J7IA 5LJ5d 3O34A 3M53A 1O75A 5GAOp 5A82A 4YTLA 3UVDA 2EQJA 5IGNA 3X28B 4OGCA 5FFYA 3CCMA 3QZTA 4J6XA 5CUGA 1OYXA 4EMHA 4UYFB 5FB0A 4BE0A 2DWWA 4BJXA 2R57A 3WVDB 4M7DC 5C0MA 5FH7A 2YW5A 5I29A 3QO3A 5A5SA 2XU8A 2R5MA 4IORA 4OP0A 3EAEA 1VQMT 3JCMf 3MEWA 5EPBA 4JUVA 1OI1A 5I80A 2OTJA 5EP7A 5HEMA 2DKGA 5CU8A 5I2MA 3AADA 3JCMJ 3INZA 3CD6T 2GFAA 1JJ2S 3J81E 1XNIA 3HRSA 4M77E 2M16A 4F7UF 2LNVA 3HRTA 4TS8A 5GANe 4UYGA 4HBVA 5D3NA 4XY9A 3M57A 2KMTA 4O7CA 4JRKA 2X35A 4PJOA 2QA4A 5ENFA 3ZBDA 5LJ5f 4J0SA 5F2PA 2E65A 2ZPHB 1B34B 1Q81U 2O4XB 1IZ6A 5I83A 2RO1A 5E0RA 3LGLA 1NE8A 1UB4A 4LDWA 4DQ2A 3I55T 5GMKl 1BYMA 4ALGA 5HK3A 3VU3C 5CK9A 5E7DA 5GAOm 5FRNA 1LNXA 4ZN3A 3JB9H 2MAMA 5I7XA 5FU6C 2KSSA 4BDZA 5AD3A 4XTYA 5CUAA 1YI2A 2PQWA 2E70A 1M9SA 3VYHB 4C0DB 4A9HA 1N8RU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C67 A;  2RI7 A;  3DLM A;  4YYN A;  4QSR A;  5A7C A;  4QUU A;  4IOO A;  4LRG A;  5HJC A;  2DKW A;  2F5K A;  4QBM A;  5EQ1 A;  3SVF A;  3TLP A;  4OVA A;  3HMH A;  3SVH A;  5CIU A;  3O37 A;  3Q2E A;  3MQM A;  3OQ5 A;  3UVX A;  4A4H A;  4C5G A;  5D6X A;  4LYI A;  4BHW A;  4A9K A;  4MR3 A;  1X0J A;  4Z6H A;  2E3K A;  5EV9 A;  4E7J A;  5J39 A;  5E3D A;  4E7I A;  2RO0 A;  3HMF A;  4KV1 A;  4UC4 A;  3S3O A;  5CS8 A;  5A5Q A;  3MP6 A;  3M9Q A;  5FE9 A;  5BT3 A;  4PKL A;  3UW9 A;  4UIX A;  4QQG A;  2D9T A;  4NUC A;  3ME9 A;  2G4A A;  3OYB A;  5E74 A;  3OA6 A;  2L8D A;  4J0R A;  4QC3 A;  5D6W A;  2RNW A;  3LQJ A;  2EQM A;  5L8U A;  2M1H A;  5FRM A;  5FE3 A;  4QW2 A;  4LR6 A;  5C8G A;  4NQM A;  5LKT A;  5ENI A;  2RFJ A;  4TT4 A;  5LVQ A;  2EQK A;  5EWV A;  4BE2 A;  1WGS A;  4UYE A;  2X4X A;  5TB6 A;  3NTH A;  2RJE A;  5L96 A;  3FDR A;  3UWN A;  5D3S A;  4NR8 A;  5HQ7 A;  4HXL A;  3FEO A;  4N4I A;  5CZG A;  2YDW A;  4QQ6 A;  5DX4 A;  2GFU A;  5HEN A;  2DVQ A;  2F6N A;  5FE8 A;  2LCC A;  5C87 A;  4A4F A;  5D3T A;  4HBX A;  2M0O A;  4QUT A;  5DLZ A;  5IG6 A;  4LZR A;  5L97 A;  2JTF A;  5FE2 A;  5LUU A;  3ONI A;  5ENH A;  4QB3 A;  2OO1 A;  5KE2 A;  4II1 A;  4NXJ A;  3IU5 A;  3NTK A;  4TU6 A;  2B8A A;  5E9K A;  4YK0 A;  3U5J A;  3L2W A;  5KHM A;  4TZ8 A;  5L8T A;  2YQD A;  3P8D A;  3OYG A;  5EIC A;  3QZV A;  3U5M A;  5C85 A;  4QZS A;  2O4X A;  3QII A;  5FDZ A;  5CRM A;  4A9L A;  4CUQ A;  4LD6 A;  4MEN A;  4A9O A;  5CQA A;  2R58 A;  4E7K A;  1WJS A;  3L42 A;  3Q2F A;  4EDU A;  3MEA A;  4QST A;  4YYK A;  2RHY A;  4E7H A;  3S91 A;  5FE0 A;  2HQE A;  4E7L A;  4IUR A;  4CFK A;  5D25 A;  4YYI A;  2VYT A;  4UIU A;  3L2U A;  4C5H A;  5HRX A;  4E96 A;  5E73 A;  5ENJ A;  5HFR A;  2P0K A;  5I7Y A;  3PNW C;  5A5N A;  2KTB B;  4BW2 A;  5DFB A;  5FE1 A;  4A9M A;  4LDF A;  5HCL A;  5KTU A;  3LGF A;  4C5E A;  1E6I A;  2FSA A;  5H1V A;  5CTL A;  5CUC A;  4C66 A;  5AD2 A;  2E7N A;  4PCE A;  3S3M A;  2LDM A;  5HRV A;  5A85 A;  2YEK A;  4CLB A;  4QSS A;  2EQU A;  2RHI A;  5IN1 A;  3C4S A;  2LSP B;  5FFW A;  5J0D A;  4YYJ A;  5CP5 A;  3OS2 A;  2RI2 A;  4HXR A;  1H3Z A;  5I1Q A;  4YAD A;  5LKU A;  4YH4 A;  2GF7 A;  3QZS A;  3OYE A;  3QJ6 A;  4YAT A;  4F3I A;  5F1L A;  3BDL A;  4YBS A;  4KV4 A;  3ASK A;  2RHX A;  2L3R A;  3OYL A;  2E6N A;  3PFS A;  5EWD A;  3MUL A;  4HBY A;  5C7N A;  3ZYU A;  5J26 A;  4QC1 A;  4NRC A;  3MEU A;  3IU6 A;  4UYF A;  4C5I A;  5CUE A;  4YYM A;  5JWM A;  5EWC A;  4CRI A;  3OYD A;  4BAC A;  4WHW A;  3JVK A;  2X4W A;  5FG5 A;  3KUF A;  5D3H A;  3LX7 A;  4UIT A;  5ENE A;  3RCW A;  4IUQ A;  3P1D A;  4YY6 A;  2RJD A;  5K29 A;  4MR4 A;  3FKM X;  3UVY A;  5DYX A;  5CPE A;  3U5K A;  4IUV A;  3OYA A;  3U5L A;  4TT6 A;  4HCZ A;  4Q0O A;  2OSS A;  3DB3 A;  5BT4 A;  5D3L A;  2QQR A;  4LC2 A;  3DAI A;  3O36 A;  2FHD A;  3PMT A;  5A83 A;  5DYU A;  4A9I A;  5ETB A;  4QEU A;  3ZEH A;  2RNX A;  4IR5 A;  3U5O A;  5LJ0 A;  2WP2 A;  4XY8 A;  4ZC9 A;  4ZQL A;  5EGU A;  3OYN A;  3JVJ A;  3MO8 A;  3LQI A;  5IID A;  4DON A;  4QR3 A;  4YH3 A;  4A4G A;  2RI5 A;  5D3J A;  4FLP A;  5E9Y A;  5EI4 A;  5E9L A;  5H1T A;  4CUS A;  4LYW A;  4Z1S A;  3E9F A;  3G0J A;  1RI0 A;  5HFQ A;  1JSP B;  4A9J A;  4QY4 A;  2RJF A;  5FG6 A;  5D0C A;  4QNS A;  3OYC A;  4QR4 A;  5IGM A;  3LYI A;  4AKN A;  4NUE A;  5D7X A;  5DFD A;  3OB9 A;  2E7O A;  4IUU A;  2R0S A;  5FH6 A;  3DWY A;  4YC9 A;  5ETD A;  4A9F A;  5EA1 A;  4GY5 A;  5CUB A;  4QSQ A;  4BDY A;  4NRB A;  3OYM A;  2YRV A;  4NRA A;  5KTW A;  5KU3 A;  3U5N A;  1WUM A;  4QSV A;  5LJ2 A;  3P1F A;  5DW2 A;  5G4R A;  5KCH A;  5L99 A;  4IR4 A;  5M9O A;  4O74 A;  2WP1 A;  4QQD A;  5EVA A;  4QYD A;  2RI3 A;  4NR4 A;  4BW4 A;  2HQX A;  1WUG A;  2N9G A;  5EPR A;  3JVL A;  3P1E A;  1OZ2 A;  5LVR A;  1WJR A;  5COI A;  4LZS A;  5LKX A;  3UT1 A;  4TTE A;  3LJW A;  5LJ1 A;  5CY9 A;  3D7C A;  5FH8 A;  5C89 A;  5KO4 A;  5KCO A;  4CUP A;  5DLX A;  4MEQ A;  1N72 A;  2XK0 A;  3AQA A;  3LXJ A;  5E9M A;  4XYA A;  2GRC A;  3LLR A;  4B9X A;  2JZ2 A;  2H60 A;  3L2Q A;  4FU6 A;  4O7B A;  5DW1 A;  2G3R A;  2R0Y A;  3MB4 A;  4O72 A;  3SVG A;  2YYN A;  5DY7 A;  5IGK A;  4NYW A;  5ENB A;  5F63 A;  3P8H A;  2QQS A;  3I3J A;  3OYF A;  5F36 A;  4NR5 A;  2X4Y A;  5KH6 A;  4HXK A;  4HXN A;  3UV4 A;  3JVM A;  4QEV A;  4IR6 A;  2RHZ A;  4MEP A;  5KTX A;  5F5Z A;  2I7K A;  2MWO A;  5BT5 A;  4L59 A;  5E9I A;  2DIG A;  3G0L A;  3DB4 A;  5FB1 A;  5EU1 A;  3UVW A;  2IG0 A;  3E9G A;  4NQN A;  4O7E A;  5FE5 A;  5HM0 A;  3H8Z A;  2F6J A;  5DKC A;  2MJV B;  4O7A A;  5A5R A;  4PLI A;  4YAX A;  3MET A;  5DFC A;  5DKH A;  5E3G A;  4YBM A;  4YYH A;  3PMI A;  4MR5 A;  4QR5 A;  5EWW A;  5F25 A;  5ENC A;  4BW3 A;  5F61 A;  5CQ8 A;  4LZ2 A;  3S92 A;  5KE3 A;  2XDP A;  4BW1 A;  5A5O A;  2RS9 B;  4PTB A;  1WJQ A;  5EIS A;  5D24 A;  5D3R A;  5I40 A;  2R5A A;  4UIZ A;  5CQ6 A;  2WAC A;  3K2J A;  5CGP A;  4Z6I A;  4ZTF A;  3SD4 A;  5II1 A;  4O71 A;  5HRW A;  3UV2 A;  5C4Q A;  5JI8 A;  2EKO A;  4TU4 A;  4UIV A;  5G4S A;  4PY6 A;  2L85 A;  5AMF A;  4N4G A;  4HXS A;  5DYA A;  2RJC A;  4HXM A;  4RG2 A;  5I89 A;  3GOX A;  4QVZ A;  1G5V A;  