4NS5A

Crystal structure of human bs69 bromo-zinc finger-pwwp
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
209
structure length
185
Chain Sequence
b'QEMGTYLRFIVSRMKEVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPNHELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDELELHQRFLREGRFWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc finger MYND domain-containing protein 11
publication title Crystal structure of human BS69 Bromo-ZnF-PWWP reveals its role in H3K36me3 nucleosome binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 66
structure length 185
sequence length 209
ec nomenclature
pdb deposition date 2013-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4ns5A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ns5A02
4IUQA 4DONA 5DFBA 3L2QA 4TZ2A 5CQ3A 4O77A 4C66A 5DLZA 4LYWA 2RJCA 5CQAA 4QSXA 4TQNA 5HJCA 2G4AA 2YYNA 1SSFA 3OYBA 4QW2A 4C5HA 2RNWA 5ENHA 5FFYA 5E73A 4C67A 5HQ5A 2OSSA 5AD2A 5HFRA 3OS2A 4CFLA 1RI0A 4MR5A 4MEOA 5J0DA 4LZRA 4A9LA 4IR3A 2BUDA 2YEKA 2BIVA 5FE5A 4ZTFA 2RI7A 4OUFA 4N4GA 4UYGA 5CY9A 3O34A 5DYAA 3MEUA 5ENCA 2MWPA 4QUUA 3IU5A 1EQFA 5ACYA 4RVRA 5FROA 2L3RA 3UV2A 5CUCA 4A4EA 5D0CA 3NTIA 5J39A 4LD6A 4NR7A 3P8DA 3OYKA 2YRVA 5EPRA 5L99A 4TT4A 3OYIA 3P1CA 5LKXA 2RI5A 5DBMA 3UV5A 3OYNA 5FDZA 1JSPB 4LDFA 2R0VA 5DFCA 5CQ8A 5FE1A 4O7FA 4NUDA 3TLPA 2E6NA 4BDYA 5F61A 4MR3A 2GFUA 3UWNA 3RCWA 5BT5A 4NYXA 3S3NA 4HBYA 4QR4A 4A4GA 1H3ZA 3OMGA 3UV4A 4IR5A 5FB0A 5FH8A 5IIDA 2K3XA 4TT6A 3ME9A 2LTOA 4J1PA 4QSSA 4CUTA 3U5PA 4NYVA 3MO8A 4Z1QA 2DATA 4BW2A 3OYLA 4PKLA 5IGMA 2RHYA 4QYDA 5D6WA 5DYXA 4J0RA 5FRNA 4NR9A 5DKHA 5LJ0A 5EPSA 3S3OA 4NR5A 4L59A 4HXKA 2GF7A 5AD3A 3MULA 2NXBA 2X4WA 2RHXA 2D9TA 2RO1A 3LGLA 5C4QA 4QC3A 5FG6A 2DVVA 3C4SA 2M0OA 4J3IA 4X2IA 5D3LA 2FSAA 2RJFA 5FE4A 5EM3A 2IG0A 4QSVA 5FE0A 4QVZA 5D3SA 5J26A 2DVSA 4C5GA 5KU3A 2DVRA 3H8ZA 4MEPA 5K29A 2DAQA 3O36A 2P0KA 3QZVA 4E7HA 4KCXA 5CQ5A 3DAIA 5LVRA 5DW1A 5I7XA 5EPBA 4E7KA 5F63A 2E5QA 4ZTJA 2DIQA 2CKKA 4FU6A 5M9OA 4PTBA 5I7YA 3U5OA 4O7CA 5E9LA 5E9IA 4PL6A 5IGLA 4TT2A 5JI8A 2R57A 4Z6HA 4XY9A 4ALHA 4XY8A 2QQSA 3OYMA 3OYDA 5F1HA 4HBVA 4NRAA 4HXRA 2HQEA 5CP5A 4CUQA 3NTKA 4LYSA 3DB4A 3BDLA 4Z1SA 3P5OA 4EDUA 3SVFA 4ALGA 5IAYA 4B9XA 4QEWA 5E7DA 4ZW1A 3LQIA 4NRBA 4MR6A 5EV9A 4QUTA 4TU6A 5I83A 5L96A 4YC9A 5EI4A 3HMFA 4CUPA 2NLUA 4PLLA 4RG2A 4BE1A 5EP7A 5C6SA 5E3GA 5L98A 5F25A 5ENBA 2R5AA 3KUFA 5CUAA 5EWWA 2DKWA 2LRQA 5D3JA 3OS0A 3O33A 5CUDA 3S6WA 3META 4A9MA 3LX7A 5H1VA 3DLMA 3MQMA 5FB1A 5A82A 2E7OA 5DLXA 5F62A 5HENA 2F5KA 3Q2FA 2O4XB 4BDZA 5IBNA 4YYDA 2YELA 4IR6A 5A5NA 2EQJA 4YYKA 5D3TA 4NRCA 5IG6A 5KTWA 3PMIA 3S92A 3U5LA 3S3MA 3OYJA 4ZC9A 5EWVA 3MP6A 4Q5WA 5COIA 4N4IA 3JVMA 2RO0A 5EWCA 2MJVB 1JM4B 5CRMA 4YADA 4B9WA 5LJ1A 4HXOA 4UITA 5DKDA 2LSPB 4YH3A 5EWHA 3OYFA 2BKDN 5CQ7A 5LKZA 1X0JA 5EVAA 4O74A 4LZ2A 5FE3A 3OQ5A 3OS1A 3SVGA 3UVDA 1WUGA 3LJWA 3AADA 5C87A 4HXPA 4YH4A 5KO4A 3QJ6A 4OGJA 4LC2A 5CQTA 5A85A 2EQMA 3U5MA 1N72A 5A5PA 3QKJA 3HMHA 3LGFA 3LH0A 3PFSA 4N3WA 5EISA 2RNXA 4KV4A 4HBXA 2QQRA 5KE3A 4QEUA 5E9YA 4UYHA 3H6ZA 3UVXA 3L2VA 5ENEA 2L89A 3MEAA 4E7JA 4YAXA 5F1LA 2X35A 4BE0A 2DVQA 3QIIA 1N27A 2EQKA 5E9MA 2DIGA 3OYAA 5FFWA 4MEQA 3PNWC 2WP2A 5EU1A 4AKNA 4A9HA 3FEOA 4IOOA 4A9EA 5I1QA 2H60A 5KCHA 5D3HA 4A4HA 5I89A 3LXJA 5DFDA 2E3KA 2RI2A 5F2PA 3FLGA 4IOQA 4PCEA 5CFWA 3NTHA 4NQMA 5G4RA 4UIZA 5II1A 5D3NA 3GOXA 5HELA 5D24A 5LVQA 4CUSA 5CUBA 4Q0OA 3AQAA 5DYUA 5FG5A 5I40A 2EKOA 4CUUA 3IU6A 4QQ6A 3P1DA 5EK9A 2YDWA 5ENJA 2LVMA 4PS5A 4O78A 2GFAA 2RI3A 5HEMA 4HXSA 3UT1A 2L85A 4YYMA 5AMEA 5C85A 3L2RA 4YYGA 1WJQA 4CURA 4BW4A 4TU4A 3OB9A 5CQ6A 5FE8A 3L2UA 5HRVA 4X34A 5KTXA 5HLSA 5I29A 4YBSA 4UIWA 4HBWA 4WHWA 4QB3A 4BHWA 5A5QA 5A5OA 2RFJA 4MR4A 5BT3A 4IUPA 5D6XA 1F68A 5FE6A 4BE2A 4YY4A 3UVYA 2YQDA 4CFKA 4IKFA 4CRIA 2I7KA 4BD3A 4O71A 3QZSA 4GY5A 3O37A 4OVAA 5TCMA 5CPEA 4N4FA 4E96A 2HQXA 3G0JA 2GRCA 3MB4A 2G3RA 2LDMA 2I8NA 4UC4A 2R0YA 5TB6A 4XUAA 4ZQLA 5AMFA 3O8VA 4IUTA 5E3DA 5FFVA 4F3IA 3S91A 3JVJA 3OMCA 2EFIA 5HFQA 2M1HA 3D7CA 4A9NA 5DYCA 5LJ2A 2RHUA 4C5IA 4IUVA 3MXFA 4QSWA 4YBTA 2LCCA 3L2WA 4Z02A 5CRZA 5FE7A 4Z93A 5D25A 5DW2A 5D3PA 5CU8A 3JVKA 4QSPA 4QR3A 4A9FA 2M16A 1E6IA 1OI1A 4O7BA 4NQNA 5C0MA 4HCZA 4NS5A 3LQJA 5FH7A 2OO1A 4UYFA 1OYXA 5L8TA 5ETBA 4YABA 4FLPA 5CUEA 4CL9A 2VYTA 4C5EA 2RJEA 4NYWA 4O75A 4YY6A 2D9EA 4N4HA 4A9IA 2F6JA 4O72A 3UVWA 3M9QA 4QQGA 3OYGA 4YYIA 4QSUA 4KV1A 3LLRA 4GPJA 2RNYA 5ENGA 4OGIA 5ETDA 4IR4A 5C89A 4FL6A 5I88A 2PQWA 4QQDA 5I86A 3E9FA 4BJXA 5KCOA 1MHNA 3K2JA 3L42A 5L97A 1ZS5A 5A81A 4UYDA 3QZTA 2D82A 5E74A 2E7NA 4LRGA 4YBMA 3G0LA 2XDPA 1KHCA 5IN1A 4A9KA 2OUOA 3FKMX 3O35A 5F60A 1WUMA 5IGKA 5A7CA 3ZYUA 4TZ8A 2YW5A 3P1FA 4QY4A 2KTBB 4NR4A 5F36A 3EAEA 3DB3A 3I3JA 5FG4A 5H1TA 2XK0A 3UW9A 2EQUA 4YK0A 5LKTA 4NUEA 4HXNA 4YYNA 4LYIA 4E7LA 5ENIA 4MENA 5DKCA 3OYCA 5JWMA 5FBXA 5LUUA 2R58A 2R5MA 3OA6A 3NXBA 4E7IA 5E9KA 4QR5A 1XNIA 5EQ1A 3MP8A 4LZSA 3LQHA 3F70A 5CZGA 5HRXA 3U5NA 2JZ2A 5FRMA 1OZ2A 4BW1A 5H1UA 4UIYA 4YYHA 3LYIA 5A83A 5CIUA 4A4FA 2K3YA 4Z6IA 5HM0A 4BW3A 5HQ6A 3OYEA 5I80A 5HQ7A 2JTFA 3HMEA 4BACA 4QNSA 4QBMA 4NXJA 2R10A 4O7AA 5IGNA 5EWDA 5CS8A 2F6NA 4QC1A 3Q1JA 4HXLA 3GG3A 5G4SA 4YYJA 2FHDA 2X4XA 2WP1A 4IUUA 5FH6A 5KH6A 4A9OA 3U5KA 4QSRA 2L5EA 3MEVA 4IURA 4XUBA 4QSTA 5F5ZA 4NR8A 4UYEA 4HXMA 4O70A 2N9GA 5EGUA 5D3RA 3PMTA 4TTEA 5FE2A 4WIVA 4LR6A 1WJSA 3JVLA 2WACA 3P8HA 3Q2EA 2L84A 2L8DA 4NUCA 4A9JA 4TYLA 3MEWA 3ZEHA 2X4YA 4II1A 4UIUA 5C7NA 5D6YA 4TS8A 4CLBA 3U5JA 3CEYA 5CUGA 4QSQA 4UIXA 5E9VA 5DY7A 4XYAA 4O7EA 5H85A 1OZ3A 5EICA 3MB3A 4O76A 5II2A 3FDRA 5HCLA 5D26A 5LKUA 5KHMA 5KE2A 4Q0NA 3SVHA 2B8AA 4PY6A 1G5VA 3MP1A 5HRWA 1WGSA 3SD4A 5F3AA 3E9GA 2YEMA 2R0SA 3P1EA 4Y03A 2MWOA 5L8UA 4QYLA 4QEVA 5A5RA 5FE9A 5E0RA 5DX4A 3FC3A 4NR6A 5C8GA 1WJRA 3OY9A 2DWWA 5CGPA 4UIVA 2RJDA 5EA1A 5KTUA 4QZSA 2RHIA 3MUKA 3OYHA 4J0SA 5CQ4A 3DWYA 4YATA 5ENFA 2RHZA 3ASKA 4PLIA 3QBYA 4UYFB 5CTLA 4WHUA 3ONIA 2RS9B 5BT4A 5D7XA 2O4XA 4IORA 5A5SA 4PCIA
chains in the Genus database with same CATH superfamily
1VQMQ 3L2QA 4PJOF 2ZZDA 4LYWA 2RJCA 2VC8A 1N8RU 1LVKA 2G4AA 5EC7A 1IHVA 5IH2A 4M77B 1ZSZA 3EGXA 1K73U 2RNWA 5ENHA 4C67A 2OSSA 5KYXA 4FYWB 3MCAB 1RI0A 4MR5A 4MEOA 4C0FA 1M3CA 2DL4A 1PWTA 3CCET 2BUDA 4OB3B 1R77A 2YEKA 2BIVA 4J8OA 5FE5A 4ZTFA 4OUFA 4UYGA 1QWFA 4PFZA 3O34A 1M2OA 2EGEA 5ACYA 4RVRA 5FROA 2DO3A 5A0DA 1D1BA 3UV2A 3GNFB 4A4EA 5D0CA 3CMAT 3I55T 3RKXA 3LWIA 3OYKA 3P8DA 4WCIA 1VQ8Q 4TT4A 3OYIA 3P1CA 2JMAA 5DBMA 3EFSA 2GCXA 1N9SA 4N0AA 5CQ8A 5FE1A 3QYGB 3TLPA 3D7SB 2F2XA 2E6NA 3LWHA 1K4US 4M77E 1EX4A 3RUXA 3S3NA 4HBYA 3LH5A 2F1LA 4A4GA 3UV4A 5FB0A 3TVTA 4TT6A 2LTOA 5J3BA 1NLPC 4A53A 1GXIE 2BE9B 1NJIR 4V2SA 5DYXA 1VQPT 5EPSA 1BI0A 2KT1A 2QG9B 5AYFA 2GF7A 2LNVA 5LJ3e 3JCMb 2X4WA 1YITQ 1NG2A 2LJ3A 1S1NA 1B3QA 3HFNA 3VS1A 5C4QA 4QC3A 4PJOG 2M0OA 3DLLA 5GAOl 5DM7R 4J3IA 4X2IA 5KYWA 1NYGA 2E10A 4QSVA 4TVRA 4BI3A 3QO3A 2DVSA 5KU3A 1YP5A 2B86A 1C0MA 4KUIA 1PD0A 4OB1B 1IREB 2Z0WA 4FYYB 1M1FA 4KUDK 4RTVA 5I7XA 2DIQA 2EAYA 5M9OA 2JT4A 4J9BA 3EG9B 5IGLA 4TT2A 5JI8A 2R57A 4ALHA 1T0HA 5KYUB 4HBVA 2HQEA 1K8AR 4LYSA 3P5OA 2DRMA 2AIRB 4B9XA 2KXDA 2RQUA 5E7DA 3HL8A 5EV9A 4TU6A 3SFMA 2LQNA 2PNIA 1ABOA 1RAHB 5C6SA 3RMQA 5L98A 3WVDB 3KUFA 4D8DA 3ULRB 2RB6A 5D3JA 3OS0A 3S6WA 1WNLA 1V76A 3META 3MQMA 5FB1A 2CUDA 5DLXA 3EGUA 1O9SA 1VQOT 4YYDA 5A5NA 3GPLA 1KQSS 5KTWA 3L2ZA 2RD1A 4XQ3A 1G3WA 2OX7A 1UFFA 1X6BA 4OMFB 2SEMA 3JVMA 3CD6Q 1JM4B 4KH1B 4OMNA 4HXOA 4M7AC 2BE7D 1YJNQ 1WHJA 1PM3A 5D7UA 2FPEA 1NJIU 3EH2A 3CPWA 2QTXA 1X0JA 1ZHIA 3CXCA 4M75F 4EMKB 3RERA 5GJWB 3OS1A 1X01A 4AFUC 4X1VA 1OV3A 3LGFA 1BK2A 3PFSA 1VQ8A 1OPKA 3CMAQ 4N3WA 1N8RC 4AKIA 4KV4A 2QQRA 3CC7Q 1KG1A 1WFWA 5E9YA 1O75A 3H6ZA 2YRCA 5CQXA 1HD3A 1B34A 2EJGA 1ZKRA 4YAXA 4JDSA 4BE0A 3QIIA 5FU7B 2QEXT 2M02A 2YSQA 5FLXE 1VYTA 5FFWA 4MEQA 1UDLA 1YWPA 3CMEQ 1K8AU 4AKNA 4A9HA 4L6V5 1M2VB 3LXJA 5DFDA 5HY6A 4AKHA 2RI2A 3FLGA 2FB7A 3GNGA 1YITA 3CCMT 1VQPQ 3NTHA 5GMKm 3HRSA 2DXUA 3HKSA 5G4RA 2IVWA 4NL3A 2DPPB 2DKGA 3VUZA 2OTJT 5D3NA 3GOXA 5LVQA 4CUSA 2VXEA 5I40A 5DYUA 4RTWA 4M77C 2L3SA 2QAZA 1OEBA 1UECA 2A37A 4ELYC 1XOVA 2YWWA 1W2BP 5ENJA 2RI3A 5GAMf 5C85A 3HRUA 3GF5A 4M75G 4M7AA 1W6XA 3V8KA 4ZGDB 4KT0E 2DYBA 5HLSA 2DBKA 2YXYA 4WHWA 3CPFA 5A5OA 2ZPBB 4RMOA 1UEBA 2HQHA 1AVZC 4K11A 2LNHB 5CO7A 4YY4A 4CFKA 2YQDA 2DYIA 1Y07A 1VQ5T 1NYFA 3UA7A 5LJ5e 3JB9H 4O71A 4GY5A 4OVAA 5TCMA 4HT8A 5CPEA 4N4FA 1VQKQ 5GANj 3ER0A 2KSSA 4UC4A 1T0JA 3CC2T 1TS9A 5A0LA 4ZQLA 2O31A 4IUTA 5E3DA 2WSEE 1Q82R 4DA4A 5HFQA 1N6AA 4MZTA 2EYQA 2RHUA 4E2FB 4IUVA 4OMOA 2PVGB 1VQOQ 3QXEB 5CRZA 2RMOA 2ESWA 3CD6A 3JVKA 1E6IA 4PNOA 4O7BA 1YJNA 4HCZA 1K9MU 1YWOA 1OYXA 4UYFA 2EGAA 2E12A 2COZA 4FLPA 5CUEA 4CL9A 2VYTA 1Y96B 1Q7YU 2E5KA 4N4HA 3QWXX 3CCJT 1VYVA 3OYGA 4YYIA 2D6FA 4PJOD 1FXXA 1IRXA 4RTYA 4M77A 2C06A 2CT3A 5CK9A 5I86A 3E9FA 3CC7A 4BJXA 4A4KA 1MHNA 3K2JA 1KQ1A 1NPRA 3EGDB 2HKNA 2CUBA 4E6RA 1R0CB 4DOWA 4YBMA 3G0LA 1KHCA 4A9KA 3JCMh 2VUBA 2J7IA 1WUMA 2DD4A 3OW2P 2DRKA 1OX9A 2PZ1A 3CMEA 2KTBB 2EBPA 4NR4A 1VUBA 3M54A 3JCMQ 2A0FB 3VV0A 3RDVA 5GAN2 2HAXA 1TOVA 4M7DB 1ZX6A 1V1CA 5ENIA 5LUUA 1KQ2A 4FM4B 5E9KA 4QR5A 3MP8A 3PGGA 4LZSA 4JUVA 5FRMA 3QDRB 3RBBB 2OAWA 4LUDA 2OTJQ 1M5Q1 4AT1B 1CKAA 1Q82U 5A83A 1QKWA 3SDZA 1U8RA 2JNGA 1RAFB 1K8AC 1M1KR 4RCCA 4BACA 4QNSA 2KGTA 4GLKA 6AT1B 4NXJA 1TU0B 2L3PA 4C92C 4QC1A 1M1GA 5GMKe 4HXLA 5G4SA 2VKNA 4EMKC 5GANh 1K0XA 2WP1A 4IUUA 2MI6A 3JCMV 1SG5A 4OGCA 4LD9K 5F5ZA 1H3HA 4NR8A 4UYEA 5EG2A 3G71T 4O70A 3JB9D 2DM1A 5D3RA 1MUZA 4F16A 8AT1B 4WIVA 1VQKA 3JSCA 1WJSA 5L8RE 3P8HA 4J9IA 1Q86R 3MEWA 3EG9A 5D6YA 3CEYA 3FJ5A 2HBWA 3G4SA 5CUGA 4UIXA 2LJ1A 5KYUA 5FU7C 1NPPA 2JJ9A 1KD1R 4JRQA 1ACMB 5HCLA 5KHMA 2GGRA 4JRPA 4OMPA 3CXCS 1G5VA 3JCMc 3U23A 5LL6S 2XI9A 2F2WA 5F3AA 3E9GA 1SRLA 2R0SA 4Y03A 1YHQT 4NOYA 2XDDA 5FE9A 5E0RA 3M53A 1Z9QA 3OY9A 4C8QB 1QVFA 2DWWA 5CGPA 2QQBA 5EA1A 1WXBA 4QZSA 4WTOB 3M56A 2M51A 2OJ2A 3OYHA 4J0SA 2CH4W 4YATA 1UUEA 4PLIA 3QBYA 4VUBA 4ESRA 3SWNB 5BT4A 5D7XA 3NFCA 3KXTA 5A5SA 4FCYA 4FT2A 4KBMB 4IUQA 4DONA 5DFBA 1SRMA 2LQKA 3JV3A 3TREA 4KULA 2CH4A 5DLZA 3UF4A 1WHKA 3NPFA 2CP2A 4QSXA 1UTIA 4XU0A 2YYNA 4RTZA 2CSIA 1U3OA 4QW2A 4C5HA 5HQ5A 1D0YA 5E73A 5AD2A 3OS2A 4CFLA 4PJJA 3JCMg 4AFSC 2QDLA 4LZRA 1QVFP 1X27A 4EMKA 4FT4A 3M0RA 5GAN8 4M75D 3UPUA 2KRMA 1VQLQ 3P8BB 1C1AA 4NL2A 5ENCA 4QUUA 3CBPA 4C8QE 2FRWA 3G6EA 1N9RA 4FSSA 1KQSA 2L5QA 2D8HA 5GAN7 1VIEA 5J39A 1FX7A 4XTYA 3JAME 4EMHA 2YRVA 1AWOA 5I21A 5EPRA 2KROA 4EPCA 1JO8A 5LKXA 2DXTA 1HK9A 2XHCA 1AZEA 4LDFA 2OTJA 2R0VA 5DFCA 1QVPA 2DJQA 4NUDA 2DFUA 2RN8A 4BDYA 1K76A 2M9UA 4DBHA 3UWNA 1D1CA 3JCMX 2C0TA 1ZBJA 3JCMP 4IR5A 1GFCA 2K3XA 1UGPB 2DEUA 1VQ4Q 3VS3A 3EG0A 3U5PA 1GRIA 3MO8A 4Z1QA 2EQIA 1YJ9T 5GANg 2DATA 3OYLA 2RHYA 5D6WA 1M90R 3VKHA 2RNAA 3S3OA 4NR5A 1PCXA 4L59A 4HXKA 5AD3A 1BCMA 4ORZA 3MULA 2DF6A 3V8LA 2D9TA 1MNDA 3RESA 3LGLA 2CREA 1BKBA 2DXCA 3G71Q 2RJFA 2FSAA 5FE4A 5D3SA 1IXDA 1Q82C 2DVRA 4MEPA 3QDFA 3G1JA 3N5BB 2P0KA 3QZVA 1HJDA 5LVRA 5I2MA 5EPBA 2QQAA 5F63A 2E5QA 4ZTJA 1T3LA 4CC2A 2JN0A 4FU6A 3MHXA 2L0AA 4O7CA 5E9LA 4PL6A 3VU3C 1N5ZA 4N0AC 4HCCA 4HXRA 5CP5A 4CUQA 3NTKA 1QMCA 1QLYA 2CP5A 4EDUA 1YI2Q 3NGPA 3OSSC 1X69A 3LQIA 4MR6A 3E19A 4QUTA 5I83A 4YC9A 3CBMA 2EGCA 5F25A 3M0SA 5ENBA 1R0BG 1RL2A 2LRQA 4ZGEB 1I8FA 5DLQE 4F7UB 3O33A 3FJPA 1YIJQ 3VYHB 1TWBA 1H8KA 3CCUT 5A82A 1UGVA 2E7OA 5F62A 2F5KA 3VJPA 2O4XB 5IBNA 2K7AA 4IR6A 4NRCA 3M58A 3OYJA 1QVGP 4JJCA 2XKOC 2DE0X 1UGRB 4Q5WA 4DBFA 1Y96A 3SEMA 5EWCA 1IGUA 5GAOm 2MJVB 5CRMA 5LJ1A 1VQLA 4UITA 2AZSA 5DKDA 3CBOA 2LSPB 2PVOB 3OYFA 1TXQA 1YCYA 4O74A 4LZ2A 5FE3A 2MK5A 3EHQA 3REBB 1UJYA 3GLXA 1WUGA 5KO4A 4OGJA 2BZ8A 3EGDA 4PKCC 2EW3A 5A5PA 5GAN3 3LH0A 2JMCA 4J9EA 3TCJA 5LJ3d 4F7UE 4PJNA 