4FL6 A;  4ZW1 A;  3L2R A;  1JM4 B;  3QKJ A;  5EPS A;  4TZ2 A;  5D3P A;  4NR9 A;  5ACY A;  3HME A;  5F60 A;  4BD3 A;  5DYC A;  5CQ5 A;  2CKK A;  2BIV A;  4X34 A;  4IOQ A;  3FC3 A;  4QSX A;  2DVS A;  5FBX A;  4ALH A;  4UIW A;  4NR6 A;  5HQ5 A;  5CUD A;  1KHC A;  3LH0 A;  3FLG A;  3O34 A;  5C6S A;  1N27 A;  3S6W A;  5HEL A;  4PL6 A;  3P1C A;  4IR3 A;  5FE6 A;  4A9E A;  4PS5 A;  5A82 A;  4HXO A;  4QSP A;  3UVD A;  2EQJ A;  5IGN A;  4MEO A;  3F70 A;  5ENG A;  5FFY A;  2L89 A;  3GG3 A;  3QBY A;  4UYH A;  5A81 A;  2BKD N;  4A9N A;  2LTO A;  3QZT A;  5CQ4 A;  4YYG A;  4IUP A;  2MWP A;  3MUK A;  5TCM A;  5CUG A;  2R10 A;  2DIQ A;  1OYX A;  5AME A;  4UYF B;  5FB0 A;  4BE0 A;  2DWW A;  4BJX A;  2R57 A;  3MP1 A;  2DAT A;  2RNY A;  5CRZ A;  3CEY A;  5C0M A;  4Q5W A;  4CL9 A;  5I86 A;  5FH7 A;  2YW5 A;  2R0V A;  4ZTJ A;  5I29 A;  4O78 A;  2EFI A;  3OY9 A;  5FFV A;  4QSU A;  5A5S A;  3Q1J A;  4IUT A;  1EQF A;  2R5M A;  4IOR A;  3O35 A;  5FG4 A;  4Q0N A;  3EAE A;  3MEW A;  3L2V A;  4HXP A;  5EPB A;  5EM3 A;  3MP8 A;  1OI1 A;  1OZ3 A;  5I80 A;  4B9W A;  5II2 A;  5EP7 A;  5HEM A;  5CU8 A;  4Y03 A;  3O8V A;  3OYH A;  4WHU A;  2OUO A;  5EK9 A;  5FE4 A;  3AAD A;  5CQ7 A;  2RHU A;  2GFA A;  5CQ3 A;  4N4H A;  4TYL A;  4UYD A;  1XNI A;  5IBN A;  4TT2 A;  2BUD A;  2K3X A;  4XUA A;  4NS5 A;  4NYV A;  2M16 A;  4O77 A;  4Z93 A;  4YAB A;  4YYD A;  3P5O A;  2L84 A;  2D9E A;  4TS8 A;  4N3W A;  3OMG A;  4UYG A;  2LRQ A;  3MEV A;  5H85 A;  4HBV A;  5F1H A;  5CFW A;  3H6Z A;  5D3N A;  5IGL A;  3NTI A;  4XY9 A;  3OYJ A;  5D26 A;  4GPJ A;  4CFL A;  4O7C A;  4YY4 A;  3OYI A;  2LVM A;  3S3N A;  5IAY A;  4PLL A;  4O76 A;  2X35 A;  4YBT A;  1MHN A;  3OS1 A;  3OS0 A;  5ENF A;  3MB3 A;  3NXB A;  4RVR A;  2K3Y A;  5H1U A;  3MXF A;  2E5Q A;  4J0S A;  5E9V A;  5F2P A;  5A5P A;  4X2I A;  5FRO A;  4MR6 A;  4A4E A;  4Z1Q A;  5CQT A;  4CUU A;  5HLS A;  3OMC A;  3LQH A;  2O4X B;  4PCI A;  5I83 A;  2RO1 A;  5L98 A;  2I8N A;  5E0R A;  4CUR A;  3LGL A;  4QSW A;  4WIV A;  4O75 A;  5DKD A;  2DVR A;  4ALG A;  5FE7 A;  1SSF A;  1ZS5 A;  2DAQ A;  4CUT A;  4Z02 A;  5D6Y A;  5HQ6 A;  4BE1 A;  4TQN A;  4O7F A;  4LYS A;  4UIY A;  4N4F A;  3O33 A;  4OGJ A;  4OUF A;  5E7D A;  5FRN A;  4NYX A;  4NUD A;  2L5E A;  2NXB A;  4XUB A;  5F3A A;  5I7X A;  3U5P A;  4QEW A;  4NR7 A;  4OGI A;  4BDZ A;  2DVV A;  2D82 A;  3UV5 A;  4IKF A;  1F68 A;  4O70 A;  5LKZ A;  5F62 A;  4KCX A;  5EWH A;  5AD3 A;  3OYK A;  5I88 A;  5CUA A;  4J3I A;  4J1P A;  2NLU A;  2PQW A;  2YEM A;  2YEL A;  4A9H A;  5DBM A;  4HBW A;  4QYL A; 
#chains in the Genus database with same CATH topology
 4C67 A;  1UEB A;  3DLM A;  4KUL A;  4OVA A;  4AG2 C;  2E12 A;  2KT1 A;  3HMH A;  3Q2E A;  3MQM A;  3UVX A;  1BIA A;  2O9S A;  2EJF A;  2DL4 A;  2XIC A;  3QHS A;  4C5G A;  4LYI A;  3I5R A;  2KE9 A;  4Z6H A;  2QI2 A;  4UC4 A;  3S3O A;  1WHG A;  1QVF A;  4LUE A;  3MP6 A;  5FE9 A;  5GAN 8;  3G4S T;  2F2V A;  4Y91 A;  1YCS B;  4M77 A;  2KRN A;  4BI3 A;  3PE0 A;  3R6N A;  3CCE Q;  2PVG B;  3OA6 A;  3G71 T;  2VB6 A;  3JB9 J;  2RNW A;  1JQQ A;  2KQW A;  3ZFJ A;  5C8G A;  2PU9 B;  5LKT A;  4DBQ A;  5KYX B;  2NUZ A;  2RFJ A;  4TT4 A;  5LVQ A;  5EWV A;  3CCJ Q;  1OU8 A;  1QKW A;  1K76 A;  2X4X A;  3NTH A;  4C0Z A;  2VV5 A;  1QMC A;  1YJN Q;  2J6O A;  1Q81 C;  4HXL A;  3CC2 Q;  4N4I A;  1VQK A;  4AMC A;  2FL7 A;  1AEY A;  5DLQ E;  3CPW S;  3G7Z A;  3CC7 T;  3CCL A;  3CCL T;  5DLZ A;  5IG6 A;  4OMM A;  2CYZ B;  5FE2 A;  1R0B G;  1PHT A;  5LUU A;  5KYU A;  3ONI A;  2X3X D;  4M75 D;  1KFZ A;  1VQO Q;  3EFO B;  2ZGW A;  4KRT A;  4YK0 A;  2JVV A;  5L8T A;  1QVP A;  3I5S A;  5KYY B;  1VQ6 T;  3OYG A;  1VQ6 A;  4DOW A;  5EIC A;  4EMK B;  2CP2 A;  1YJ9 T;  4M78 F;  5GAN d;  5CRM A;  2K79 A;  4ZGD B;  4MEN A;  1QKX A;  1P92 A;  4E7K A;  4KGZ B;  1YHQ A;  2EWN A;  3L42 A;  4EDU A;  3MEA A;  4MZM A;  2OI3 A;  4QVC A;  1N8R C;  2JJ9 A;  2HBP A;  4E7L A;  3HRU A;  1K9M U;  1PUO A;  1VQ4 Q;  2ZPE B;  3LH5 A;  2A37 A;  1F1B B;  1HJD A;  4UIU A;  3L2U A;  1WXT A;  4C5H A;  1NPP A;  4E96 A;  4F7U A;  5GAO q;  3CQT A;  1KG1 A;  2KTB B;  5DFB A;  2EGE A;  2JMC A;  1VQL A;  2QQA A;  1B07 A;  4C5E A;  4XTW A;  2ROL A;  3EGX A;  2AKL A;  2HSE B;  1M3B A;  2XMF A;  5J0D A;  5CP5 A;  3GF5 A;  1PRM C;  3OS2 A;  2RI2 A;  4F14 A;  2M02 A;  3CCS A;  4YAD A;  4YH4 A;  1OX9 A;  2RN8 A;  2COY A;  2J6K A;  3CCV T;  2K5I A;  4F3I A;  5F1L A;  4OMP A;  3CCR A;  2L3R A;  4PJO B;  3X25 B;  1WXB A;  1SRM A;  5EWD A;  4M75 E;  3SB2 A;  3EHR A;  5JWM A;  4M75 C;  1PC0 A;  1VQN Q;  5CKH A;  4NL2 A;  2DXB A;  3JCM g;  1IGQ A;  2X4W A;  5AYF A;  3VV0 A;  2XDB A;  5D3H A;  1LPL A;  2A7Y A;  1K8A R;  1D09 B;  5IXB A;  5ENE A;  1QLY A;  1GCQ C;  2DK3 A;  3VS2 A;  1U1T A;  2DEQ A;  4MR4 A;  4HVV A;  1KC8 C;  3ERR A;  1MMA A;  2KVQ G;  1AWO A;  1SHG A;  2LX9 A;  2X3W D;  3L2Z A;  1ZSZ C;  3HSB A;  3DAI A;  3PMT A;  4A9I A;  4QEU A;  5FU7 B;  1WHK A;  1G3Y A;  4M4Z A;  5LJ0 A;  4JJB A;  1K9M C;  4ZQL A;  5EGU A;  1TU0 B;  3OSV A;  3JVJ A;  3HFO A;  5J3B A;  2RD1 A;  2NYS A;  2RI5 A;  4FLP A;  2XID A;  8AT1 B;  5H1T A;  3E9F A;  1K9A A;  5HFQ A;  1JSP B;  4A9J A;  4QY4 A;  3OYC A;  1D1A A;  4XTZ A;  5LJ5 g;  5IGM A;  1W2B S;  5DFD A;  2JW4 A;  3A8H B;  2R0S A;  4AG1 C;  3DWY A;  1TSF A;  4DBH A;  2ZZD A;  5CUB A;  1SRL A;  4HVW A;  2HQH A;  4BDY A;  2YRV A;  5KTW A;  1WUM A;  2GBQ A;  4QSV A;  1PKS A;  2Z0W A;  4J6Y A;  4O74 A;  4LE9 A;  1BI1 A;  2ZAE A;  5GAM h;  2L3Q A;  4NR4 A;  1XTD A;  1WUG A;  5DM7 R;  2N9G A;  3E1S A;  3EG0 A;  5COI A;  1PD0 A;  4C8Q A;  1KQS A;  2LP5 A;  2K5L A;  1ZQ1 A;  2MMP A;  1I0C A;  3RMS A;  3RBB B;  5C89 A;  5KO4 A;  2XG8 D;  4CUP A;  4AT1 B;  5A0G A;  3CBO A;  4M7A F;  3AQA A;  3FIF A;  4JJC A;  1EIF A;  4B9X A;  4M78 A;  4JS5 A;  1QCN A;  2DXT A;  3L2Q A;  5GAN 7;  2D0N A;  2CH4 A;  3M0R A;  1M90 U;  4ELZ C;  3QDR B;  5DY7 A;  5IGK A;  2ZPI B;  4NYW A;  5F63 A;  3TU4 K;  5I2S A;  2X4Y A;  2EYZ A;  1YFN A;  2FZG