2RNXA 4OMQA 5KE3A 3A8GB 1SHFA 3I9QA 4HKEA 1M3BA 4JJBA 3UVXA 3L2VA 1M1KC 3MEAA 2AHJB 2KXCA 4E7JA 3JB9I 3JCMd 2DVQA 2X9HA 5GAN4 1AT1B 2EQKA 5E9MA 1X2KA 3QG1A 3PNWC 1VQ4A 2WP2A 5EU1A 3BFMA 4M7DA 4IOOA 4KH0B 2PUOB 4C8QC 4A4HA 5I89A 2E3KA 2E3IA 4IIOA 2JW4A 1A0NB 1MGQA 2DMOA 3CCLQ 1I0CA 2AKLA 4PCEA 3I56T 4C92F 1XTDA 1ZUKA 4NQMA 4UIZA 1Q86C 2QQ9A 2J6OA 1QP3A 1HYOA 3IU6A 3VS7A 1KD1C 3JB9F 2CZ6B 2YLBA 3VS5A 4O78A 1KC8R 1FMKA 5HEMA 4HXSA 2P4TA 2C0IA 1F1BB 5AMEA 2GTOA 3X25B 1QVFS 5GAOr 2L2PA 4CURA 4TU4A 3L2UA 5HRVA 2BTTA 5GANd 4UIWA 4HBWA 4QB3A 5D6XA 2EYXA 5BT3A 2RFJA 1YI2A 1F68A 3V7CA 1QCOA 1SHGA 1W70A 1AWWA 3UVYA 1D3BB 4IKFA 3PT9A 1G2BA 2MPXC 3QZSA 3TQ7P 4JJDA 1BI1A 4ZGJB 3T9NA 1VQ6Q 3GP8A 2GRCA 7AT1B 4E47A 1VA7A 1KHIA 1YIJA 2V26A 4XUAA 2JOYA 1UG1A 3G7ZA 2MYSA 2NUPB 2FL7A 3JVJA 1VQMA 2M1HA 1P92A 4KGXB 3D7CA 2GQIA 5DYCA 4JPBW 2D0NA 2EYZA 3MXFA 4QSWA 1T3SA 3A98A 5CVIA 2LCCA 1WHGA 2FYKA 3L2WA 4Z02A 2L3QA 4C8QA 2MAMA 5CU8A 4QSPA 1FMWA 3H0HA 4RCBA 4QR3A 2KRSA 4C92G 2M16A 1OI1A 2EJFA 5C0MA 3RR6A 3TSWA 2DL3A 5FH7A 2OO1A 3CQTA 5GAMe 5L8TA 3E1SA 4M7AD 2J6FA 3SWNA 3CCEQ 4C5EA 2RJEA 4O75A 4YY6A 2JTEA 2KE9A 3J81E 2K6DA 2KDSA 4O72A 4JZ3A 3UVWA 1JJ2P 2OTLT 2EKHA 5I11A 4QSUA 4KV1A 3JB9G 3CC4T 3R6OA 4J5YA 4IR4A 3CCST 4QQDA 2W0ZA 3HPWA 4AMCA 3I55Q 5L97A 2VGMA 3EG2A 2K57A 2KR3A 1KC8U 2D82A 1ZUUA 1GBRA 2ED0A 1IHWA 2K5FA 1BYMA 4M78B 1VQ9T 1VQ7T 4BI8B 1M90C 1M30A 5LJ3j 1KSWA 3BY7A 3A8MB 2XK0A 1W2BA 3UW9A 4OGEA 2EQUA 2JXBA 5LKTA 1SSHA 2EVRA 4NUEA 2LX9A 3CCLA 4YYNA 4HA8A 1RLPC 2WSCE 5FBXA 2R58A 2R5MA 3EFOB 4J83A 1HXDA 1U06A 5DLOA 1GCQC 2A3LA 2RM4A 3F70A 5LJ5d 3U5NA 1K0SA 4ATOA 4J9CA 5H1UA 4UIYA 4HT9A 5KYYB 5CIUA 2K3YA 4Z6IA 1WI7A 4M77D 4BW3A 3OYEA 3CCQT 1BIAA 3AT1B 2JTFA 2KYMA 3CCRT 3IQLA 3A8LB 2CP6A 4O5VA 3EG1A 4M78E 2X51A 2R10A 5IGNA 5CS8A 2QA4T 2ZPGB 1NEGA 2YUPA 2X4XA 4E7ZA 2ZPFB 4R55A 4XUBA 2CZ1B 2KY9A 1M8VA 4XTZA 2D8JA 3ZL7C 1S72T 2N9GA 5EGUA 4JLIA 2LZ6B 2BZYA 2QK0A 5FE2A 1PHTA 1Y57A 1VQ6A 2HCKA 1KFZA 3Q2EA 2H8HA 4NUCA 4A9JA 2X4YA 4UIUA 5C7NA 4CLBA 3U5JA 2K9GA 2RK2A 4FIBA 1EZZB 1ZUYA 5E9VA 2KBTA 1WHHA 5II2A 3RKWA 5D26A 2MOXA 2DTIA 2WSFE 4M75B 4PY6A 3JCMJ 2P84A 4QVDA 2LC4A 1Y71A 5HRWA 5DY9A 1BB9A 3PVQA 2V8KA 3TSZA 3TU4K 2GQVA 2E6ZA 5L8UA 1M8MA 3CCVT 1FYNA 3FC3A 4NR6A 5C8GA 3A1PA 4UIVA 3CCEA 4F7UA 4MZPA 3OW2A 4R0KA 1GCQA 4JS4A 2J05A 3ASKA 3GBQA 1XJWB 1NE8A 5CTLA 1VOMA 2O4XA 2OTLQ 4IORA 4A63B 4PCIA 1WHMA 4O77A 4C66A 2LX7A 3I55A 3CMAA 5CQAA 2E41A 5LJ3h 4TQNA 1UHFA 1YJWT 1SSFA 1VQNT 4HCBA 2DTHA 2CT4A 4ZN1A 3KBGA 4FW2A 5HFRA 2O01E 4QT7A 2DL8A 5J0DA 4RKUE 4A9LA 1DJ7B 4LDUA 5CCAA 4XU1A 4C0GA 1QQJA 1U5SA 4N4GA 4C0DB 1QP2A 4AI6A 3MEUA 2MWPA 3IU5A 1EQFA 3HHTB 1D09B 2QEXQ 3THKA 2XG8D 2L3RA 5CUCA 4JZ4A 4PK4A 2HL3A 4Y92A 3NTIA 4LD6A 4XTUA 5L99A 2ABLA 1VQPA 2RI5A 1XQHA 4EIKA 1JSPB 1KC8C 5GAN5 4B6MA 3CCMQ 3RMSA 2MF2A 1MMGA 2XICA 1WHLA 2HBPA 4O7FA 4XK8E 1MNEA 2D0QB 4MR3A 2GFUA 3RCWA 3M55A 4JS5A 4J7IA 3J7AF 2IPOB 4CC7A 1WPYA 3OMGA 1PG5B 4MMKA 5GAN6 1B07A 3CCQQ 4D6WA 4GBQA 4CUTA 3CCRQ 2ZGWA 2NUTB 5LJ5j 4C92D 5IGMA 4DQ2A 2SRCA 5FRNA 4J0RA 4QVCA 4NR9A 2QA4Q 2E70A 2IIMA 2NXBA 2RHXA 1R8OB 3QJYA 5FG6A 2DVVA 2P0PA 4CC4B 2XU8A 3EHRA 4LNPA 4M7DE 4L5GA 3RNJA 5D3LA 4AFZC 3OBYA 3H0FA 2IG0A 5GAMh 5GAOp 2H3JA 4QVZA 1VQ5Q 5J26A 4C5GA 2FRYA 5K29A 3VYGA 1GBQA 4KRTA 4DOVA 3O36A 2HNIA 2NYSA 1AD5A 2ROLA 5CQ5A 3VKIA 4AG1C 5DW1A 3URGA 4IIMA 4E7KA 4M78C 4PTBA 1MV3A 3CC2Q 4Z6HA 4XY9A 2FPFA 5A2QE 4XY8A 1UE9A 2QQSA 3AHUA 3OYDA 1OOTA 1D3BA 1Q95G 3DB4A 5L23A 2JUFA 2RK1A 1VQOA 1D0XA 4E7SA 1ZA2B 4ZW1A 1MMNA 2A7YA 5AT1B 4NRBA 2E4HA 5L96A 2NLUA 4RG2A 4PLLA 5EP7A 3GIBA 2HZYA 3QWYA 2R5AA 5EWWA 2NUPA 4XU3A 9ATCB 1WDXA 4M7AF 1HSQA 3CCJQ 3DLMA 4XTVA 2LMJA 1RADB 5LJ3g 5HENA 4GLMA 2KAFA 5HK3A 1W2BS 5D3TA 5IG6A 4FSXA 3PMIA 3S92A 3U5LA 1YJWQ 2JM8A 4ZC9A 3MP6A 5COIA 3M5AA 2FG0A 3JCMW 2RO0A 1M1KU 1C6VX 2X3XD 4LDXA 4B9WA 3QPHA 3RIRA 5EWHA 2KQWA 1X43A 2I2LA 2BKDN 5CQ7A 5FWBA 5LKZA 5EVAA 2QEXA 3V7RA 2VXFA 4HVWA 2ROTA 3SVGA 3UVDA 3VS6A 2RA2A 3AADA 5C87A 2RQRA 4YH4A 1ZLMA 2JS2A 4X9DA 5CQTA 1WZOA 4RUGA 3QZ9B 5EISA 4HBXA 2O2OA 2EYWA 4QEUA 3CCMA 4UYHA 4LDVA 4M78A 1MV0B 1VIFA 2L89A 5LJ5h 1Q86U 3H41A 2O9SA 4P5NA 2Y4XA 5GMKj 4J6XA 2ATCB 2X35A 3M0TA 2Y90A 1AWJA 3VRYA 2DZ9A 1KD1U 3OS5A 1M2VA 2DERA 1YCSB 2EJNA 4AG2C 4M77F 5D3HA 3QSUA 3EFOA 2RPNA 2OAUA 1VQ8T 2RQVA 3M0UA 4LUEA 1I81A 1PKTA 2DXBA 2QXFA 2XD0A 4DEXA 3A8HB 4M7AG 1SKUB 5II1A 5KYYA 5CAIA 5CKDA 2LQ8A 4OMLA 1M4ZA 5CUBA 3AQAA 1J3TA 1D1AA 1VQ5A 4HVVA 4F04B 4QQ6A 3P1DA 2BZXA 3REAB 1K73R 2HEQA 3M0PA 1LOJA 4J9DA 5IT9E 2LVMA 1ARKA 2DX1A 2GFAA 3UDCA 3HSBA 1KIKA 2J06A 2L85A 4YYMA 4LE9A 2CZ7B 3WXMB 1WJQA 2JVVA 1OU8A 3CC2A 4C0DC 2O88A 4F14A 4BW4A 2ECZA 3OB9A 5CQ6A 4HXJA 4XU2A 1YITT 4X34A 3OW2S 5I29A 3O5ZA 2KI7A 1H641 1E7OA 4ME7A 4MR4A 5IHNA 4BE2A 3FRNA 4M7DC 1RABB 1QVGA 1YHQQ 2HQXA 1WXTA 3G0JA 1G3SA 3MB4A 2G3RA 2LDMA 4HCKA 2FPDA 2DL5A 2R0YA 1EFNA 5TB6A 3D1DA 2ZAEA 3SB2A 3CCJA 4M75A 4J6WA 5AMFA 3O8VA 1TTHB 1K1ZA 3RKYA 4F3IA 3S91A 2HDAA 4CC3A 2DA9A 2KVQG 1SPKA 4M77G 8ATCB 4J6YA 4Z93A 5D25A 5DW2A 5D3PA 1W1FA 1M3AA 4A9FA 3I5RA 1NM7A 1OQKA 4RTUA 1BI3A 5ETBA 1NZ9A 4YABA 2PUKB 4MDXA 4NYWA 2QASA 2D9EA 3MPUB 2DILA 1M90U 3V7SA 3LLRA 4GPJA 2VVKA 5GMKh 4OGIA 5ETDA 1LPLA 3HTRA 5C89A 5I88A 2F5TX 4EMGA 1YN8A 3L42A 1CSKA 3M4GA 4UYDA 1Z9ZA 3QZTA 4Z88A 3CD6T 2C0OA 2YUQA 4FYVB 5LJ5g 2E7NA 1YJNT 3R6NA 3ZFJA 4OMMA 1OULA 2XDPA 1MMDA 5F60A 5GJVB 2VV5A 5A7CA 1AWXA 4TZ8A 3QHSA 2YW5A 3P1FA 1RACB 2EJ9A 4JRIA 4LN2A 3EAEA 2PVDB 2E64A 3I3JA 5FG4A 4R56A 2QDYB 1WQ7A 1WYXA 4YK0A 2KYBA 4C8QD 2RQWA 1PKSA 2LP5A 3OSVA 4RTTA 4HXNA 4LYIA 4E7LA 3CC7T 5GAOn 5DKCA 1IZ6A 1Y7XA 2DZCA 3C95A 1YJ9Q 4E7IA 1XNIA 5EQ1A 3FB9A 3SWNC 3LQHA 5CZGA 3G71A 1OZ2A 1X6GA 2P0QA 1VYUA 3CMET 4A4FA 4J9HA 5HM0A 1JXOA 4F17A 2NUTA 1RI9A 5HQ6A 5I80A 1PD1A 2K4YA 2V1RA 4QBMA 2ZCFB 2LT4A 2F6NA 5IXBA 4XTXA 3GG3A 5FWCA 3PIOA 4YYJA 