B;  1VQM Q;  1RAB B;  4IR6 A;  4MEP A;  2MWO A;  5F5Z A;  1GXI E;  5GJW B;  5BT5 A;  3MJX A;  5E9I A;  2J06 A;  4M7D G;  3OBY A;  4NQN A;  1JU5 C;  3H8Z A;  4HVU A;  4D8D A;  3CCE A;  2MJV B;  4O7A A;  5A5R A;  1QWF A;  2DJQ A;  3MET A;  2ESW A;  4PLI A;  3CD6 Q;  5DFC A;  5DKH A;  2LX7 A;  2KRM A;  2CGH A;  3PMI A;  2K3B A;  5F25 A;  4BW3 A;  2EJ9 A;  4LDV A;  2DTI A;  1UUE A;  3C12 A;  5KE3 A;  2XDP A;  1JJ2 P;  3VRY A;  4IIO A;  1YJN A;  3CC2 A;  3OW2 A;  2EW3 A;  2E64 A;  3FJ5 A;  5GMK m;  3CCU T;  1V76 A;  4Z6I A;  3G1J A;  4ZTF A;  1VYT A;  2E10 A;  4F7U B;  4JRP A;  3UV2 A;  5JI8 A;  2VWF A;  2EKO A;  1KJW A;  4TU4 A;  4PY6 A;  4N4G A;  4HXS A;  2L5Q A;  4FT2 A;  3GOX A;  4QVZ A;  4FL6 A;  4ZW1 A;  3L2R A;  3JB9 D;  3QKJ A;  3EGX B;  4NR9 A;  3HME A;  4L6V 5;  1NEG A;  2BIV A;  3FC3 A;  4QSX A;  3I55 Q;  4ME7 A;  4ALH A;  4RUG A;  3QZ5 B;  4PL6 A;  4IR3 A;  1K0S A;  3CBM A;  4C0D C;  3F70 A;  1M27 C;  2L89 A;  2KRS A;  2QK0 A;  4A9N A;  1VQ4 A;  2GTO A;  5IHK A;  1GL5 A;  3GP8 A;  4ZNX A;  4IUP A;  1AZE A;  1M90 C;  5TCM A;  2R10 A;  2FZC B;  3UF4 A;  3N5B B;  4OGE A;  2KDS A;  2MYS A;  4RKU E;  5CRZ A;  1MND A;  1UDL A;  1FYN A;  4O78 A;  3OY9 A;  2EYQ A;  1AWW A;  4FYX B;  4QSU A;  4K11 A;  3PVQ A;  1WZO A;  4IUT A;  5FG4 A;  1BU1 A;  2FYK A;  4BUG A;  1W4S A;  3L2V A;  2IVW A;  3MP8 A;  1NJI R;  1WI7 A;  1OZ3 A;  1U1S A;  2JT4 A;  3EGU A;  2E1H A;  1SF9 A;  4B9W A;  4DEX A;  1N6A A;  1SG5 A;  4Y03 A;  3O8V A;  2IPO B;  2AHJ B;  5EK9 A;  5FE4 A;  5CKB A;  5CQ7 A;  5IHI A;  5I21 A;  3HTR A;  5CQ3 A;  4A63 B;  4HT9 A;  5EG2 A;  4TT2 A;  1NPR A;  2LCL A;  3G4S Q;  4C92 A;  5KYW A;  4XUA A;  4XU2 A;  4NS5 A;  5GAN h;  4O77 A;  4Z93 A;  4YAB A;  4YYD A;  2CT4 A;  3G71 Q;  1Y71 A;  3HFN A;  2NUP B;  2OJ2 A;  5H85 A;  4PJO D;  2AT1 B;  2RM4 A;  1KC8 R;  4GPJ A;  4CFL A;  2X9H A;  4YY4 A;  1PWT A;  2A3L A;  5LJ3 f;  4O76 A;  4YBT A;  2H3E B;  5L23 A;  3OS1 A;  4RVR A;  1M2V A;  5A5P A;  4LDU A;  5FRO A;  1U06 A;  4X2I A;  2NUT A;  4E2F B;  2JTE A;  1K9M R;  2QYZ A;  4Z1Q A;  4EMK C;  5CQT A;  3CCL Q;  4BY6 B;  4AFQ C;  4M7A A;  2I8N A;  1Q86 U;  4CUR A;  3JCM W;  2RK1 A;  1CSK A;  4EMG A;  5FE7 A;  1SSF A;  1WXU A;  4BI8 B;  1NYF A;  1SHF A;  4CUT A;  3NPF A;  4F17 A;  4TQN A;  5FWC A;  3GBQ A;  4C8Q B;  4XTV A;  1BCO A;  1OV3 A;  4OUF A;  1VQ6 Q;  4NYX A;  4NUD A;  2NXB A;  1YBY A;  3A98 A;  1EFN A;  1YJ9 Q;  2HBW A;  1MGQ A;  2QTX A;  4QEW A;  5GAN 5;  4NR7 A;  2E3I A;  3VS0 A;  1M1K R;  4GLK A;  2D82 A;  3QSU A;  3UV5 A;  4M78 B;  5LJ3 j;  4IKF A;  1K8A U;  3M55 A;  5F62 A;  2KGT A;  1FX7 A;  1HD3 A;  2NLU A;  4J1P A;  4OB2 B;  4OML A;  3X20 B;  3EFR A;  2YEL A;  4A4K A;  1PG5 B;  4HBW A;  4C0F A;  4M77 F;  4KT0 E;  2JM9 A;  3RKW A;  1UGS B;  2Y4Y A;  3SVH A;  5CIU A;  3OQ5 A;  3C95 A;  1M1F A;  2FRY A;  8ATC B;  2F2X A;  3QWX X;  2DO3 A;  1C1A A;  4A9K A;  2JN0 A;  2E3K A;  5EV9 A;  5E3D A;  4E7I A;  4RMO A;  2RO0 A;  4KV1 A;  1WHJ A;  2CZ7 B;  3EG9 A;  5A5Q A;  3M9Q A;  1W70 A;  4PJO C;  4UIX A;  4NUC A;  3ME9 A;  3VUZ A;  4FM4 B;  2MIO A;  2QEX T;  4M7D E;  4NOY A;  1YIT T;  3RNJ A;  3OYB A;  4OF1 A;  4JDS A;  3MCA B;  1BK2 A;  2L8D A;  4J0R A;  2FO0 A;  3LQJ A;  2EQM A;  2M1H A;  3CCV Q;  4QW2 A;  4NQM A;  2KEA A;  1GFC A;  2OAU A;  2CP5 A;  2RJE A;  3FDR A;  4Y92 A;  4NR8 A;  3OW2 P;  4N0A A;  1VQM A;  1Q86 C;  2GFU A;  5HEN A;  2F6N A;  5FE8 A;  5C87 A;  3URG A;  5GJV B;  2HL3 A;  5LL6 S;  1ZUY A;  2P4T A;  1VQ7 T;  5ECA A;  4BI4 A;  3CD6 A;  5FU7 C;  3CMA A;  2OO1 A;  5KE2 A;  3CMA T;  4JLG A;  3EGD B;  3L2W A;  3HPW A;  5HKC A;  2YDL A;  4LXC A;  3X24 B;  4M75 G;  3QZV A;  5DLO A;  1VQ9 T;  3QII A;  1K8A C;  2KXC A;  2EBP A;  5CQY A;  4LD6 A;  4A9O A;  2YRD A;  2LQK A;  5A0L A;  2HQE A;  4R56 A;  1G2B A;  4YYI A;  2ED0 A;  1WPY A;  2QQB A;  4J9C A;  2COW A;  2QQ9 A;  2HD0 A;  2PTK A;  4DEY A;  4JRI A;  5E73 A;  5ENJ A;  5HFR A;  2P0K A;  3PNW C;  5GAN 6;  1WLP B;  4J8O A;  3CCQ A;  2YUO A;  1D1C A;  3CCQ T;  2HAX A;  3I55 A;  4XQ3 A;  3KBG A;  3PGG A;  3M0T A;  2O88 A;  1W2B P;  1AOJ A;  1M90 R;  5KTU A;  3NGP A;  1E6I A;  5H1V A;  4C66 A;  1MV0 B;  4J9G A;  4J9H A;  4QVD A;  3S3M A;  2DIL A;  5A85 A;  2DYB A;  2YEK A;  5KYN A;  2YRC A;  4L5G A;  4QSS A;  4C92 B;  5KYW B;  2RHI A;  5FFW A;  3CME T;  3J7A F;  3PIO A;  1XJW B;  2LT1 A;  1H3Z A;  2QDL A;  5LKU A;  3QZS A;  4XU3 A;  3OYE A;  4ATO A;  4JS4 A;  1I1J A;  4YAT A;  2KYM A;  3BDL A;  4YBS A;  1OUL A;  4KV4 A;  3ASK A;  1QW1 A;  3OYL A;  2ABL A;  3PFS A;  4HBY A;  2NWM A;  4PJJ A;  5C7N A;  1QVG S;  3ZYU A;  2NUT B;  3D1B A;  3IU6 A;  5CUE A;  5EWC A;  4M7A B;  3CBP A;  4WHW A;  3SEM A;  2D1X A;  3HP9 A;  3KUF A;  1U8R A;  3V7R A;  1PSF A;  3BFM A;  2DD4 A;  2DTO A;  1DJ7 B;  1IRX A;  2ZCF B;  2L2P A;  5GAM f;  3G4S A;  3U5K A;  4X9C A;  3VUB A;  3QDF A;  3OYA A;  2LT4 A;  2JMA A;  2QQR A;  1ZSG A;  4GBQ A;  3G71 A;  2FHD A;  3O36 A;  2E3H A;  5DYU A;  5A2Q E;  5ETB A;  1TUG B;  3I56 T;  2GNC A;  3I56 A;  3JV3 A;  3ZEH A;  4IR5 A;  1NBE B;  4A53 A;  3U5O A;  2DRK A;  4CC4 B;  2QGG A;  2WP2 A;  4XY8 A;  5CQX A;  3OYN A;  3LQI A;  2KAF A;  4QR3 A;  3OS5 A;  1BI3 A;  4EPC A;  5LJ3 g;  1UTI A;  1NJI U;  5E9L A;  2CZ1 B;  3CCU Q;  1OU9 A;  4Z1S A;  3G0J A;  1RI0 A;  1Y57 A;  3RKX A;  3CC7 A;  4PJN A;  5FG6 A;  4Z89 A;  1VA7 A;  3LYI A;  2XDD A;  3OB9 A;  2E7O A;  3RKY A;  4C8Q F;  4GY5 A;  2VGN A;  5GAM j;  4QSQ A;  1KIK A;  3U5N A;  5LJ2 A;  5DW2 A;  1O9S A;  1FMV A;  2H3J A;  3EG9 B;  5L99 A;  1JJ2 A;  2OTL T;  1YJ9 A;  4QQD A;  1T3S A;  2K5F A;  5EVA A;  2DX1 A;  1KC8 U;  4BW4 A;  2HQX A;  2ROT A;  5GMK j;  2RQV A;  5EPR A;  1KQ1 A;  3P1E A;  3A5Z B;  4PKC C;  2DZC A;  4PFP A;  4LZS A;  4TTE A;  5LJ1 A;  5CY9 A;  4RG8 A;  4M78 D;  4HCK A;  2CSQ A;  4ELY C;  5DLX A;  2DNU A;  4FYW B;  2XK0 A;  3LXJ A;  5E9M A;  4QKU A;  2GRC A;  1VQ8 T;  4MZP A;  2H60 A;  2E5K A;  4FU6 A;  4O7B A;  2YSQ A;  2QAS A;  2R0Y A;  