5GMKi 4M78F 5FH6A 5KH6A 4A9OA 3U5KA 4QSRA 2L5EA 3MEVA 2I0NA 1B7TA 4QSTA 1FWZA 4OF1A 2LJ0A 3PMTA 1YHQA 1X75C 4Z89A 4PJOB 3JCMe 5GAMd 4LR6A 4O6JA 2L84A 4BI4A 3ZEHA 4PJMA 4II1A 1UGSB 1ABQA 1QCNA 1UHCA 3A5ZB 5DY7A 1WIEA 5H85A 1JJ2A 2DL7A 5EICA 3MB3A 3VS2A 4O76A 1PNJA 3FDRA 3D1BA 5LKUA 5KE2A 4Q0NA 2B8AA 5I2SA 4CI0C 2K79A 3MP1A 3CCUQ 3HFOA 1WGSA 4YTLA 1TUGB 3SD4A 2YEMA 3P1EA 2KNBB 2MWOA 4QEVA 1VQKT 5IHIA 1PRLC 3G4ST 3VS4A 5CQ4A 3DWYA 5ENFA 1W4SA 4PJOE 1G3TA 1I4K1 4WHUA 2QYZA 2RS9B 2AKKA 2XDBA 3QZ5B 2ZPEB 5KYNA 1M9SA 1RUWA 1BU1A 4TZ2A 4JRKA 4Y28E 5CQ3A 5GANe 4PFOA 4FYXB 1TH7A 5HJCA 3X26B 2M0YA 3HP9A 3OYBA 2JM9A 5FFYA 2PU9B 5LJ3f 2LQWA 4M78G 4FW1A 4IR3A 4C92B 2RI7A 5FW9A 5CY9A 1I07A 5DYAA 2COYA 3H0IA 2E3HA 3JCMf 2KMTA 3VUBA 2DBMA 2EIFA 2GBQA 2DETA 4NR7A 2CS7A 1YJ9A 2E65A 2KK4A 1K73C 3OBWA 2MIOA 3M59A 3UV5A 3OYNA 5FDZA 4OP0A 3I56Q 5ECAA 1ZBXA 2NUZA 2PTKA 4AKGA 2ENMA 5F61A 3CPWP 1JBMA 3CXCP 5BT5A 4NYXA 4QR4A 2DLPA 1H3ZA 1FMVA 3G6ET 5FH8A 3DKMA 2V8JA 5IIDA 3ME9A 4C92E 4J1PA 1K9MR 1QVGS 4QSSA 2QGGA 4NYVA 1Q7YR 4RG8A 4BW2A 3QUIA 4PKLA 4QYDA 1I1JA 5DKHA 5LJ0A 3VRZA 4D8KA 4JJNK 2RO1A 1YBYA 1KK7A 3C4SA 1YNZA 4ANJA 2YT6A 5GANf 3TEEA 2OI3A 1RLQC 3NHNA 5EM3A 3I5SA 4J9FA 4OB0B 5FE0A 3ZBDA 1WQWA 5CQYA 3H8ZA 4M7DF 5HK0A 3BW1A 3M0QA 2DAQA 1LCKA 2FZKB 1QWEA 4E7HA 4KCXA 2XMFA 3DAIA 2DJZA 1I5LA 1NLOC 2CKKA 2YDLA 5I7YA 3UATA 3U5OA 3PE0A 3X24B 1ZSGA 1PC0A 4HVUA 3OYMA 2YUNA 3VS0A 3CCUA 5F1HA 4NRAA 4DEYA 5GAMj 3BDLA 4Z1SA 2A36A 3SVFA 4ALGA 5IAYA 4MDWA 5CKHA 4QEWA 1ZQ1A 5CKBA 5KCHA 5EI4A 4CUPA 3HMFA 4BE1A 4JLGA 1TG0A 5E3GA 3X28B 1BIBA 4XAXB 1CKBA 1M27C 5CUAA 2DKWA 1G3YA 3G4SQ 2F69A 5CUDA 2A08A 4A9MA 3LX7A 2HMAA 5H1VA 2CP3A 2QGFB 3JB9J 2LT1A 4BUGA 1BBZA 5GMKl 3CC4Q 3Q2FA 4BDZA 2YELA 2EQJA 4YYKA 2K2MA 3CCSQ 3S3MA 1OU9A 2DD5A 1X2QA 2V1QA 5CR2A 5EWVA 3L1AA 4DBRA 4N4IA 2H3EB 1ZSZB 3EGXB 4M75E 2VASA 4YADA 1BCOA 1IB8A 1X6OA 1Q81R 5KYXB 4YH3A 3PVLA 2D1XA 3INZA 3OQ5A 2MCNA 1YFNA 3EG3A 1VQ9Q 1VQ7Q 4PJOC 2W10A 2YUOA 3LJWA 4M7DG 2HSEB 4HXPA 3QJ6A 4LC2A 1UB4A 5A85A 2EQMA 3U5MA 1N72A 3QKJA 3HMHA 2HD0A 4C8QF 4LDYA 2FZGB 4MMLA 2DEQA 3I56A 1Y0MA 5GAOq 1MMAA 5ENEA 2QI2A 1VQLT 3BE3A 5F1LA 2J6KA 1NJIC 3FIFA 1WA7A 2AK5A 1QKXA 1N27A 3NMZC 5FU6B 5LJ5f 2DIGA 3OYAA 2X4JA 3FEOA 5I1QA 4A9EA 3G6EQ 2H60A 1WXUA 5CKFA 2KRNA 2E1HA 5F2PA 4IOQA 3MKDA 2GNCA 4BY6B 5CFWA 3OYYA 1IGQA 2DTOA 1ZA1B 2KEAA 2X3WD 1OPLA 1JJ2S 3KFVA 5HELA 5D24A 2EKOA 2CYZB 4Q0OA 5FG5A 1S72Q 4CUUA 3M4YA 1SF9A 1AEYA 5EK9A 1JQQA 1VQ4T 2RQTA 2YDWA 1AHJB 5KYWB 1BI2A 5A0GA 4PS5A 3UT1A 4XTWA 3L2RA 4YYGA 1KJWA 2ED1A 4ELZC 2HSPA 4M78D 2O9VA 5FE8A 4RTXA 5HKCA 5KTXA 3VKGA 1JEGA 4YBSA 5HCKA 1Q81U 2RH2A 4BHWA 5A5QA 2CP0A 4IUPA 2CGHA 4PJOA 5FE6A 1U1TA 4CRIA 2I7KA 3C0CA 4C8QG 2VWFA 4BD3A 2DK3A 3PTAA 3JRZA 3UA6A 3O37A 2QTVA 4E96A 2CSQA 3CCVQ 1TUCA 1G83A 2I8NA 5IXFA 2LCLA 2OTLA 5FFVA 3CPWS 2K2VA 3OMCA 2EFIA 3CC4A 4A9NA 5LJ2A 2JS0A 4J9GA 1YI2T 1WX6A 1E6GA 4C5IA 3CCSA 1JU5C 4YBTA 2YLCA 3M57A 2CP7A 2K5LA 5FE7A 2FZCB 1VQNQ 1SEMA 3BDUA 2FO0A 1GCPA 4NQNA 4ZNXA 4NS5A 2JTMA 3LQJA 1JB0E 2MMPA 1VQ9A 1IO6A 1YIJT 1VQ7A 4A9IA 1TSFA 2F6JA 3M9QA 4QQGA 2A28A 1RAEB 1VQMT 2RNYA 5ENGA 1GL5A 1QW1A 1OX8A 4A54A 1LNXA 4FL6A 2PQWA 2NWMA 1JXMA 2Y4YA 2YHTA 3HRTA 5KCOA 2HL5C 1ZS5A 5A81A 1PRMC 2G6FX 4C92A 2F2VA 5E74A 2V8IA 2XIDA 4WF2A 4LRGA 2YRDA 1EIFA 1GFDA 1AZGB 3X20B 3C94A 5IN1A 1K9MC 4F7UF 2OUOA 3FKMX 3O35A 4M75C 2VB6A 2ZPIB 1Q7YC 5IGKA 3ZYUA 4AFQC 1B34B 4QY4A 1H92A 5F36A 3DB3A 5H1TA 1TUDA 2AT1B 2EPDA 1LJOA 3CCQA 3CCRA 2KT8A 4MENA 3OYCA 5JWMA 1JRIA 3J80E 2QA4A 3SHWA 3OA6A 3NXBA 3EFRA 5IHKA 5HRXA 4Y91A 2JZ2A 2LCSA 1S72A 1PSEA 2FVUA 4BW1A 2K5IA 4PJLA 5GAMg 4YYHA 3LYIA 4M4ZA 1N8RR 1NBEB 4QKUA 5I22A 1V29B 4LXCA 3QYHB 1D0ZA 2DVJA 1PUOA 1KQSP 5HQ7A 1ZSZC 3HMEA 2DNUA 3A8OB 3CCLT 4KGZB 2DVEA 2RF0A 1G8XA 4O7AA 5EWDA 3Q1JA 2ZPHB 1RAAB 2FEIA 2FHDA 2AZVA 4IURA 4ZN3A 3EH1A 2VGNA 4M7AB 4HXMA 4J7FA 3LW5E 4TTEA 1WLPB 4M7DD 2CDTA 4DBQA 3CCVA 3JVLA 1UGQB 2WACA 2L8DA 4TYLA 1QCFA 4F7UG 3ERRA 4TS8A 4QSQA 1RAGB 1K9AA 2COWA 4XYAA 4O7EA 5FU6C 1OZ3A 1I5OB 1RAIB 3I35A 1UJ0A 3V8JA 2CZ0B 3SVHA 4C0ZA 4MZMA 1Q81C 2K3BA 2EYYA 2P4RA 1YJWA 4X9CA 1VQNA 2EWNA 4QYLA 3C12A 1VQ6T 4PFPA 5A5RA 4KGVB 4BY6C 5DX4A 1WJRA 1AOJA 1E6HA 2GTJA 2RJDA 4BB7A 1NEBA 5KTUA 4M7AE 2RHIA 3MUKA 1PSFA 4Z8AA 3WVEB 4OB2B 2RHZA 3PIPA 3E2UA 4UYFB 4LDWA 2HKQB 3ONIA 1U1SA 3H9NA 3MJXA 5E9IA 5CKEA
chains in the Genus database with same CATH topology
3L2QA 4PJOF 2ZZDA 4LYWA 2RJCA 2VC8A 1N8RU 2G4AA 4M77B 1K73U 2RNWA 5ENHA 4C67A 2OSSA 3MCAB 1RI0A 4MR5A 4MEOA 4C0FA 3CCET 2BUDA 4OB3B 2YEKA 2BIVA 4J8OA 5FE5A 4ZTFA 4OUFA 4UYGA 3O34A 5ACYA 4RVRA 5FROA 2DO3A 5A0DA 3UV2A 3GNFB 4A4EA 5D0CA 3CMAT 3I55T 3RKXA 3LWIA 3OYKA 3P8DA 4TT4A 3OYIA 3P1CA 5DBMA 3EFSA 2GCXA 1N9SA 4N0AA 5CQ8A 5FE1A 3QYGB 3TLPA 2E6NA 3LWHA 4M77E 3RUXA 3S3NA 4HBYA 4A4GA 3UV4A 5FB0A 4TT6A 2LTOA 5J3BA 4A53A 1GXIE 4V2SA 5DYXA 1VQPT 5EPSA 1BI0A 5AYFA 5LJ3e 2GF7A 2LNVA 3JCMb 2X4WA 3HFNA 5C4QA 4QC3A 4PJOG 2M0OA 3DLLA 5GAOl 5DM7R 4J3IA 4X2IA 2E10A 4QSVA 4TVRA 4BI3A 3QO3A 2DVSA 5KU3A 4KUIA 4OB1B 1IREB 1M1FA 4KUDK 5I7XA 2DIQA 2EAYA 5M9OA 5IGLA 4TT2A 5JI8A 2R57A 4ALHA 4HBVA 2HQEA 4LYSA 3P5OA 4B9XA 5E7DA 3HL8A 5EV9A 4TU6A 3SFMA 5C6SA 3RMQA 5L98A 3WVDB 3KUFA 2RB6A 5D3JA 3OS0A 3S6WA 1WNLA 3META 3MQMA 5FB1A 5DLXA 1O9SA 1VQOT 4YYDA 5A5NA 3GPLA 1KQSS 5KTWA 3L2ZA 2RD1A 4XQ3A 1G3WA 4OMFB 3JVMA 1JM4B 4HXOA 4M7AC 1NJIU 3CPWA 2QTXA 1X0JA 1ZHIA 3CXCA 4M75F 4EMKB 3RERA 3OS1A 1X01A 3LGFA 3PFSA 1VQ8A 4N3WA 1N8RC 4KV4A 2QQRA 1KG1A 5E9YA 1O75A 3H6ZA 5CQXA 1B34A 2EJGA 4YAXA 4JDSA 4BE0A 3QIIA 5FU7B 2QEXT 5FLXE 5FFWA 4MEQA 1K8AU 4AKNA 4A9HA 4L6V5 3LXJA 5DFDA 5HY6A 2RI2A 3FLGA 2FB7A 3GNGA 1YITA 3CCMT 3NTHA 5GMKm 3HRSA 2DXUA 3HKSA 5G4RA 2IVWA 4NL3A 2DPPB 2DKGA 3VUZA 2OTJT 5D3NA 3GOXA 5LVQA 4CUSA 2VXEA 5I40A 5DYUA 4M77C 4ELYC 1XOVA 5ENJA 2RI3A 5GAMf 5C85A 3HRUA 3GF5A 4M75G 