3MB4 A;  2DBK A;  3VYG A;  4HCB A;  2YYN A;  3UAT A;  5ENB A;  4XAX B;  3I3J A;  5I11 A;  2GCX A;  3VS7 A;  2DBM A;  2H8H A;  5KH6 A;  4A54 A;  4QEV A;  2BE7 D;  2RHZ A;  3NFC A;  2LJ3 A;  2LJ0 A;  2DIG A;  1M1K U;  4Z8A A;  1ZUK A;  4O7E A;  2EAY A;  3M56 A;  2F6J A;  3JCM h;  2LJ1 A;  4OMN A;  1ABO A;  2RB6 A;  1TUC A;  4XU1 A;  3JCM Q;  3SWN A;  3CCV A;  1Q86 R;  2PNI A;  3CXC S;  2YXY A;  1U5S A;  2FPD A;  1NJI C;  1EX4 A;  1M3A A;  2RQT A;  5A5O A;  1G3W A;  2RS9 B;  1ABQ A;  1QP2 A;  1Y0M A;  5D24 A;  1S72 T;  2WAC A;  4UIZ A;  4E6R A;  3K2J A;  5CGP A;  4BY6 C;  1I07 A;  3SD4 A;  4J83 A;  4O71 A;  1VOM A;  2GQV A;  3M0P A;  5G4S A;  4TVR A;  1MMN A;  5AMF A;  2CRE A;  4J9F A;  1YCY A;  1E6G A;  4C8Q C;  1G5V A;  5CCA A;  1GRI A;  1JM4 B;  2DA9 A;  3M0S A;  5ACY A;  3JB9 G;  5DYC A;  5LJ3 e;  2W0Z A;  5LJ5 h;  2F1L A;  3JCM b;  4M78 C;  1YJW T;  2KYB A;  3LH0 A;  1KHC A;  2MPX C;  2KT8 A;  3FLG A;  1N27 A;  4QT7 A;  2L3P A;  5HEL A;  3P1C A;  5FE6 A;  1ZHI A;  4HXO A;  2HKQ B;  4R0K A;  4P5N A;  4AFZ C;  3GG3 A;  3QBY A;  2LTO A;  4PK4 A;  5CQ4 A;  2DM1 A;  5AME A;  1ARK A;  4KH0 B;  2DAT A;  4AFS C;  2RNY A;  4FSX A;  3CEY A;  3M54 A;  3CPW A;  5I86 A;  2R0V A;  3LWI A;  1SEM A;  1D1B A;  5FFV A;  4B6M A;  4C92 F;  3BDU A;  3Q1J A;  3UPU A;  1M1K C;  1WFW A;  4ESR A;  3GLX A;  4AKH A;  2VUB A;  4RTY A;  4LUD A;  2DTH A;  2M9U A;  4M77 B;  1M8V A;  1H92 A;  3OYH A;  4WHU A;  2OUO A;  2XKO C;  2ATC B;  1ACM B;  4N4H A;  4TYL A;  4UYD A;  5IBN A;  2CT3 A;  4J6W A;  2DYI A;  2QEX Q;  4M75 A;  3P5O A;  1YIT Q;  2FVU A;  2L84 A;  3MEV A;  5CFW A;  3H6Z A;  3CC4 T;  3NTI A;  1N9R A;  3OYJ A;  2DPP B;  1PSE A;  4LN2 A;  3OYI A;  1GCQ A;  2LVM A;  1X27 A;  4PJO G;  5KYU B;  2QXF A;  3S3N A;  2A0F B;  1ZUU A;  1MHN A;  1VIF A;  4M7A D;  3JSC A;  2K3Y A;  2E5Q A;  5E9V A;  4A4E A;  4CUU A;  5HLS A;  3OMC A;  3LQH A;  1ZX6 A;  5L98 A;  1VQ7 Q;  4QSW A;  1PNJ A;  2HDA A;  1Z9Z A;  2YUN A;  2DVR A;  3CMA Q;  4IIM A;  2D8H A;  5D6Y A;  2KNB B;  3THK A;  4BE1 A;  2VAS A;  1H64 1;  1VQ9 Q;  2ENM A;  1ZA2 B;  3U5P A;  3CCU A;  3V8L A;  4PNO A;  4XK8 E;  1WQW A;  1LOJ A;  1T3L A;  2VGM A;  5GMK i;  4O70 A;  4KCX A;  3OYK A;  4J3I A;  3VS1 A;  3EG2 A;  2YEM A;  2DJZ A;  2J7I A;  2E4H A;  1JO8 A;  4XTU A;  1Q7Y U;  5L8R E;  5DBM A;  2RF0 A;  4RCB A;  4QYL A;  4YYN A;  2DFU A;  4QSR A;  5A7C A;  1AD5 A;  1X2K A;  4C92 C;  4IOO A;  1D0Y A;  2DKW A;  3TLP A;  3SVF A;  2CZ6 B;  5LJ3 d;  3CCQ Q;  2HNI A;  4KUI A;  2V8I A;  3NHN A;  1HYO A;  4DA4 A;  4A4H A;  3TVT A;  4BHW A;  3SWN B;  5DY9 A;  3VKG A;  4MR3 A;  1X0J A;  3M4Y A;  3HMF A;  1VQO T;  3M4G A;  5CS8 A;  1I8F A;  1X2Q A;  4PKL A;  3UW9 A;  5CR2 A;  4QQG A;  2D9T A;  3CME Q;  2ZPF B;  5FW9 A;  1RAE B;  1RL2 A;  5CKD A;  4ZGE B;  1C6V X;  1K4U S;  2F69 A;  5HK0 A;  4QC3 A;  2HEQ A;  4M7A C;  1K73 U;  4RTT A;  2G6F X;  5ENI A;  2LQ8 A;  2MK5 A;  1UE9 A;  5IHN A;  1VQP T;  1W2B A;  2EQK A;  2K4Y A;  1I4K 1;  2DMO A;  1Q95 G;  4O5V A;  1XOV A;  2XHC A;  3DKM A;  5CAI A;  5D3S A;  3FEO A;  2DL5 A;  3LWH A;  4BB7 A;  1M30 A;  2LCC A;  2K9G A;  3RIR A;  4A4F A;  4LZR A;  2DZ9 A;  2JTF A;  2BE9 B;  2K2M A;  1QWE A;  1KSW A;  3JAM E;  3TSZ A;  2HKN A;  3IU5 A;  2PVD B;  3NTK A;  1WX6 A;  4TU6 A;  5E9K A;  3PT9 A;  3U5J A;  3TEE A;  3VKI A;  5KHM A;  1B34 A;  1G83 A;  2RA2 A;  1FMK A;  5C85 A;  2O4X A;  1CKA A;  2YUQ A;  4A9L A;  4NL3 A;  3I56 Q;  2KRO A;  2R58 A;  5GAM e;  1TXQ A;  4FSS A;  1Q7Y C;  1Y07 A;  4QST A;  4YYK A;  4MMK A;  4J9D A;  4CI0 C;  4E7H A;  3S91 A;  2RQW A;  5FE0 A;  4KBM B;  1RLP C;  3V7C A;  4IUR A;  1OQK A;  1ZLM A;  3WVE B;  1UFF A;  4F7U G;  2JS0 A;  2VYT A;  4M7D F;  2XI9 A;  5GMK e;  3CC7 Q;  2QGF B;  1IXD A;  1M3C A;  3A8L B;  1UJY A;  5A5N A;  4BW2 A;  5FE1 A;  2RNA A;  3CPW P;  4LDF A;  2X4J A;  4E7S A;  2O01 E;  3LGF A;  5AD2 A;  5CTL A;  5CUC A;  2LDM A;  3V8K A;  5HRV A;  1D3B A;  2K2V A;  1WDX A;  4J9E A;  5CKF A;  1W6X A;  2OTL Q;  4CLB A;  1WQ7 A;  1N5Z A;  3O5Z A;  4CC7 A;  1MUZ A;  3C4S A;  4N0A C;  3SHW A;  1K73 C;  4AI6 A;  2JOY A;  4HXR A;  3NMZ C;  2LQW A;  2DVE A;  1UGP B;  5CKE A;  5HCK A;  1YN8 A;  4FW2 A;  1GBR A;  1LVK A;  2YLC A;  5CVI A;  3FB9 A;  3QPH A;  1RAD B;  2E6N A;  3A1P A;  4ZN1 A;  3V8J A;  1OPK A;  1VQ8 Q;  1VYV A;  4QC1 A;  2DVJ A;  1QCO A;  4NRC A;  2YT6 A;  4WCI A;  1K0X A;  4CRI A;  1YWP A;  3JVK A;  4RCC A;  1TOV A;  2C06 A;  1CKB A;  5KYX A;  1YIJ T;  4M77 D;  2VXF A;  3RCW A;  4PJO E;  4IUQ A;  1NM7 A;  3P1D A;  5K29 A;  3UDC A;  2WSC E;  3FKM X;  1GBQ A;  2QDY B;  5DYX A;  1ZA1 B;  2KY9 A;  2V8J A;  4IUV A;  2W10 A;  3U5L A;  1HK9 A;  5IT9 E;  4TT6 A;  2O2O A;  2QEX A;  2OSS A;  3G6E T;  1YIT A;  5BT4 A;  2CZ0 B;  4LC2 A;  1FXX A;  4FYV B;  2IIM A;  4HKE A;  1QVF S;  1TS9 A;  2RNX A;  1E7O A;  3A8G B;  3GNG A;  1BI2 A;  3MO8 A;  5IID A;  3J80 E;  4DON A;  6AT1 B;  4YH3 A;  4A4G A;  2FB7 A;  3CCM T;  5D3J A;  4EMK A;  4KUD K;  1H3H A;  2FPF A;  4LYW A;  1NZ9 A;  3VS5 A;  2HL5 C;  2ECZ A;  2RJF A;  5D0C A;  4QNS A;  2P0Q A;  4QR4 A;  4NUE A;  5D7X A;  2EJN A;  1HXD A;  1VQ7 A;  5ETD A;  4A9F A;  1KK7 A;  5EA1 A;  4WTO B;  2QG9 B;  1WHM A;  4NRA A;  1ZKR A;  5KU3 A;  1TWB A;  3MKD A;  3P1F A;  4AKI A;  5G4R A;  2CP6 A;  4IR4 A;  5M9O A;  1VQ9 A;  2DLP A;  2D8J A;  2WP1 A;  1JRI A;  3OBW A;  4OB3 B;  2OTJ T;  1YJW Q;  2P0P A;  3JVL A;  1OZ2 A;  5GAM d;  1KD1 R;  5LVR A;  4C8Q G;  1RAC B;  1WJR A;  4MDX A;  4ORZ A;  1QP3 A;  5LKX A;  2K6D A;  1TUD A;  2HSP A;  2DD5 A;  3UT1 A;  5KCO A;  1B3Q A;  3LW5 E;  1TG0 A;  1C0M A;  2FRW A;  1N72 A;  3OYY A;  2F5T X;  4M78 G;  1XQH A;  2EJG A;  4M77 C;  3LLR A;  2COZ A;  3HKS A;  4RTW A;  1BIB A;  3EG1 A;  2KK4 A;  4OMF B;  1SPK A;  1G3S A;  2GTJ A;  2EVR A;  4O72 A;  4LNP A;  4JRQ A;  1Q82 U;  3RES A;  2MI6 A;  3P8H A;  2QQS A;  3OYF A;  4VUB A;  1AWJ A;  2BZX A;  1X75 C;  2QA4 T;  2FG0 A;  1UGQ B;  2ZPB B;  3JCM V;  3DB4 A;  3CME A;  5EU1 