4M7AA 3V8KA 4ZGDB 4KT0E 5HLSA 4WHWA 3CPFA 5A5OA 2ZPBB 4RMOA 1UEBA 5CO7A 4YY4A 4CFKA 2YQDA 1Y07A 1VQ5T 5LJ5e 3JB9H 4O71A 4GY5A 4OVAA 5TCMA 4HT8A 5CPEA 4N4FA 5GANj 3ER0A 2KSSA 4UC4A 3CC2T 5A0LA 4ZQLA 4IUTA 5E3DA 2WSEE 4DA4A 5HFQA 1N6AA 4MZTA 2EYQA 2RHUA 4IUVA 2PVGB 3QXEB 5CRZA 3CD6A 3JVKA 1E6IA 4PNOA 4O7BA 1YJNA 4HCZA 1K9MU 1OYXA 4UYFA 2E12A 4FLPA 5CUEA 4CL9A 2VYTA 1Y96B 1Q7YU 4N4HA 3CCJT 3OYGA 4YYIA 2D6FA 4PJOD 1FXXA 2C06A 4M77A 5CK9A 5I86A 3E9FA 3CC7A 4BJXA 4A4KA 1MHNA 3K2JA 1KQ1A 1NPRA 4DOWA 4YBMA 3G0LA 1KHCA 4A9KA 3JCMh 2VUBA 1WUMA 2DD4A 3CMEA 2KTBB 4NR4A 1VUBA 3M54A 3JCMQ 3VV0A 5GAN2 2HAXA 4M7DB 5ENIA 5LUUA 1KQ2A 4FM4B 5E9KA 4QR5A 3MP8A 3PGGA 4LZSA 4JUVA 5FRMA 3QDRB 1M5Q1 1Q82U 5A83A 3SDZA 1U8RA 2JNGA 1K8AC 4RCCA 4BACA 4QNSA 4GLKA 4NXJA 4C92C 4QC1A 1M1GA 5GMKe 4HXLA 5G4SA 4EMKC 5GANh 2WP1A 4IUUA 2MI6A 3JCMV 4OGCA 4LD9K 5F5ZA 4NR8A 4UYEA 5EG2A 3G71T 4O70A 3JB9D 5D3RA 4WIVA 1VQKA 3JSCA 1WJSA 5L8RE 3P8HA 3MEWA 5D6YA 3CEYA 3G4SA 5CUGA 4UIXA 5FU7C 1NPPA 4JRQA 5HCLA 5KHMA 4JRPA 3CXCS 1G5VA 3JCMc 5LL6S 2XI9A 5F3AA 3E9GA 2R0SA 4Y03A 1YHQT 4NOYA 2XDDA 5FE9A 5E0RA 3M53A 3OY9A 4C8QB 1QVFA 2DWWA 5CGPA 2QQBA 5EA1A 4QZSA 3M56A 3OYHA 4J0SA 4YATA 4PLIA 3QBYA 4VUBA 3SWNB 5BT4A 5D7XA 3NFCA 3KXTA 5A5SA 4KBMB 4FT2A 4IUQA 4DONA 5DFBA 2LQKA 3TREA 4KULA 5DLZA 4XU0A 4QSXA 2YYNA 4QW2A 4C5HA 5HQ5A 5E73A 5AD2A 3OS2A 4CFLA 3JCMg 4LZRA 4EMKA 4FT4A 5GAN8 4M75D 3UPUA 3P8BB 4NL2A 5ENCA 4QUUA 3CBPA 4C8QE 3G6EA 1N9RA 1KQSA 2L5QA 5GAN7 1VIEA 5J39A 1FX7A 4XTYA 3JAME 4EMHA 2YRVA 5I21A 5EPRA 4EPCA 5LKXA 2DXTA 1HK9A 2XHCA 4LDFA 2OTJA 2R0VA 5DFCA 1QVPA 4NUDA 4BDYA 2M9UA 3UWNA 3JCMX 3JCMP 4IR5A 2K3XA 1UGPB 3U5PA 3MO8A 4Z1QA 1YJ9T 5GANg 2DATA 3OYLA 2RHYA 5D6WA 3S3OA 4NR5A 4L59A 4HXKA 5AD3A 3MULA 3V8LA 2D9TA 3RESA 3LGLA 1BKBA 2DXCA 2RJFA 2FSAA 5FE4A 5D3SA 1Q82C 2DVRA 4MEPA 3N5BB 2P0KA 3QZVA 5LVRA 5I2MA 5EPBA 2QQAA 5F63A 2E5QA 4ZTJA 2JN0A 4FU6A 3MHXA 4O7CA 5E9LA 4PL6A 3VU3C 4N0AC 4HCCA 4HXRA 5CP5A 4CUQA 3NTKA 4EDUA 3OSSC 3LQIA 4MR6A 3E19A 4QUTA 5I83A 4YC9A 3CBMA 5F25A 5ENBA 1RL2A 2LRQA 4ZGEB 1I8FA 5DLQE 4F7UB 3O33A 3FJPA 3VYHB 3CCUT 5A82A 2E7OA 5F62A 2F5KA 3VJPA 2O4XB 5IBNA 4IR6A 4NRCA 3M58A 3OYJA 2XKOC 1UGRB 4Q5WA 1Y96A 5EWCA 5GAOm 2MJVB 5CRMA 5LJ1A 1VQLA 4UITA 3CBOA 5DKDA 2LSPB 2PVOB 3OYFA 1YCYA 4O74A 4LZ2A 5FE3A 3GLXA 1WUGA 5KO4A 4OGJA 4PKCC 5A5PA 5GAN3 3LH0A 3TCJA 5LJ3d 4F7UE 2RNXA 5KE3A 3A8GB 4HKEA 3UVXA 3L2VA 1M1KC 3MEAA 2AHJB 4E7JA 3JB9I 3JCMd 2DVQA 5GAN4 2EQKA 5E9MA 3QG1A 3PNWC 1VQ4A 2WP2A 5EU1A 3BFMA 4M7DA 4IOOA 2PUOB 4C8QC 4A4HA 5I89A 2E3KA 1MGQA 4PCEA 3I56T 4C92F 1XTDA 4NQMA 4UIZA 1Q86C 2QQ9A 1QP3A 3IU6A 1KD1C 3JB9F 2CZ6B 2YLBA 4O78A 5HEMA 4HXSA 2P4TA 5AMEA 3X25B 1QVFS 5GAOr 4CURA 4TU4A 3L2UA 5HRVA 5GANd 4UIWA 4HBWA 4QB3A 5D6XA 5BT3A 2RFJA 1YI2A 1F68A 3V7CA 3UVYA 1D3BB 4IKFA 3PT9A 3QZSA 1BI1A 4ZGJB 3T9NA 3GP8A 2GRCA 4E47A 1KHIA 1YIJA 4XUAA 2JOYA 3G7ZA 2FL7A 3JVJA 1VQMA 2M1HA 1P92A 3D7CA 5DYCA 3MXFA 4QSWA 5CVIA 2LCCA 2FYKA 3L2WA 4Z02A 4C8QA 2MAMA 5CU8A 4QSPA 4RCBA 4C92G 4QR3A 2M16A 1OI1A 2EJFA 5C0MA 5FH7A 2OO1A 5GAMe 5L8TA 3E1SA 4M7AD 3SWNA 4C5EA 2RJEA 4O75A 4YY6A 3J81E 2KDSA 4O72A 3UVWA 2OTLT 4QSUA 4KV1A 3JB9G 3CC4T 3R6OA 4J5YA 4IR4A 3CCST 4QQDA 3HPWA 5L97A 2VGMA 2K57A 1KC8U 2D82A 2K5FA 1BYMA 4M78B 1VQ9T 1VQ7T 4BI8B 1M90C 5LJ3j 3BY7A 3A8MB 2XK0A 1W2BA 3UW9A 4OGEA 2EQUA 5LKTA 4NUEA 2LX9A 3CCLA 4YYNA 4HA8A 2WSCE 5FBXA 2R58A 2R5MA 4J83A 1HXDA 5DLOA 2A3LA 2RM4A 3F70A 5LJ5d 3U5NA 4ATOA 5H1UA 4UIYA 4HT9A 5CIUA 2K3YA 4Z6IA 4M77D 4BW3A 3OYEA 3CCQT 1BIAA 2JTFA 3CCRT 3A8LB 4O5VA 4M78E 2R10A 5IGNA 5CS8A 2QA4T 2ZPGB 2X4XA 2ZPFB 4R55A 4XUBA 2CZ1B 2KY9A 1M8VA 4XTZA 1S72T 2N9GA 5EGUA 4JLIA 5FE2A 1VQ6A 3Q2EA 4NUCA 4A9JA 2X4YA 4UIUA 5C7NA 4CLBA 3U5JA 2RK2A 4FIBA 5E9VA 5II2A 3RKWA 5D26A 2DTIA 2WSFE 4M75B 4PY6A 3JCMJ 4QVDA 2LC4A 1Y71A 5HRWA 5DY9A 2V8KA 3TU4K 2GQVA 2E6ZA 5L8UA 3CCVT 3FC3A 4NR6A 5C8GA 4UIVA 3CCEA 4F7UA 4MZPA 3OW2A 4JS4A 3ASKA 1NE8A 5CTLA 2O4XA 4IORA 4PCIA 4O77A 4C66A 3CMAA 3I55A 5CQAA 2E41A 5LJ3h 4TQNA 1YJWT 1SSFA 1VQNT 4HCBA 2DTHA 4ZN1A 3KBGA 5HFRA 2O01E 5J0DA 4RKUE 4A9LA 1DJ7B 4LDUA 5CCAA 4XU1A 4C0GA 4N4GA 4C0DB 1QP2A 3MEUA 2MWPA 3IU5A 1EQFA 3HHTB 2XG8D 2L3RA 5CUCA 3NTIA 4LD6A 4XTUA 5L99A 1VQPA 2RI5A 1XQHA 1JSPB 1KC8C 5GAN5 3RMSA 2MF2A 2XICA 2HBPA 4O7FA 4XK8E 2D0QB 4MR3A 2GFUA 3RCWA 3M55A 4JS5A 4J7IA 3J7AF 1WPYA 3OMGA 4MMKA 5GAN6 4D6WA 4CUTA 2ZGWA 5LJ5j 4C92D 5IGMA 4DQ2A 5FRNA 4J0RA 4QVCA 4NR9A 2E70A 2NXBA 2RHXA 1R8OB 3QJYA 5FG6A 2DVVA 2P0PA 2XU8A 4M7DE 4L5GA 5D3LA 3OBYA 2IG0A 5GAMh 5GAOp 2H3JA 4QVZA 5J26A 4C5GA 5K29A 3VYGA 4DOVA 3O36A 2HNIA 5CQ5A 3VKIA 5DW1A 3URGA 4E7KA 4M78C 4PTBA 4Z6HA 4XY9A 5A2QE 4XY8A 2QQSA 3AHUA 3OYDA 1D3BA 3DB4A 2JUFA 2RK1A 1VQOA 4ZW1A 2A7YA 4NRBA 5L96A 2NLUA 4RG2A 4PLLA 5EP7A 3GIBA 2R5AA 5EWWA 4XU3A 4M7AF 3DLMA 4XTVA 5LJ3g 5HENA 2KAFA 5HK3A 1W2BS 5D3TA 5IG6A 4FSXA 3PMIA 3S92A 3U5LA 4ZC9A 3MP6A 5COIA 3M5AA 3JCMW 2RO0A 1M1KU 4LDXA 4B9WA 3QPHA 3RIRA 5EWHA 2KQWA 2I2LA 2BKDN 5CQ7A 5LKZA 5EVAA 2QEXA 3V7RA 2VXFA 3SVGA 3UVDA 2RA2A 3AADA 5C87A 4YH4A 4X9DA 5CQTA 3QZ9B 5EISA 4HBXA 4QEUA 3CCMA 4UYHA 4LDVA 4M78A 1VIFA 2L89A 5LJ5h 1Q86U 4P5NA 2Y4XA 5GMKj 4J6XA 2X35A 2Y90A 2DZ9A 1KD1U 3OS5A 4M77F 5D3HA 3QSUA 2OAUA 1VQ8T 1I81A 2DXBA 2QXFA 2XD0A 3A8HB 4M7AG 5II1A 5CAIA 5CKDA 2LQ8A 1M4ZA 5CUBA 3AQAA 1VQ5A 4QQ6A 3P1DA 1LOJA 5IT9E 2LVMA 2GFAA 3HSBA 3UDCA 2L85A 4YYMA 2CZ7B 3WXMB 1WJQA 2JVVA 3CC2A 4C0DC 4BW4A 3OB9A 5CQ6A 4XU2A 1YITT 4X34A 3OW2S 5I29A 1H641 4ME7A 4MR4A 4BE2A 3FRNA 4M7DC 1QVGA 2HQXA 3G0JA 1G3SA 3MB4A 2G3RA 2LDMA 2R0YA 5TB6A 3SB2A 3CCJA 4M75A 4J6WA 5AMFA 3O8VA 3RKYA 4F3IA 3S91A 2KVQG 4M77G 4J6YA 4Z93A 5D25A 5DW2A 5D3PA 4A9FA 1BI3A 5ETBA 1NZ9A 4YABA 2PUKB 4MDXA 4NYWA 2D9EA 1M90U 3V7SA 3LLRA 4GPJA 5GMKh 4OGIA 5ETDA 5C89A 5I88A 2F5TX 4EMGA 3L42A 3M4GA 4UYDA 3QZTA 3CD6T 5LJ5g 2E7NA 1YJNT 3ZFJA 2XDPA 5F60A 2VV5A 5A7CA 4TZ8A 3QHSA 2YW5A 3P1FA 2EJ9A 4JRIA 3EAEA 2PVDB 2E64A 3I3JA 5FG4A 4R56A 2QDYB 1WQ7A 4YK0A 4C8QD 3OSVA 4HXNA 4LYIA 4E7LA 3CC7T 5GAOn 5DKCA 1IZ6A 1Y7XA 2DZCA 3C95A 4E7IA 1XNIA 5EQ1A 3FB9A 3SWNC 3LQHA 5CZGA 3G71A 1OZ2A 2P0QA 3CMET 4A4FA 5HM0A 5HQ6A 5I80A 2K4YA 4QBMA 2ZCFB 2LT4A 2F6NA 4XTXA 3GG3A 3PIOA 4YYJA 5GMKi 4M78F 5FH6A 5KH6A 4A9OA 3U5KA 4QSRA 2L5EA 3MEVA 4QSTA 1FWZA 4OF1A 3PMTA 1YHQA 1X75C 4PJOB 3JCMe 5GAMd 4LR6A 4O6JA 2L84A 4BI4A 3ZEHA 4II1A 1UGSB 3A5ZB 5DY7A 5H85A 1JJ2A 5EICA 3MB3A 4O76A 3FDRA 5LKUA 5KE2A 4Q0NA 2B8AA 5I2SA 4CI0C 3MP1A 3HFOA 1WGSA 4YTLA 3SD4A 2YEMA 3P1EA 2MWOA 4QEVA 1VQKT 3G4ST 5CQ4A 3DWYA 5ENFA 1W4SA 4PJOE 1G3TA 1I4K1 4WHUA 2RS9B 2XDBA 3QZ5B 2ZPEB 1M9SA 4TZ2A 4JRKA 4Y28E 5CQ3A 5GANe 1TH7A 5HJCA 3X26B 3HP9A 3OYBA 5FFYA 2PU9B 5LJ3f 4M78G 4IR3A 4C92B 2RI7A 5CY9A 5DYAA 3JCMf 2KMTA 3VUBA 2EIFA 4NR7A 2CS7A 1YJ9A 2E65A 2KK4A 1K73C 3OBWA 3M59A 3UV5A 3OYNA 5FDZA 4OP0A 1ZBXA 5F61A 1JBMA 5BT5A 4NYXA 4QR4A 1H3ZA 3G6ET 5FH8A 3DKMA 2V8JA 5IIDA 3ME9A 4C92E 4J1PA 1QVGS 4QSSA 4NYVA 4RG8A 4BW2A 3QUIA 4PKLA 4QYDA 5DKHA 5LJ0A 4JJNK 2RO1A 1YBYA 3C4SA 5GANf 3TEEA 5EM3A 4OB0B 3ZBDA 5FE0A 1WQWA 5CQYA 3H8ZA 4M7DF 5HK0A 3BW1A 2DAQA 4E7HA 4KCXA 3DAIA 2DJZA 1I5LA 2CKKA 5I7YA 3U5OA 3X24B 3OYMA 3CCUA 5F1HA 4NRAA 5GAMj 3BDLA 4Z1SA 3SVFA 4ALGA 5IAYA 4MDWA 5CKHA 4QEWA 1ZQ1A 5CKBA 5KCHA 5EI4A 4CUPA 3HMFA 4BE1A 4JLGA 5E3GA 3X28B 1BIBA 4XAXB 5CUAA 2DKWA 1G3YA 2F69A 5CUDA 4A9MA 3LX7A 5H1VA 3JB9J 2LT1A 4BUGA 5GMKl 3Q2FA 4BDZA 2YELA 2EQJA 4YYKA 3S3MA 2DD5A 5CR2A 5EWVA 3L1AA 4N4IA 4M75E 4YADA 1X6OA 4YH3A 3INZA 3OQ5A 4PJOC 3LJWA 4M7DG 4HXPA 3QJ6A 4LC2A 1UB4A 5A85A 2EQMA 3U5MA 1N72A 3QKJA 3HMHA 2HD0A 4C8QF 4LDYA 4MMLA 2DEQA 3I56A 5GAOq 5ENEA 2QI2A 1VQLT 5F1LA 1NJIC 3FIFA 1N27A 5FU6B 5LJ5f 2DIGA 3OYAA 2X4JA 3FEOA 5I1QA 4A9EA 2H60A 5CKFA 2E1HA 5F2PA 4IOQA 4BY6B 5CFWA 3OYYA 2DTOA 1JJ2S 5HELA 5D24A 2EKOA 2CYZB 4Q0OA 5FG5A 4CUUA 3M4YA 5EK9A 1VQ4T 2YDWA 1AHJB 1BI2A 5A0GA 4PS5A 3UT1A 4XTWA 3L2RA 4YYGA 4ELZC 4M78D 5FE8A 5HKCA 5KTXA 4YBSA 1Q81U 2RH2A 4BHWA 5A5QA 4IUPA 2CGHA 4PJOA 5FE6A 1U1TA 4CRIA 2I7KA 4C8QG 4BD3A 2DK3A 3PTAA 3JRZA 3O37A 4E96A 2I8NA 2LCLA 2OTLA 5FFVA 3CPWS 2K2VA 3OMCA 2EFIA 3CC4A 4A9NA 5LJ2A 1YI2T 4C5IA 3CCSA 4YBTA 2YLCA 3M57A 2K5LA 5FE7A 3BDUA 4NQNA 4NS5A 2JTMA 3LQJA 1JB0E 2MMPA 1VQ9A 1YIJT 1VQ7A 4A9IA 2F6JA 3M9QA 4QQGA 1VQMT 2RNYA 5ENGA 1QW1A 4A54A 1LNXA 4FL6A 2PQWA 2Y4YA 2YHTA 3HRTA 5KCOA 1ZS5A 5A81A 4C92A 2V8IA 5E74A 2XIDA 4WF2A 4LRGA 1EIFA 3X20B 3C94A 5IN1A 1K9MC 4F7UF 2OUOA 3FKMX 3O35A 4M75C 2ZPIB 1Q7YC 5IGKA 3ZYUA 1B34B 4QY4A 5F36A 3DB3A 5H1TA 1LJOA 3CCQA 3CCRA 4MENA 3OYCA 5JWMA 1JRIA 3J80E 2QA4A 3OA6A 3NXBA 3EFRA 5HRXA 4Y91A 2JZ2A 1S72A 1PSEA 2FVUA 4BW1A 2K5IA 5GAMg 4YYHA 3LYIA 1V29B 3QYHB 5HQ7A 3HMEA 3A8OB 3CCLT 2DVEA 4O7AA 3Q1JA 5EWDA 2ZPHB 2FHDA 4IURA 4ZN3A 4M7AB 2VGNA 4HXMA 4J7FA 3LW5E 4TTEA 4M7DD 3CCVA 3JVLA 1UGQB 2WACA 2L8DA 4TYLA 4F7UG 4TS8A 4QSQA 4XYAA 4O7EA 5FU6C 1OZ3A 3V8JA 2CZ0B 3SVHA 4C0ZA 4MZMA 1Q81C 1YJWA 4X9CA 1VQNA 2EWNA 4QYLA 3C12A 1VQ6T 5A5RA 4BY6C 5DX4A 1WJRA 2RJDA 4BB7A 5KTUA 4M7AE 2RHIA 3MUKA 1PSFA 3WVEB 4OB2B 2RHZA 3PIPA 4UYFB 4LDWA 3ONIA 1U1SA 5E9IA 5CKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUQ A;  4DON A;  5DFB A;  3L2Q A;  4TZ2 A;  5CQ3 A;  4O77 A;  4C66 A;  5DLZ A;  4LYW A;  2RJC A;  5CQA A;  4QSX A;  4TQN A;  5HJC A;  2G4A A;  2YYN A;  1SSF A;  3OYB A;  4QW2 A;  4C5H A;  2RNW A;  5ENH A;  5FFY A;  5E73 A;  4C67 A;  5HQ5 A;  2OSS A;  5AD2 A;  5HFR A;  3OS2 A;  4CFL A;  1RI0 A;  4MR5 A;  4MEO A;  5J0D A;  4LZR A;  4A9L A;  4IR3 A;  2BUD A;  2YEK A;  2BIV A;  5FE5 A;  4ZTF A;  2RI7 A;  4OUF A;  4N4G A;  4UYG A;  5CY9 A;  3O34 A;  5DYA A;  3MEU A;  5ENC A;  2MWP A;  4QUU A;  3IU5 A;  1EQF A;  5ACY A;  4RVR A;  5FRO A;  2L3R A;  3UV2 A;  5CUC A;  4A4E A;  5D0C A;  3NTI A;  5J39 A;  4LD6 A;  4NR7 A;  3P8D A;  3OYK A;  2YRV A;  5EPR A;  5L99 A;  4TT4 A;  3OYI A;  3P1C A;  5LKX A;  2RI5 A;  5DBM A;  3UV5 A;  3OYN A;  5FDZ A;  1JSP B;  4LDF A;  2R0V A;  5DFC A;  5CQ8 A;  5FE1 A;  4O7F A;  4NUD A;  3TLP A;  2E6N A;  4BDY A;  5F61 A;  4MR3 A;  2GFU A;  3UWN A;  3RCW A;  5BT5 A;  4NYX A;  3S3N A;  4HBY A;  4QR4 A;  4A4G A;  1H3Z A;  3OMG A;  3UV4 A;  4IR5 A;  5FB0 A;  5FH8 A;  5IID A;  2K3X A;  4TT6 A;  3ME9 A;  2LTO A;  4J1P A;  4QSS A;  4CUT A;  3U5P A;  4NYV A;  3MO8 A;  4Z1Q A;  2DAT A;  4BW2 A;  3OYL A;  4PKL A;  5IGM A;  2RHY A;  4QYD A;  5D6W A;  5DYX A;  4J0R A;  5FRN A;  4NR9 A;  5DKH A;  5LJ0 A;  5EPS A;  3S3O A;  4NR5 A;  4L59 A;  4HXK A;  2GF7 A;  5AD3 A;  3MUL A;  2NXB A;  2X4W A;  2RHX A;  2D9T A;  2RO1 A;  3LGL A;  5C4Q A;  4QC3 A;  5FG6 A;  2DVV A;  3C4S A;  2M0O A;  4J3I A;  4X2I A;  5D3L A;  2FSA A;  2RJF A;  5FE4 A;  5EM3 A;  2IG0 A;  4QSV A;  5FE0 A;  4QVZ A;  5D3S A;  5J26 A;  2DVS A;  4C5G A;  5KU3 A;  2DVR A;  3H8Z A;  4MEP A;  5K29 A;  2DAQ A;  3O36 A;  2P0K A;  3QZV A;  4E7H A;  4KCX A;  5CQ5 A;  3DAI A;  5LVR A;  5DW1 A;  5I7X A;  5EPB A;  4E7K A;  5F63 A;  2E5Q A;  4ZTJ A;  2DIQ A;  2CKK A;  4FU6 A;  5M9O A;  4PTB A;  5I7Y A;  3U5O A;  4O7C A;  5E9L A;  5E9I A;  4PL6 A;  5IGL A;  4TT2 A;  5JI8 A;  2R57 A;  4Z6H A;  4XY9 A;  4ALH A;  4XY8 A;  2QQS A;  3OYM A;  3OYD A;  5F1H A;  4HBV A;  4NRA A;  4HXR A;  2HQE A;  5CP5 A;  4CUQ A;  3NTK A;  4LYS A;  3DB4 A;  3BDL A;  4Z1S A;  3P5O A;  4EDU A;  3SVF A;  4ALG A;  5IAY A;  4B9X A;  4QEW A;  5E7D A;  4ZW1 A;  3LQI A;  4NRB A;  4MR6 A;  5EV9 A;  4QUT A;  4TU6 A;  5I83 A;  5L96 A;  4YC9 A;  5EI4 A;  3HMF A;  4CUP A;  2NLU A;  4PLL A;  4RG2 A;  4BE1 A;  5EP7 A;  5C6S A;  5E3G A;  5L98 A;  5F25 A;  5ENB A;  2R5A A;  3KUF A;  5CUA A;  5EWW A;  2DKW A;  2LRQ A;  5D3J A;  3OS0 A;  3O33 A;  5CUD A;  3S6W A;  3MET A;  4A9M A;  3LX7 A;  5H1V A;  3DLM A;  3MQM A;  5FB1 A;  5A82 A;  2E7O A;  5DLX A;  5F62 A;  5HEN A;  2F5K