A;  4DBR A;  2VKN A;  3UVW A;  4M7D A;  1OX8 A;  2IG0 A;  1MV3 A;  3E9G A;  5FE5 A;  1KHI A;  5DKC A;  1M8M A;  3MPU B;  2CP3 A;  3JCM P;  4V2S A;  2F2W A;  4YYH A;  4MR5 A;  5ENC A;  5F61 A;  3GNF B;  5CQ8 A;  4LZ2 A;  3S92 A;  1M5Q 1;  4BW1 A;  3AHU A;  1Y96 A;  2QAZ A;  2E6Z A;  5EIS A;  1M2V B;  5D3R A;  2J05 A;  5I40 A;  5CQ6 A;  2EGA A;  3QJY A;  1ZBX A;  2A28 A;  2D0Q B;  1BCM A;  2ZPG B;  3CC4 Q;  2DEU A;  5II1 A;  5C4Q A;  2YLB A;  4UIV A;  5GAN 3;  1YI2 T;  2QTV A;  2RJC A;  4HXM A;  5LJ5 j;  3TSW A;  3EHQ A;  5EPS A;  1D3B B;  5LJ3 h;  1Q7Y R;  1UGV A;  4TZ2 A;  1KQ2 A;  3QG1 A;  5F60 A;  4BD3 A;  3SDZ A;  4F7U E;  2DL7 A;  1UHF A;  4X1V A;  2DVS A;  1I5O B;  2JUF A;  5CUD A;  3IQL A;  1WYX A;  3S6W A;  2YUP A;  3H41 A;  4A9E A;  2OX7 A;  4PS5 A;  3JRZ A;  1S1N A;  4QSP A;  2V1Q A;  4MEO A;  1VUB A;  4J9B A;  5ENG A;  4FW1 A;  3M58 A;  4UYH A;  5A81 A;  1BI0 A;  2BKD N;  1RAG B;  2KI7 A;  4YYG A;  2MWP A;  3MUK A;  2DIQ A;  4KH1 B;  1Q82 C;  4JJD A;  3JCM c;  1Y7X A;  3MP1 A;  2PVO B;  4Q5W A;  4CL9 A;  4J5Y A;  3UA7 A;  3SWN C;  1K73 R;  4ZTJ A;  2EFI A;  2KXD A;  3QXE B;  2I0N A;  2O9V A;  4WF2 A;  1EQF A;  4HA8 A;  3O35 A;  2CP7 A;  5HY6 A;  4Q0N A;  4M75 F;  1LJO A;  2DE0 X;  3TCJ A;  2OTL A;  3PTA A;  1VQK T;  4MML A;  4HXP A;  5EM3 A;  2C0I A;  4AKG A;  4C8Q D;  3U23 A;  5II2 A;  5FLX E;  3E2U A;  5A0D A;  1OOT A;  1I5L A;  2DXC A;  1R8O B;  2RHU A;  2HMA A;  2AZS A;  1BBZ A;  2CDT A;  2BUD A;  4C92 G;  2GGR A;  3QYH B;  4MZT A;  4RTV A;  2K3X A;  2GQI A;  4NYV A;  1JBM A;  1BKB A;  3D1D A;  4FCY A;  4FIB A;  2D9E A;  2HZY A;  1VQ8 A;  1T0J A;  4N3W A;  3OMG A;  2LRQ A;  1KQS S;  5F1H A;  5IGL A;  1G3T A;  5D26 A;  3P8B B;  5GAO n;  1YHQ T;  1X43 A;  1VQP Q;  1JXO A;  2J6F A;  2DET A;  5IAY A;  4PLL A;  3VS6 A;  1VIE A;  4PJM A;  3OS0 A;  3MB3 A;  3NXB A;  2FZK B;  4JPB W;  5H1U A;  3MXF A;  4MR6 A;  1X6O A;  5IH2 A;  4M7A G;  1U3O A;  4PCI A;  2PZ1 A;  2DL8 A;  3MHX A;  4WIV A;  4O75 A;  5DKD A;  2FEI A;  2MF2 A;  2CP0 A;  1ZS5 A;  1VQL T;  2JNG A;  1PKT A;  2DAQ A;  4Z02 A;  5HQ6 A;  4ANJ A;  4O7F A;  4LYS A;  4UIY A;  4N4F A;  3O33 A;  4OGJ A;  1H8K A;  2L5E A;  4XUB A;  2JTM A;  5F3A A;  3EH2 A;  1I81 A;  1S72 A;  4OGI A;  2DVV A;  3BW1 A;  1TTH B;  1RI9 A;  2M51 A;  3CCS T;  1F68 A;  5LKZ A;  1QVG A;  3RDV A;  4E47 A;  5EWH A;  3HHT B;  4RTZ A;  5I88 A;  4F04 B;  4C8Q E;  3OW2 S;  5GAN 2;  1IRE B;  3CCR T;  5CO7 A;  4ZGJ B;  2RI7 A;  3EG3 A;  4QUU A;  4LRG A;  5HJC A;  2F5K A;  4QBM A;  5EQ1 A;  4M78 E;  3O37 A;  3H9N A;  3M59 A;  4M7D B;  1QQJ A;  1MMG A;  2P84 A;  1PD1 A;  1YJW A;  2CUD A;  2DER A;  5D6X A;  3GIB A;  1AVZ C;  1M2O A;  3REA B;  5GAN f;  4E7J A;  5J39 A;  3VS4 A;  4JZ4 A;  4CC3 A;  2EYX A;  2VC8 A;  4J7F A;  1YWO A;  5BT3 A;  2C0O A;  1Y96 B;  2G4A A;  3I9Q A;  5E74 A;  4RTU A;  1GFD A;  3H0F A;  5D6W A;  5FRM A;  5L8U A;  3KXT A;  4RTX A;  5FE3 A;  3E19 A;  4LR6 A;  1SKU B;  1VQ5 T;  1VQ5 A;  4BE2 A;  1WGS A;  2D6F A;  4UYE A;  3UWN A;  5TB6 A;  5L96 A;  1X6G A;  5HQ7 A;  5CZG A;  1UGR B;  2YDW A;  1WIE A;  2EQI A;  4QQ6 A;  5DX4 A;  2JXB A;  2NUP A;  1N9S A;  2DVQ A;  1D0X A;  4X9D A;  5D3T A;  1KD1 U;  4HBX A;  2M0O A;  4QUT A;  2WSE E;  2LQN A;  3EH1 A;  3QWY A;  4AFU C;  4D8K A;  5L97 A;  5GAN j;  4C92 D;  1YIJ Q;  2BZ8 A;  4JLI A;  5ENH A;  4QB3 A;  2BZY A;  1V29 B;  4II1 A;  4NXJ A;  1Z9Q A;  2B8A A;  2LNH B;  3TRE A;  3BE3 A;  4TZ8 A;  2YQD A;  2VXE A;  2K57 A;  5EC7 A;  3P8D A;  3U5M A;  4QZS A;  3G6E Q;  1UEC A;  4PFO A;  5FDZ A;  1WNL A;  4CUQ A;  3CC4 A;  4XTX A;  4J9I A;  5CQA A;  1WJS A;  3Q2F A;  2RHY A;  4HXJ A;  4XU0 A;  1SSH A;  1QVF P;  3CCM Q;  4CFK A;  5D25 A;  5GMK h;  4LD9 K;  1X6B A;  3VS3 A;  3FJP A;  5FU6 B;  1M1G A;  1ZSZ A;  2Y90 A;  3RUX A;  5GAO l;  1MMD A;  3RER A;  5HRX A;  2SEM A;  5GAM g;  9ATC B;  2LC4 A;  5I7Y A;  2AKK A;  1QCF A;  2Y4X A;  3L1A A;  2LZ6 B;  4A9M A;  5HCL A;  1IO6 A;  1PM3 A;  2FSA A;  1Q82 R;  1K1Z A;  2EYY A;  2E7N A;  2CSI A;  4PCE A;  1IHW A;  3VRZ A;  3A8M B;  2RH2 A;  2AZV A;  4MDW A;  1AWX A;  1AHJ B;  2EQU A;  2V1R A;  5IN1 A;  3CXC A;  2LSP B;  4YYJ A;  2OTJ Q;  2FPE A;  1WA7 A;  3BY7 A;  3SFM A;  1FMW A;  5I1Q A;  1Q81 R;  3CCE T;  4LDX A;  3T9N A;  2RK2 A;  2GF7 A;  1UHC A;  5IXF A;  2E41 A;  2V8K A;  4OMQ A;  3JCM e;  3QJ6 A;  4KGX B;  2I2L A;  3CCJ A;  2RHX A;  4C92 E;  4PJL A;  3CCJ T;  1G8X A;  1V1C A;  3MUL A;  1YJN T;  1KD1 C;  1YP5 A;  2EGC A;  3CC2 T;  1NLP C;  4HCC A;  1TH7 A;  2CS7 A;  5J26 A;  3HL8 A;  3MEU A;  3JB9 F;  4UYF A;  1RAI B;  4PFZ A;  4C5I A;  4YYM A;  2CH4 W;  3M5A A;  3OYD A;  4BAC A;  5I22 A;  5FG5 A;  3LX7 A;  1IB8 A;  3FRN A;  4UIT A;  3UA6 A;  1FWZ A;  2QA4 Q;  4YY6 A;  2JS2 A;  2RJD A;  3QZ9 B;  1VQO A;  1HSQ A;  4M77 G;  3UVY A;  2RPN A;  5CPE A;  4JJN K;  1PRL C;  1N8R R;  4OMO A;  4HCZ A;  4Q0O A;  4M7A E;  3DB3 A;  5D3L A;  3QUI A;  5A83 A;  5LJ5 e;  3JCM X;  4ZC9 A;  3EGD A;  4D6W A;  1VQP A;  2DRM A;  4HT8 A;  3M0U A;  2CUB A;  1R0C B;  3CPF A;  1X01 A;  2K7A A;  2BTT A;  5E9Y A;  5EI4 A;  2L0A A;  4CUS A;  1VQ4 T;  2YWW A;  2KBT A;  4FT4 A;  4AKN A;  2C0T A;  1QVG P;  4LDY A;  4IUU A;  5FH6 A;  2MCN A;  1YI2 Q;  4YC9 A;  3OSS C;  3ER0 A;  4NRB A;  3OYM A;  3D7S B;  2P4R A;  2AK5 A;  5KCH A;  2L3S A;  1AZG B;  3VJP A;  4QYD A;  2WSF E;  2RI3 A;  3VKH A;  1VYU A;  2M0Y A;  4Y28 E;  3C0C A;  1RAA B;  3EFS A;  5GAN 4;  1JXM A;  4PJO F;  4OB1 B;  3LJW A;  3QYG B;  2DXU A;  3D7C A;  5FH8 A;  1NYG A;  3C94 A;  7AT1 B;  4E7Z A;  4MEQ A;  2O31 A;  2X51 A;  1WHL A;  4XYA A;  2A08 A;  2JZ2 A;  1VQN A;  2PUK B;  1VQN T;  5DW1 A;  2EIF A;  2G3R A;  1M4Z A;  3SVG A;  1ZBJ A;  2PUO B;  4CC2 A;  5F36 A;  4M7D D;  4NR5 A;  3JB9 I;  2RQR A;  4HXK A;  4HXN A;  3UV4 A;  3JVM A;  1PCX A;  3PIP A;  5KTX A;  1YNZ A;  1VQK Q;  2I7K A;  5GAN g;  2ED1 A;  4L59 A;  3R6O A;  3G0L A;  5FB1 A;  3WXM B;  3KFV A;  1E6H A;  4M75 B;  5HM0 A;  1T0H A;  3GPL A;  5GAO