A;  3Q2F A;  2O4X B;  4BDZ A;  5IBN A;  4YYD A;  2YEL A;  4IR6 A;  5A5N A;  2EQJ A;  4YYK A;  5D3T A;  4NRC A;  5IG6 A;  5KTW A;  3PMI A;  3S92 A;  3U5L A;  3S3M A;  3OYJ A;  4ZC9 A;  5EWV A;  3MP6 A;  4Q5W A;  5COI A;  4N4I A;  3JVM A;  2RO0 A;  5EWC A;  2MJV B;  1JM4 B;  5CRM A;  4YAD A;  4B9W A;  5LJ1 A;  4HXO A;  4UIT A;  5DKD A;  2LSP B;  4YH3 A;  5EWH A;  3OYF A;  2BKD N;  5CQ7 A;  5LKZ A;  1X0J A;  5EVA A;  4O74 A;  4LZ2 A;  5FE3 A;  3OQ5 A;  3OS1 A;  3SVG A;  3UVD A;  1WUG A;  3LJW A;  3AAD A;  5C87 A;  4HXP A;  4YH4 A;  5KO4 A;  3QJ6 A;  4OGJ A;  4LC2 A;  5CQT A;  5A85 A;  2EQM A;  3U5M A;  1N72 A;  5A5P A;  3QKJ A;  3HMH A;  3LGF A;  3LH0 A;  3PFS A;  4N3W A;  5EIS A;  2RNX A;  4KV4 A;  4HBX A;  2QQR A;  5KE3 A;  4QEU A;  5E9Y A;  4UYH A;  3H6Z A;  3UVX A;  3L2V A;  5ENE A;  2L89 A;  3MEA A;  4E7J A;  4YAX A;  5F1L A;  2X35 A;  4BE0 A;  2DVQ A;  3QII A;  1N27 A;  2EQK A;  5E9M A;  2DIG A;  3OYA A;  5FFW A;  4MEQ A;  3PNW C;  2WP2 A;  5EU1 A;  4AKN A;  4A9H A;  3FEO A;  4IOO A;  4A9E A;  5I1Q A;  2H60 A;  5KCH A;  5D3H A;  4A4H A;  5I89 A;  3LXJ A;  5DFD A;  2E3K A;  2RI2 A;  5F2P A;  3FLG A;  4IOQ A;  4PCE A;  5CFW A;  3NTH A;  4NQM A;  5G4R A;  4UIZ A;  5II1 A;  5D3N A;  3GOX A;  5HEL A;  5D24 A;  5LVQ A;  4CUS A;  5CUB A;  4Q0O A;  3AQA A;  5DYU A;  5FG5 A;  5I40 A;  2EKO A;  4CUU A;  3IU6 A;  4QQ6 A;  3P1D A;  5EK9 A;  2YDW A;  5ENJ A;  2LVM A;  4PS5 A;  4O78 A;  2GFA A;  2RI3 A;  5HEM A;  4HXS A;  3UT1 A;  2L85 A;  4YYM A;  5AME A;  5C85 A;  3L2R A;  4YYG A;  1WJQ A;  4CUR A;  4BW4 A;  4TU4 A;  3OB9 A;  5CQ6 A;  5FE8 A;  3L2U A;  5HRV A;  4X34 A;  5KTX A;  5HLS A;  5I29 A;  4YBS A;  4UIW A;  4HBW A;  4WHW A;  4QB3 A;  4BHW A;  5A5Q A;  5A5O A;  2RFJ A;  4MR4 A;  5BT3 A;  4IUP A;  5D6X A;  1F68 A;  5FE6 A;  4BE2 A;  4YY4 A;  3UVY A;  2YQD A;  4CFK A;  4IKF A;  4CRI A;  2I7K A;  4BD3 A;  4O71 A;  3QZS A;  4GY5 A;  3O37 A;  4OVA A;  5TCM A;  5CPE A;  4N4F A;  4E96 A;  2HQX A;  3G0J A;  2GRC A;  3MB4 A;  2G3R A;  2LDM A;  2I8N A;  4UC4 A;  2R0Y A;  5TB6 A;  4XUA A;  4ZQL A;  5AMF A;  3O8V A;  4IUT A;  5E3D A;  5FFV A;  4F3I A;  3S91 A;  3JVJ A;  3OMC A;  2EFI A;  5HFQ A;  2M1H A;  3D7C A;  4A9N A;  5DYC A;  5LJ2 A;  2RHU A;  4C5I A;  4IUV A;  3MXF A;  4QSW A;  4YBT A;  2LCC A;  3L2W A;  4Z02 A;  5CRZ A;  5FE7 A;  4Z93 A;  5D25 A;  5DW2 A;  5D3P A;  5CU8 A;  3JVK A;  4QSP A;  4QR3 A;  4A9F A;  2M16 A;  1E6I A;  1OI1 A;  4O7B A;  4NQN A;  5C0M A;  4HCZ A;  4NS5 A;  3LQJ A;  5FH7 A;  2OO1 A;  4UYF A;  1OYX A;  5L8T A;  5ETB A;  4YAB A;  4FLP A;  5CUE A;  4CL9 A;  2VYT A;  4C5E A;  2RJE A;  4NYW A;  4O75 A;  4YY6 A;  2D9E A;  4N4H A;  4A9I A;  2F6J A;  4O72 A;  3UVW A;  3M9Q A;  4QQG A;  3OYG A;  4YYI A;  4QSU A;  4KV1 A;  3LLR A;  4GPJ A;  2RNY A;  5ENG A;  4OGI A;  5ETD A;  4IR4 A;  5C89 A;  4FL6 A;  5I88 A;  2PQW A;  4QQD A;  5I86 A;  3E9F A;  4BJX A;  5KCO A;  1MHN A;  3K2J A;  3L42 A;  5L97 A;  1ZS5 A;  5A81 A;  4UYD A;  3QZT A;  2D82 A;  5E74 A;  2E7N A;  4LRG A;  4YBM A;  3G0L A;  2XDP A;  1KHC A;  5IN1 A;  4A9K A;  2OUO A;  3FKM X;  3O35 A;  5F60 A;  1WUM A;  5IGK A;  5A7C A;  3ZYU A;  4TZ8 A;  2YW5 A;  3P1F A;  4QY4 A;  2KTB B;  4NR4 A;  5F36 A;  3EAE A;  3DB3 A;  3I3J A;  5FG4 A;  5H1T A;  2XK0 A;  3UW9 A;  2EQU A;  4YK0 A;  5LKT A;  4NUE A;  4HXN A;  4YYN A;  4LYI A;  4E7L A;  5ENI A;  4MEN A;  5DKC A;  3OYC A;  5JWM A;  5FBX A;  5LUU A;  2R58 A;  2R5M A;  3OA6 A;  3NXB A;  4E7I A;  5E9K A;  4QR5 A;  1XNI A;  5EQ1 A;  3MP8 A;  4LZS A;  3LQH A;  3F70 A;  5CZG A;  5HRX A;  3U5N A;  2JZ2 A;  5FRM A;  1OZ2 A;  4BW1 A;  5H1U A;  4UIY A;  4YYH A;  3LYI A;  5A83 A;  5CIU A;  4A4F A;  2K3Y A;  4Z6I A;  5HM0 A;  4BW3 A;  5HQ6 A;  3OYE A;  5I80 A;  5HQ7 A;  2JTF A;  3HME A;  4BAC A;  4QNS A;  4QBM A;  4NXJ A;  2R10 A;  4O7A A;  5IGN A;  5EWD A;  5CS8 A;  2F6N A;  4QC1 A;  3Q1J A;  4HXL A;  3GG3 A;  5G4S A;  4YYJ A;  2FHD A;  2X4X A;  2WP1 A;  4IUU A;  5FH6 A;  5KH6 A;  4A9O A;  3U5K A;  4QSR A;  2L5E A;  3MEV A;  4IUR A;  4XUB A;  4QST A;  5F5Z A;  4NR8 A;  4UYE A;  4HXM A;  4O70 A;  2N9G A;  5EGU A;  5D3R A;  3PMT A;  4TTE A;  5FE2 A;  4WIV A;  4LR6 A;  1WJS A;  3JVL A;  2WAC A;  3P8H A;  3Q2E A;  2L84 A;  2L8D A;  4NUC A;  4A9J A;  4TYL A;  3MEW A;  3ZEH A;  2X4Y A;  4II1 A;  4UIU A;  5C7N A;  5D6Y A;  4TS8 A;  4CLB A;  3U5J A;  3CEY A;  5CUG A;  4QSQ A;  4UIX A;  5E9V A;  5DY7 A;  4XYA A;  4O7E A;  5H85 A;  1OZ3 A;  5EIC A;  3MB3 A;  4O76 A;  5II2 A;  3FDR A;  5HCL A;  5D26 A;  5LKU A;  5KHM A;  5KE2 A;  4Q0N A;  3SVH A;  2B8A A;  4PY6 A;  1G5V A;  3MP1 A;  5HRW A;  1WGS A;  3SD4 A;  5F3A A;  3E9G A;  2YEM A;  2R0S A;  3P1E A;  4Y03 A;  2MWO A;  5L8U A;  4QYL A;  4QEV A;  5A5R A;  5FE9 A;  5E0R A;  5DX4 A;  3FC3 A;  4NR6 A;  5C8G A;  1WJR A;  3OY9 A;  2DWW A;  5CGP A;  4UIV A;  2RJD A;  5EA1 A;  5KTU A;  4QZS A;  2RHI A;  3MUK A;  3OYH A;  4J0S A;  5CQ4 A;  3DWY A;  4YAT A;  5ENF A;  2RHZ A;  3ASK A;  4PLI A;  3QBY A;  4UYF B;  5CTL A;  4WHU A;  3ONI A;  2RS9 B;  5BT4 A;  5D7X A;  2O4X A;  4IOR A;  5A5S A;  4PCI A; 
#chains in the Genus database with same CATH topology