r;  4YAX A;  3RMQ A;  3JCM d;  5E3G A;  4YBM A;  4R55 A;  4JZ3 A;  3V7S A;  1RLQ C;  4QR5 A;  5EWW A;  1IGU A;  3A8O B;  1W1F A;  3DLL A;  2DF6 A;  4DOV A;  4PTB A;  1WJQ A;  4O6J A;  1GCP A;  2R5A A;  4DBF A;  1ZSZ B;  1JB0 E;  4C0G A;  1WHH A;  1YHQ Q;  2XD0 A;  5HRW A;  1KQS P;  1YIJ A;  3PVL A;  2L85 A;  1EZZ B;  1A0N B;  5DYA A;  2YHT A;  4RG2 A;  5I89 A;  3ULR B;  3H0I A;  3X26 B;  1IHV A;  4OB0 B;  5D3P A;  3G6E A;  1J3T A;  4F16 A;  5CQ5 A;  2CKK A;  4X34 A;  4IOQ A;  5FBX A;  1X69 A;  4UIW A;  4NR6 A;  5HQ5 A;  5C6S A;  4J7I A;  5LJ5 d;  1VQL Q;  3O34 A;  3M53 A;  1O75 A;  2LMJ A;  3EFO A;  1JEG A;  5GAO p;  5A82 A;  4YTL A;  3UVD A;  2EQJ A;  5IGN A;  3X28 B;  4OGC A;  5KYY A;  5FFY A;  3CCM A;  1UJ0 A;  3CXC P;  2JM8 A;  1S72 Q;  3QZT A;  4J6X A;  5CUG A;  3CCS Q;  1OYX A;  4EMH A;  4UYF B;  5FB0 A;  4BE0 A;  2DWW A;  4BJX A;  1UG1 A;  2R57 A;  3WVD B;  4M7D C;  4EIK A;  5C0M A;  2AIR B;  3I35 A;  5FH7 A;  2YW5 A;  5AT1 B;  2EYW A;  5I29 A;  1NLO C;  2SRC A;  3QO3 A;  3CCR Q;  5A5S A;  2XU8 A;  1NEB A;  4IOR A;  2R5M A;  2MOX A;  4OP0 A;  3EAE A;  1VQM T;  3JCM f;  3MEW A;  5EPB A;  5FWB A;  4JUV A;  1OEB A;  1OI1 A;  5I80 A;  2OTJ A;  5EP7 A;  5HEM A;  2DKG A;  5CU8 A;  3TQ7 P;  3RR6 A;  5I2M A;  3AAD A;  3JCM J;  3INZ A;  3CD6 T;  2GFA A;  1JJ2 S;  2A36 A;  2B86 A;  3J81 E;  1XNI A;  3HRS A;  2V26 A;  4M77 E;  2OAW A;  2M16 A;  2LCS A;  3M0Q A;  4F7U F;  2LNV A;  3HRT A;  4TS8 A;  5GAN e;  4UYG A;  4HBV A;  1MNE A;  5D3N A;  4XY9 A;  1VQ5 Q;  3M57 A;  4FYY B;  2KMT A;  3AT1 B;  4O7C A;  2VVK A;  4JRK A;  2X35 A;  4PJO A;  2QA4 A;  5ENF A;  3ZBD A;  1NG2 A;  5LJ5 f;  4J0S A;  5F2P A;  4Z88 A;  2E65 A;  2ZPH B;  1B34 B;  2EPD A;  3ZL7 C;  1Q81 U;  2O4X B;  3H0H A;  1IZ6 A;  5I83 A;  2RO1 A;  5E0R A;  3LGL A;  1OPL A;  1NE8 A;  1UB4 A;  4LDW A;  4DQ2 A;  1RUW A;  5GMK l;  3I55 T;  5D7U A;  4ALG A;  1BYM A;  5HK3 A;  3VU3 C;  2KR3 A;  5CK9 A;  4KGV B;  5E7D A;  2HCK A;  1RAH B;  5GAO m;  1LCK A;  1RAF B;  1LNX A;  5FRN A;  4ZN3 A;  3JB9 H;  1AT1 B;  2MAM A;  5I7X A;  4GLM A;  2RQU A;  5FU6 C;  2KSS A;  2EKH A;  4BDZ A;  2DL3 A;  3REB B;  5AD3 A;  4XTY A;  5CUA A;  1BB9 A;  1D0Z A;  2PQW A;  1YI2 A;  2E70 A;  2RMO A;  1M9S A;  3VYH B;  1B7T A;  4C0D B;  4A9H A;  1R77 A;  1N8R U; 
#chains in the Genus database with same CATH homology
 4C67 A;  1UEB A;  3DLM A;  4KUL A;  4OVA A;  2E12 A;  3HMH A;  3Q2E A;  3MQM A;  3UVX A;  1BIA A;  2EJF A;  2XIC A;  3QHS A;  4C5G A;  4LYI A;  4Z6H A;  2QI2 A;  4UC4 A;  3S3O A;  1QVF A;  3MP6 A;  5FE9 A;  5GAN 8;  3G4S T;  4Y91 A;  4M77 A;  4BI3 A;  2PVG B;  3OA6 A;  3G71 T;  3JB9 J;  2RNW A;  2KQW A;  3ZFJ A;  5C8G A;  2PU9 B;  5LKT A;  2RFJ A;  4TT4 A;  5LVQ A;  5EWV A;  2X4X A;  3NTH A;  4C0Z A;  2VV5 A;  1Q81 C;  4HXL A;  4N4I A;  1VQK A;  2FL7 A;  5DLQ E;  3CPW S;  3G7Z A;  3CC7 T;  3CCL A;  3CCL T;  5DLZ A;  5IG6 A;  2CYZ B;  5FE2 A;  5LUU A;  3ONI A;  4M75 D;  2ZGW A;  4YK0 A;  2JVV A;  5L8T A;  1QVP A;  1VQ6 A;  1VQ6 T;  3OYG A;  4DOW A;  5EIC A;  4EMK B;  1YJ9 T;  4M78 F;  5GAN d;  5CRM A;  4ZGD B;  4MEN A;  1P92 A;  4E7K A;  1YHQ A;  2EWN A;  3L42 A;  4EDU A;  3MEA A;  4MZM A;  4QVC A;  1N8R C;  2HBP A;  4E7L A;  3HRU A;  1K9M U;  2ZPE B;  4UIU A;  3L2U A;  4C5H A;  1NPP A;  4E96 A;  4F7U A;  5GAO q;  1KG1 A;  2KTB B;  5DFB A;  1VQL A;  2QQA A;  4C5E A;  4XTW A;  5J0D A;  5CP5 A;  3GF5 A;  3OS2 A;  2RI2 A;  3CCS A;  4YAD A;  4YH4 A;  3CCV T;  2K5I A;  4F3I A;  5F1L A;  3CCR A;  2L3R A;  4PJO B;  3X25 B;  5EWD A;  4M75 E;  3SB2 A;  5JWM A;  4M75 C;  5CKH A;  4NL2 A;  2DXB A;  3JCM g;  5AYF A;  2X4W A;  3VV0 A;  2XDB A;  5D3H A;  2A7Y A;  5ENE A;  2DK3 A;  1U1T A;  2DEQ A;  4MR4 A;  1KC8 C;  2KVQ G;  2LX9 A;  3L2Z A;  3HSB A;  3DAI A;  3PMT A;  4A9I A;  4QEU A;  5FU7 B;  1G3Y A;  5LJ0 A;  1K9M C;  4ZQL A;  5EGU A;  3OSV A;  3JVJ A;  3HFO A;  5J3B A;  2RD1 A;  2RI5 A;  4FLP A;  2XID A;  5H1T A;  3E9F A;  5HFQ A;  1JSP B;  4A9J A;  4QY4 A;  3OYC A;  4XTZ A;  5LJ5 g;  5IGM A;  1W2B S;  5DFD A;  3A8H B;  2R0S A;  3DWY A;  2ZZD A;  5CUB A;  4BDY A;  2YRV A;  5KTW A;  1WUM A;  4QSV A;  4J6Y A;  4O74 A;  1BI1 A;  5GAM h;  4NR4 A;  1XTD A;  1WUG A;  5DM7 R;  2N9G A;  3E1S A;  5COI A;  4C8Q A;  1KQS A;  2K5L A;  1ZQ1 A;  2MMP A;  3RMS A;  5C89 A;  5KO4 A;  2XG8 D;  4CUP A;  5A0G A;  3CBO A;  4M7A F;  3AQA A;  3FIF A;  1EIF A;  4B9X A;  4M78 A;  4JS5 A;  2DXT A;  3L2Q A;  5GAN 7;  1M90 U;  4ELZ C;  3QDR B;  5DY7 A;  5IGK A;  2ZPI B;  4NYW A;  5F63 A;  3TU4 K;  5I2S A;  2X4Y A;  4IR6 A;  4MEP A;  2MWO A;  5F5Z A;  1GXI E;  5BT5 A;  5E9I A;  4M7D G;  3OBY A;  4NQN A;  3H8Z A;  3CCE A;  2MJV B;  4O7A A;  5A5R A;  4PLI A;  3MET A;  5DFC A;  5DKH A;  2CGH A;  3PMI A;  5F25 A;  4BW3 A;  2EJ9 A;  4LDV A;  2DTI A;  3C12 A;  5KE3 A;  2XDP A;  1YJN A;  3CC2 A;  3OW2 A;  2E64 A;  5GMK m;  3CCU T;  4Z6I A;  4ZTF A;  2E10 A;  4F7U B;  4JRP A;  3UV2 A;  5JI8 A;  2EKO A;  4TU4 A;  4PY6 A;  4N4G A;  4HXS A;  2L5Q A;  4FT2 A;  3GOX A;  4QVZ A;  4FL6 A;  4ZW1 A;  3L2R A;  3JB9 D;  3QKJ A;  4NR9 A;  3HME A;  4L6V 5;  2BIV A;  3FC3 A;  4QSX A;  4ME7 A;  4ALH A;  3QZ5 B;  4PL6 A;  4IR3 A;  3CBM A;  4C0D C;  3F70 A;  2L89 A;  4A9N A;  1VQ4 A;  3GP8 A;  4IUP A;  1M90 C;  5TCM A;  2R10 A;  3N5B B;  4OGE A;  2KDS A;  4RKU E;  5CRZ A;  4O78 A;  3OY9 A;  2EYQ A;  4QSU A;  4IUT A;  5FG4 A;  2FYK A;  4BUG A;  1W4S A;  3L2V A;  2IVW A;  3MP8 A;  1OZ3 A;  1U1S A;  4B9W A;  2E1H A;  1N6A A;  3O8V A;  4Y03 A;  2AHJ B;  5EK9 A;  5FE4 A;  5CKB A;  5CQ7 A;  5I21 A;  5CQ3 A;  4HT9 A;  5EG2 A;  4TT2 A;  1NPR A;  2LCL A;  4C92 A;  4XUA A;  4XU2 A;  4NS5 A;  5GAN h;  4O77 A;  4Z93 A;  4YAB A;  4YYD A;  1Y71 A;  3HFN A;  5H85 A;  4PJO D;  2RM4 A;  4GPJ A;  4CFL A;  4YY4 A;  2A3L A;  5LJ3 f;  4O76 A;  4YBT A;  3OS1 A;  4RVR A;  5A5P A;  4LDU A;  5FRO A;  4X2I A;  4EMK C;  4Z1Q A;  5CQT A;  4BY6 B;  4M7A A;  2I8N A;  1Q86 U;  4CUR A;  3JCM W;  2RK1 A;  4EMG A;  5FE7 A;  1SSF A;  4BI8 B;  4CUT A;  4TQN A;  4C8Q B;  4XTV A;  4OUF A;  4NYX A;  4NUD A;  2NXB A;  1YBY A;  1MGQ A;  2QTX A;  4QEW A;  5GAN 5;  4NR7 A;  4GLK A;  2D82 A;  3QSU A;  3UV5 A;  4M78 B;  5LJ3 j;  4IKF A;  1K8A U;  3M55 A;  5F62 A;  1FX7 A;  2NLU A;  4J1P A;  4OB2 B;  3X20 B;  3EFR A;  2YEL A;  4A4K A;  4HBW A;  4C0F A;  4M77 F;  4KT0 E;  3RKW A;  1UGS B;  2Y4Y A;  3SVH A;  5CIU A;  3OQ5 A;  3C95 A;  1M1F A;  2DO3 A;  4A9K A;  2JN0 A;  2E3K A;  5EV9 A;  5E3D A;  4E7I A;  4RMO A;  2RO0 A;  4KV1 A;  2CZ7 B;  5A5Q A;  3M9Q A;  4PJO C;  4UIX A;  4NUC A;  3ME9 A;  3VUZ A;  4FM4 B;  2QEX T;  4M7D E;  4NOY A;  1YIT T;  3OYB A;  4OF1 A;  4JDS A;  3MCA B;  2L8D A;  4J0R A;  3LQJ A;  2EQM A;  2M1H A;  4QW2 A;  4NQM A;  2OAU A;  2RJE A;  3FDR A;  4NR8 A;  4N0A A;  1VQM A;  1Q86 C;  2GFU A;  5HEN A;  2F6N A;  5FE8 A;  5C87 A;  3URG A;  5LL6 S;  2P4T A;  1VQ7 T;  4BI4 A;  3CD6 A;  5FU7 C;  3CMA A;  2OO1 A;  5KE2 A;  3CMA T;  4JLG A;  3L2W A;  3HPW A;  5HKC A;  3X24 B;  4M75 G;  3QZV A;  5DLO A;  1VQ9 T;  3QII A;  1K8A C;  5CQY A;  4LD6 A;  4A9O A;  2LQK A;  5A0L A;  2HQE A;  4R56 A;  4YYI A;  1WPY A;  2QQB A;  2QQ9 A;  2HD0 A;  4JRI A;  5E73 A;  5ENJ A;  5HFR A;  2P0K A;  3PNW C;  5GAN 6;  4J8O A;  3CCQ A;  2HAX A;  3CCQ T;  3I55 A;  4XQ3 A;  3KBG A;  3PGG A;  5KTU A;  1E6I A;  5H1V A;  4C66 A;  4QVD A;  3S3M A;  5A85 A;  2YEK A;  4L5G A;  4C92 B;  4QSS A;  2RHI A;  5FFW A;  3CME T;  3J7A F;  3PIO A;  2LT1 A;  1H3Z A;  5LKU A;  3QZS A;  4XU3 A;  3OYE A;  4ATO A;  4JS4 A;  4YAT A;  3BDL A;  4YBS A;  4KV4 A;  3ASK A;  1QW1 A;  3OYL A;  3PFS A;  4HBY A;  5C7N A;  1QVG S;  3ZYU A;  3IU6 A;  5CUE A;  5EWC A;  4M7A B;  3CBP A;  4WHW A;  3HP9 A;  3KUF A;  1U8R A;  3V7R A;  1PSF A;  3BFM A;  2DD4 A;  2DTO A;  1DJ7 B;  2ZCF B;  5GAM f;  3G4S A;  3U5K A;  4X9C A;  3VUB A;  3OYA A;  2LT4 A;  2QQR A;  3G71 A;  2FHD A;  3O36 A;  5DYU A;  5A2Q E;  5ETB A;  3I56 T;  3I56 A;  3ZEH A;  4IR5 A;  4A53 A;  3U5O A;  2WP2 A;  4XY8 A;  5CQX A;  3OYN A;  3LQI A;  2KAF A;  4QR3 A;  3OS5 A;  1BI3 A;  4EPC A;  5LJ3 g;  1NJI U;  5E9L A;  2CZ1 B;  4Z1S A;  3G0J A;  1RI0 A;  3RKX A;  3CC7 A;  5FG6 A;  3LYI A;  2XDD A;  3OB9 A;  2E7O A;  3RKY A;  4C8Q F;  4GY5 A;  2VGN A;  5GAM j;  4QSQ A;  3U5N A;  5LJ2 A;  5DW2 A;  1O9S A;  2H3J A;  5L99 A;  1JJ2 A;  2OTL T;  1YJ9 A;  4QQD A;  2K5F A;  5EVA A;  1KC8 U;  4BW4 A;  2HQX A;  5GMK j;  5EPR A;  1KQ1 A;  3P1E A;  3A5Z B;  4PKC C;  2DZC A;  4LZS A;  4TTE A;  5LJ1 A;  5CY9 A;  4RG8 A;  4M78 D;  4ELY C;  5DLX A;  2XK0 A;  3LXJ A;  5E9M A;  2GRC A;  1VQ8 T;  4MZP A;  2H60 A;  4FU6 A;  4O7B A;  2R0Y A;  3MB4 A;  3VYG A;  4HCB A;  2YYN A;  5ENB A;  4XAX B;  3I3J A;  2GCX A;  5KH6 A;  4A54 A;  4QEV A;  2RHZ A;  3NFC A;  2DIG A;  1M1K U;  4O7E A;  2EAY A;  3M56 A;  2F6J A;  3JCM h;  2RB6 A;  4XU1 A;  3JCM Q;  3SWN A;  3CCV A;  3CXC S;  1NJI C;  5A5O A;  1G3W A;  2RS9 B;  1QP2 A;  5D24 A;  1S72 T;  2WAC A;  4UIZ A;  3K2J A;  5CGP A;  4BY6 C;  3SD4 A;  4J83 A;  4O71 A;  2GQV A;  5G4S A;  4TVR A;  5AMF A;  1YCY A;  4C8Q C;  1G5V A;  5CCA A;  1JM4 B;  5ACY A;  3JB9 G;  5DYC A;  5LJ3 e;  5LJ5 h;  3JCM b;  4M78 C;  1YJW T;  3LH0 A;  1KHC A;  3FLG A;  1N27 A;  5HEL A;  3P1C A;  5FE6 A;  1ZHI A;  4HXO A;  4P5N A;  3GG3 A;  3QBY A;  2LTO A;  5CQ4 A;  5AME A;  2DAT A;  2RNY A;  4FSX A;  3CEY A;  3M54 A;  3CPW A;  5I86 A;  2R0V A;  3LWI A;  5FFV A;  4C92 F;  3BDU A;  3Q1J A;  3UPU A;  1M1K C;  3GLX A;  2VUB A;  2DTH A;  2M9U A;  4M77 B;  1M8V A;  3OYH A;  4WHU A;  2OUO A;  2XKO C;  4N4H A;  4TYL A;  4UYD A;  5IBN A;  4J6W A;  4M75 A;  3P5O A;  2FVU A;  2L84 A;  3MEV A;  5CFW A;  3H6Z A;  3CC4 T;  3NTI A;  1N9R A;  3OYJ A;  2DPP B;  1PSE A;  3OYI A;  2LVM A;  3S3N A;  4PJO G;  2QXF A;  1MHN A;  1VIF A;  4M7A D;  3JSC A;  2K3Y A;  2E5Q A;  5E9V A;  4A4E A;  4CUU A;  5HLS A;  3OMC A;  3LQH A;  5L98 A;  4QSW A;  2DVR A;  5D6Y A;  4BE1 A;  1H64 1;  3U5P A;  3CCU A;  3V8L A;  4PNO A;  4XK8 E;  1WQW A;  1LOJ A;  2VGM A;  5GMK i;  4O70 A;  4KCX A;  3OYK A;  4J3I A;  2YEM A;  2DJZ A;  4XTU A;  1Q7Y U;  5L8R E;  5DBM A;  4RCB A;  4QYL A;  4YYN A;  4QSR A;  5A7C A;  4C92 C;  4IOO A;  2DKW A;  3TLP A;  3SVF A;  2CZ6 B;  5LJ3 d;  2HNI A;  4KUI A;  2V8I A;  4DA4 A;  4A4H A;  4BHW A;  3SWN B;  5DY9 A;  4MR3 A;  1X0J A;  3M4Y A;  3HMF A;  1VQO T;  3M4G A;  5CS8 A;  1I8F A;  4PKL A;  3UW9 A;  5CR2 A;  4QQG A;  2D9T A;  2ZPF B;  1RL2 A;  5CKD A;  4ZGE B;  2F69 A;  5HK0 A;  4QC3 A;  4M7A C;  1K73 U;  5ENI A;  2LQ8 A;  1VQP T;  1W2B A;  2EQK A;  2K4Y A;  1I4K 1;  4O5V A;  1XOV A;  2XHC A;  3DKM A;  5CAI A;  5D3S A;  3FEO A;  3LWH A;  4BB7 A;  2LCC A;  3RIR A;  4A4F A;  4LZR A;  2DZ9 A;  2JTF A;  3JAM E;  2PVD B;  3IU5 A;  3NTK A;  4TU6 A;  5E9K A;  3PT9 A;  3U5J A;  3TEE A;  3VKI A;  5KHM A;  1B34 A;  2RA2 A;  5C85 A;  2O4X A;  4A9L A;  4NL3 A;  2R58 A;  5GAM e;  1Q7Y C;  1Y07 A;  4QST A;  4YYK A;  4MMK A;  4CI0 C;  4E7H A;  3S91 A;  5FE0 A;  4KBM B;  3V7C A;  4IUR A;  3WVE B;  4F7U G;  2VYT A;  4M7D F;  2XI9 A;  5GMK e;  3A8L B;  5A5N A;  4BW2 A;  5FE1 A;  4LDF A;  2X4J A;  2O01 E;  3LGF A;  5AD2 A;  5CTL A;  5CUC A;  2LDM A;  3V8K A;  5HRV A;  1D3B A;  2K2V A;  5CKF A;  4CLB A;  1WQ7 A;  3C4S A;  4N0A C;  1K73 C;  2JOY A;  4HXR A;  2DVE A;  1UGP B;  5CKE A;  2YLC A;  5CVI A;  3FB9 A;  3QPH A;  2E6N A;  4ZN1 A;  3V8J A;  4QC1 A;  4NRC A;  4CRI A;  3JVK A;  4RCC A;  2C06 A;  1YIJ T;  4M77 D;  2VXF A;  3RCW A;  4PJO E;  4IUQ A;  3P1D A;  5K29 A;  3UDC A;  2WSC E;  3FKM X;  2QDY B;  5DYX A;  2KY9 A;  2V8J A;  4IUV A;  3U5L A;  1HK9 A;  5IT9 E;  4TT6 A;  2QEX A;  2OSS A;  3G6E T;  1YIT A;  5BT4 A;  2CZ0 B;  4LC2 A;  1FXX A;  4HKE A;  1QVF S;  2RNX A;  3A8G B;  3GNG A;  1BI2 A;  3MO8 A;  5IID A;  3J80 E;  4DON A;  4YH3 A;  4A4G A;  2FB7 A;  3CCM T;  5D3J A;  4EMK A;  4KUD K;  4LYW A;  1NZ9 A;  2RJF A;  5D0C A;  4QNS A;  2P0Q A;  4QR4 A;  4NUE A;  5D7X A;  1HXD A;  1VQ7 A;  5ETD A;  4A9F A;  5EA1 A;  4NRA A;  5KU3 A;  3P1F A;  5G4R A;  4IR4 A;  5M9O A;  1VQ9 A;  2WP1 A;  1JRI A;  3OBW A;  4OB3 B;  2OTJ T;  2P0P A;  3JVL A;  1OZ2 A;  5GAM d;  5LVR A;  4C8Q G;  1WJR A;  4MDX A;  1QP3 A;  5LKX A;  2DD5 A;  3UT1 A;  5KCO A;  3LW5 E;  1N72 A;  3OYY A;  2F5T X;  4M78 G;  1XQH A;  2EJG A;  4M77 C;  3LLR A;  3HKS A;  1BIB A;  2KK4 A;  4OMF B;  4JRQ A;  1G3S A;  1Q82 U;  4O72 A;  3RES A;  2MI6 A;  3P8H A;  2QQS A;  3OYF A;  4VUB A;  1X75 C;  2QA4 T;  1UGQ B;  2ZPB B;  3JCM V;  3DB4 A;  3CME A;  5EU1 A;  3UVW A;  4M7D A;  2IG0 A;  3E9G A;  5FE5 A;  1KHI A;  5DKC A;  3JCM P;  4V2S A;  4YYH A;  4MR5 A;  5ENC A;  5F61 A;  3GNF B;  5CQ8 A;  4LZ2 A;  3S92 A;  1M5Q 1;  4BW1 A;  3AHU A;  1Y96 A;  2E6Z A;  5EIS A;  5D3R A;  5I40 A;  5CQ6 A;  3QJY A;  1ZBX A;  2ZPG B;  2D0Q B;  5II1 A;  5C4Q A;  2YLB A;  4UIV A;  5GAN 3;  1YI2 T;  2RJC A;  4HXM A;  5LJ5 j;  5EPS A;  1D3B B;  5LJ3 h;  4TZ2 A;  1KQ2 A;  3QG1 A;  5F60 A;  4BD3 A;  3SDZ A;  4F7U E;  2DVS A;  2JUF A;  5CUD A;  3S6W A;  4A9E A;  3JRZ A;  4PS5 A;  4QSP A;  4MEO A;  1VUB A;  5ENG A;  3M58 A;  4UYH A;  5A81 A;  1BI0 A;  2BKD N;  4YYG A;  2MWP A;  3MUK A;  2DIQ A;  1Q82 C;  3JCM c;  1Y7X A;  3MP1 A;  2PVO B;  4Q5W A;  4CL9 A;  4J5Y A;  3SWN C;  4ZTJ A;  2EFI A;  3QXE B;  4WF2 A;  1EQF A;  4HA8 A;  3O35 A;  5HY6 A;  4Q0N A;  4M75 F;  1LJO A;  3TCJ A;  2OTL A;  3PTA A;  1VQK T;  4MML A;  4HXP A;  5EM3 A;  4C8Q D;  5II2 A;  5FLX E;  5A0D A;  1I5L A;  2DXC A;  1R8O B;  2RHU A;  2BUD A;  4C92 G;  3QYH B;  4MZT A;  2K3X A;  4NYV A;  1JBM A;  1BKB A;  4FIB A;  2D9E A;  1VQ8 A;  4N3W A;  3OMG A;  2LRQ A;  1KQS S;  5F1H A;  5IGL A;  1G3T A;  5D26 A;  3P8B B;  5GAO n;  1YHQ T;  5IAY A;  4PLL A;  1VIE A;  3OS0 A;  3MB3 A;  3NXB A;  5H1U A;  3MXF A;  4MR6 A;  1X6O A;  4M7A G;  4PCI A;  3MHX A;  4WIV A;  4O75 A;  5DKD A;  2MF2 A;  1ZS5 A;  1VQL T;  2JNG A;  2DAQ A;  4Z02 A;  5HQ6 A;  4O7F A;  4LYS A;  4UIY A;  4N4F A;  3O33 A;  4OGJ A;  2L5E A;  4XUB A;  2JTM A;  5F3A A;  1I81 A;  1S72 A;  4OGI A;  2DVV A;  3BW1 A;  3CCS T;  1F68 A;  5LKZ A;  1QVG A;  4E47 A;  5EWH A;  3HHT B;  5I88 A;  4C8Q E;  3OW2 S;  5GAN 2;  1IRE B;  3CCR T;  5CO7 A;  4ZGJ B;  2RI7 A;  4QUU A;  4LRG A;  5HJC A;  2F5K A;  4QBM A;  5EQ1 A;  4M78 E;  3O37 A;  3M59 A;  4M7D B;  1YJW A;  3GIB A;  5D6X A;  5GAN f;  4E7J A;  5J39 A;  2VC8 A;  4J7F A;  5BT3 A;  1Y96 B;  2G4A A;  5E74 A;  5D6W A;  5FRM A;  5L8U A;  3KXT A;  5FE3 A;  3E19 A;  4LR6 A;  1VQ5 T;  1VQ5 A;  4BE2 A;  1WGS A;  2D6F A;  4UYE A;  3UWN A;  5TB6 A;  5L96 A;  5HQ7 A;  5CZG A;  1UGR B;  2YDW A;  4QQ6 A;  5DX4 A;  1N9S A;  2DVQ A;  4X9D A;  5D3T A;  1KD1 U;  4HBX A;  2M0O A;  4QUT A;  2WSE E;  5L97 A;  5GAN j;  4C92 D;  4JLI A;  5ENH A;  4QB3 A;  1V29 B;  4II1 A;  4NXJ A;  2B8A A;  3TRE A;  4TZ8 A;  2YQD A;  2VXE A;  2K57 A;  3P8D A;  3U5M A;  4QZS A;  5FDZ A;  1WNL A;  4CUQ A;  3CC4 A;  4XTX A;  5CQA A;  1WJS A;  3Q2F A;  2RHY A;  4XU0 A;  4CFK A;  5D25 A;  5GMK h;  4LD9 K;  3FJP A;  5FU6 B;  1M1G A;  2Y90 A;  3RUX A;  5GAO l;  3RER A;  5HRX A;  5GAM g;  2LC4 A;  5I7Y A;  2Y4X A;  3L1A A;  4A9M A;  5HCL A;  2FSA A;  2E7N A;  4PCE A;  3A8M B;  2RH2 A;  4MDW A;  2EQU A;  1AHJ B;  5IN1 A;  3CXC A;  2LSP B;  4YYJ A;  3BY7 A;  3SFM A;  5I1Q A;  3CCE T;  4LDX A;  3T9N A;  2RK2 A;  2GF7 A;  2E41 A;  2V8K A;  3JCM e;  3QJ6 A;  2I2L A;  3CCJ A;  2RHX A;  4C92 E;  3CCJ T;  3MUL A;  1YJN T;  1KD1 C;  3CC2 T;  4HCC A;  1TH7 A;  2CS7 A;  5J26 A;  3HL8 A;  3MEU A;  3JB9 F;  4UYF A;  4C5I A;  4YYM A;  3M5A A;  3OYD A;  4BAC A;  5FG5 A;  3LX7 A;  3FRN A;  4UIT A;  1FWZ A;  4YY6 A;  2RJD A;  3QZ9 B;  1VQO A;  4M77 G;  3UVY A;  5CPE A;  4JJN K;  4HCZ A;  4Q0O A;  4M7A E;  3DB3 A;  5D3L A;  3QUI A;  5A83 A;  5LJ5 e;  3JCM X;  4ZC9 A;  4D6W A;  1VQP A;  4HT8 A;  3CPF A;  1X01 A;  5E9Y A;  5EI4 A;  4CUS A;  1VQ4 T;  4FT4 A;  4AKN A;  4LDY A;  4IUU A;  5FH6 A;  4YC9 A;  3OSS C;  3ER0 A;  4NRB A;  3OYM A;  5KCH A;  3VJP A;  4QYD A;  2WSF E;  2RI3 A;  4Y28 E;  3EFS A;  5GAN 4;  4PJO F;  4OB1 B;  3LJW A;  3QYG B;  2DXU A;  3D7C A;  5FH8 A;  3C94 A;  4MEQ A;  4XYA A;  2JZ2 A;  1VQN A;  2PUK B;  1VQN T;  5DW1 A;  2EIF A;  2G3R A;  1M4Z A;  3SVG A;  2PUO B;  5F36 A;  4M7D D;  4NR5 A;  3JB9 I;  4HXK A;  4HXN A;  3UV4 A;  3JVM A;  3PIP A;  5KTX A;  2I7K A;  5GAN g;  4L59 A;  3R6O A;  3G0L A;  5FB1 A;  3WXM B;  4M75 B;  5HM0 A;  3GPL A;  5GAO r;  4YAX A;  3RMQ A;  3JCM d;  5E3G A;  4YBM A;  4R55 A;  3V7S A;  4QR5 A;  5EWW A;  3A8O B;  3DLL A;  4DOV A;  4PTB A;  1WJQ A;  4O6J A;  2R5A A;  1JB0 E;  4C0G A;  2XD0 A;  5HRW A;  1YIJ A;  2L85 A;  5DYA A;  2YHT A;  4RG2 A;  5I89 A;  3X26 B;  4OB0 B;  5D3P A;  3G6E A;  5CQ5 A;  2CKK A;  4X34 A;  4IOQ A;  5FBX A;  4UIW A;  4NR6 A;  5HQ5 A;  5C6S A;  4J7I A;  5LJ5 d;  3O34 A;  3M53 A;  1O75 A;  5GAO p;  5A82 A;  4YTL A;  3UVD A;  2EQJ A;  5IGN A;  3X28 B;  4OGC A;  5FFY A;  3CCM A;  3QZT A;  4J6X A;  5CUG A;  1OYX A;  4EMH A;  4UYF B;  5FB0 A;  4BE0 A;  2DWW A;  4BJX A;  2R57 A;  3WVD B;  4M7D C;  5C0M A;  5FH7 A;  2YW5 A;  5I29 A;  3QO3 A;  5A5S A;  2XU8 A;  2R5M A;  4IOR A;  4OP0 A;  3EAE A;  1VQM T;  3JCM f;  3MEW A;  5EPB A;  4JUV A;  1OI1 A;  5I80 A;  2OTJ A;  5EP7 A;  5HEM A;  2DKG A;  5CU8 A;  5I2M A;  3AAD A;  3JCM J;  3INZ A;  3CD6 T;  2GFA A;  1JJ2 S;  3J81 E;  1XNI A;  3HRS A;  4M77 E;  2M16 A;  4F7U F;  2LNV A;  3HRT A;  4TS8 A;  5GAN e;  4UYG A;  4HBV A;  5D3N A;  4XY9 A;  3M57 A;  2KMT A;  4O7C A;  4JRK A;  2X35 A;  4PJO A;  2QA4 A;  5ENF A;  3ZBD A;  5LJ5 f;  4J0S A;  5F2P A;  2E65 A;  2ZPH B;  1B34 B;  1Q81 U;  2O4X B;  1IZ6 A;  5I83 A;  2RO1 A;  5E0R A;  3LGL A;  1NE8 A;  1UB4 A;  4LDW A;  4DQ2 A;  3I55 T;  5GMK l;  1BYM A;  4ALG A;  5HK3 A;  3VU3 C;  5CK9 A;  5E7D A;  5GAO m;  5FRN A;  1LNX A;  4ZN3 A;  3JB9 H;  2MAM A;  5I7X A;  5FU6 C;  2KSS A;  4BDZ A;  5AD3 A;  4XTY A;  5CUA A;  1YI2 A;  2PQW A;  2E70 A;  1M9S A;  3VYH B;  4C0D B;  4A9H A;  1N8R U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...