 1VQM Q;  3L2Q A;  4PJO F;  2ZZD A;  4LYW A;  2RJC A;  2VC8 A;  1N8R U;  1LVK A;  2G4A A;  5EC7 A;  1IHV A;  5IH2 A;  4M77 B;  1ZSZ A;  3EGX A;  1K73 U;  2RNW A;  5ENH A;  4C67 A;  2OSS A;  5KYX A;  4FYW B;  3MCA B;  1RI0 A;  4MR5 A;  4MEO A;  4C0F A;  1M3C A;  2DL4 A;  1PWT A;  3CCE T;  2BUD A;  4OB3 B;  1R77 A;  2YEK A;  2BIV A;  4J8O A;  5FE5 A;  4ZTF A;  4OUF A;  4UYG A;  1QWF A;  4PFZ A;  3O34 A;  1M2O A;  2EGE A;  5ACY A;  4RVR A;  5FRO A;  2DO3 A;  5A0D A;  1D1B A;  3UV2 A;  3GNF B;  4A4E A;  5D0C A;  3CMA T;  3I55 T;  3RKX A;  3LWI A;  3OYK A;  3P8D A;  4WCI A;  1VQ8 Q;  4TT4 A;  3OYI A;  3P1C A;  2JMA A;  5DBM A;  3EFS A;  2GCX A;  1N9S A;  4N0A A;  5CQ8 A;  5FE1 A;  3QYG B;  3TLP A;  3D7S B;  2F2X A;  2E6N A;  3LWH A;  1K4U S;  4M77 E;  1EX4 A;  3RUX A;  3S3N A;  4HBY A;  3LH5 A;  2F1L A;  4A4G A;  3UV4 A;  5FB0 A;  3TVT A;  4TT6 A;  2LTO A;  5J3B A;  1NLP C;  4A53 A;  1GXI E;  2BE9 B;  1NJI R;  4V2S A;  5DYX A;  1VQP T;  5EPS A;  1BI0 A;  2KT1 A;  2QG9 B;  5AYF A;  2GF7 A;  2LNV A;  5LJ3 e;  3JCM b;  2X4W A;  1YIT Q;  1NG2 A;  2LJ3 A;  1S1N A;  1B3Q A;  3HFN A;  3VS1 A;  5C4Q A;  4QC3 A;  4PJO G;  2M0O A;  3DLL A;  5GAO l;  5DM7 R;  4J3I A;  4X2I A;  5KYW A;  1NYG A;  2E10 A;  4QSV A;  4TVR A;  4BI3 A;  3QO3 A;  2DVS A;  5KU3 A;  1YP5 A;  2B86 A;  1C0M A;  4KUI A;  1PD0 A;  4OB1 B;  1IRE B;  2Z0W A;  4FYY B;  1M1F A;  4KUD K;  4RTV A;  5I7X A;  2DIQ A;  2EAY A;  5M9O A;  2JT4 A;  4J9B A;  3EG9 B;  5IGL A;  4TT2 A;  5JI8 A;  2R57 A;  4ALH A;  1T0H A;  5KYU B;  4HBV A;  2HQE A;  1K8A R;  4LYS A;  3P5O A;  2DRM A;  2AIR B;  4B9X A;  2KXD A;  2RQU A;  5E7D A;  3HL8 A;  5EV9 A;  4TU6 A;  3SFM A;  2LQN A;  2PNI A;  1ABO A;  1RAH B;  5C6S A;  3RMQ A;  5L98 A;  3WVD B;  3KUF A;  4D8D A;  3ULR B;  2RB6 A;  5D3J A;  3OS0 A;  3S6W A;  1WNL A;  1V76 A;  3MET A;  3MQM A;  5FB1 A;  2CUD A;  5DLX A;  3EGU A;  1O9S A;  1VQO T;  4YYD A;  5A5N A;  3GPL A;  1KQS S;  5KTW A;  3L2Z A;  2RD1 A;  4XQ3 A;  1G3W A;  2OX7 A;  1UFF A;  1X6B A;  4OMF B;  2SEM A;  3JVM A;  3CD6 Q;  1JM4 B;  4KH1 B;  4OMN A;  4HXO A;  4M7A C;  2BE7 D;  1YJN Q;  1WHJ A;  1PM3 A;  5D7U A;  2FPE A;  1NJI U;  3EH2 A;  3CPW A;  2QTX A;  1X0J A;  1ZHI A;  3CXC A;  4M75 F;  4EMK B;  3RER A;  5GJW B;  3OS1 A;  1X01 A;  4AFU C;  4X1V A;  1OV3 A;  3LGF A;  1BK2 A;  3PFS A;  1VQ8 A;  1OPK A;  3CMA Q;  4N3W A;  1N8R C;  4AKI A;  4KV4 A;  2QQR A;  3CC7 Q;  1KG1 A;  1WFW A;  5E9Y A;  1O75 A;  3H6Z A;  2YRC A;  5CQX A;  1HD3 A;  1B34 A;  2EJG A;  1ZKR A;  4YAX A;  4JDS A;  4BE0 A;  3QII A;  5FU7 B;  2QEX T;  2M02 A;  2YSQ A;  5FLX E;  1VYT A;  5FFW A;  4MEQ A;  1UDL A;  1YWP A;  3CME Q;  1K8A U;  4AKN A;  4A9H A;  4L6V 5;  1M2V B;  3LXJ A;  5DFD A;  5HY6 A;  4AKH A;  2RI2 A;  3FLG A;  2FB7 A;  3GNG A;  1YIT A;  3CCM T;  1VQP Q;  3NTH A;  5GMK m;  3HRS A;  2DXU A;  3HKS A;  5G4R A;  2IVW A;  4NL3 A;  2DPP B;  2DKG A;  3VUZ A;  2OTJ T;  5D3N A;  3GOX A;  5LVQ A;  4CUS A;  2VXE A;  5I40 A;  5DYU A;  4RTW A;  4M77 C;  2L3S A;  2QAZ A;  1OEB A;  1UEC A;  2A37 A;  4ELY C;  1XOV A;  2YWW A;  1W2B P;  5ENJ A;  2RI3 A;  5GAM f;  5C85 A;  3HRU A;  3GF5 A;  4M75 G;  4M7A A;  1W6X A;  3V8K A;  4ZGD B;  4KT0 E;  2DYB A;  5HLS A;  2DBK A;  2YXY A;  4WHW A;  3CPF A;  5A5O A;  2ZPB B;  4RMO A;  1UEB A;  2HQH A;  1AVZ C;  4K11 A;  2LNH B;  5CO7 A;  4YY4 A;  4CFK A;  2YQD A;  2DYI A;  1Y07 A;  1VQ5 T;  1NYF A;  3UA7 A;  5LJ5 e;  3JB9 H;  4O71 A;  4GY5 A;  4OVA A;  5TCM A;  4HT8 A;  5CPE A;  4N4F A;  1VQK Q;  5GAN j;  3ER0 A;  2KSS A;  4UC4 A;  1T0J A;  3CC2 T;  1TS9 A;  5A0L A;  4ZQL A;  2O31 A;  4IUT A;  5E3D A;  2WSE E;  1Q82 R;  4DA4 A;  5HFQ A;  1N6A A;  4MZT A;  2EYQ A;  2RHU A;  4E2F B;  4IUV A;  4OMO A;  2PVG B;  1VQO Q;  3QXE B;  5CRZ A;  2RMO A;  2ESW A;  3CD6 A;  3JVK A;  1E6I A;  4PNO A;  4O7B A;  1YJN A;  4HCZ A;  1K9M U;  1YWO A;  1OYX A;  4UYF A;  2EGA A;  2E12 A;  2COZ A;  4FLP A;  5CUE A;  4CL9 A;  2VYT A;  1Y96 B;  1Q7Y U;  2E5K A;  4N4H A;  3QWX X;  3CCJ T;  1VYV A;  3OYG A;  4YYI A;  2D6F A;  4PJO D;  1FXX A;  1IRX A;  4RTY A;  4M77 A;  2C06 A;  2CT3 A;  5CK9 A;  5I86 A;  3E9F A;  3CC7 A;  4BJX A;  4A4K A;  1MHN A;  3K2J A;  1KQ1 A;  1NPR A;  3EGD B;  2HKN A;  2CUB A;  4E6R A;  1R0C B;  4DOW A;  4YBM A;  3G0L A;  1KHC A;  4A9K A;  3JCM h;  2VUB A;  2J7I A;  1WUM A;  2DD4 A;  3OW2 P;  2DRK A;  1OX9 A;  2PZ1 A;  3CME A;  2KTB B;  2EBP A;  4NR4 A;  1VUB A;  3M54 A;  3JCM Q;  2A0F B;  3VV0 A;  3RDV A;  5GAN 2;  2HAX A;  1TOV A;  4M7D B;  1ZX6 A;  1V1C A;  5ENI A;  5LUU A;  1KQ2 A;  4FM4 B;  5E9K A;  4QR5 A;  3MP8 A;  3PGG A;  4LZS A;  4JUV A;  5FRM A;  3QDR B;  3RBB B;  2OAW A;  4LUD A;  2OTJ Q;  1M5Q 1;  4AT1 B;  1CKA A;  1Q82 U;  5A83 A;  1QKW A;  3SDZ A;  1U8R A;  2JNG A;  1RAF B;  1K8A C;  1M1K R;  4RCC A;  4BAC A;  4QNS A;  2KGT A;  4GLK A;  6AT1 B;  4NXJ A;  1TU0 B;  2L3P A;  4C92 C;  4QC1 A;  1M1G A;  5GMK e;  4HXL A;  5G4S A;  2VKN A;  4EMK C;  5GAN h;  1K0X A;  2WP1 A;  4IUU A;  2MI6 A;  3JCM V;  1SG5 A;  4OGC A;  4LD9 K;  5F5Z A;  1H3H A;  4NR8 A;  4UYE A;  5EG2 A;  3G71 T;  4O70 A;  3JB9 D;  2DM1 A;  5D3R A;  1MUZ A;  4F16 A;  8AT1 B;  4WIV A;  1VQK A;  3JSC A;  1WJS A;  5L8R E;  3P8H A;  4J9I A;  1Q86 R;  3MEW A;  3EG9 A;  5D6Y A;  3CEY A;  3FJ5 A;  2HBW A;  3G4S A;  5CUG A;  4UIX A;  2LJ1 A;  5KYU A;  5FU7 C;  1NPP A;  2JJ9 A;  1KD1 R;  4JRQ A;  1ACM B;  5HCL A;  5KHM A;  2GGR A;  4JRP A;  4OMP A;  3CXC S;  1G5V A;  3JCM c;  3U23 A;  5LL6 S;  2XI9 A;  2F2W A;  5F3A A;  3E9G A;  1SRL A;  2R0S A;  4Y03 A;  1YHQ T;  4NOY A;  2XDD A;  5FE9 A;  5E0R A;  3M53 A;  1Z9Q A;  3OY9 A;  4C8Q B;  1QVF A;  2DWW A;  5CGP A;  2QQB A;  5EA1 A;  1WXB A;  4QZS A;  4WTO B;  3M56 A;  2M51 A;  2OJ2 A;  3OYH A;  4J0S A;  2CH4 W;  4YAT A;  1UUE A;  4PLI A;  3QBY A;  4VUB A;  4ESR A;  3SWN B;  5BT4 A;  5D7X A;  3NFC A;  3KXT A;  5A5S A;  4FCY A;  4FT2 A;  4KBM B;  4IUQ A;  4DON A;  5DFB A;  1SRM A;  2LQK A;  3JV3 A;  3TRE A;  4KUL A;  2CH4 A;  5DLZ A;  3UF4 A;  1WHK A;  3NPF A;  2CP2 A;  4QSX A;  1UTI A;  4XU0 A;  2YYN A;  4RTZ A;  2CSI A;  1U3O A;  4QW2 A;  4C5H A;  5HQ5 A;  1D0Y A;  5E73 A;  5AD2 A;  3OS2 A;  4CFL A;  4PJJ A;  3JCM g;  4AFS C;  2QDL A;  4LZR A;  1QVF P;  1X27 A;  4EMK A;  4FT4 A;  3M0R A;  5GAN 8;  4M75 D;  3UPU A;  2KRM A;  1VQL Q;  3P8B B;  1C1A A;  4NL2 A;  5ENC A;  4QUU A;  3CBP A;  4C8Q E;  2FRW A;  3G6E A;  1N9R A;  4FSS A;  1KQS A;  2L5Q A;  2D8H A;  5GAN 7;  1VIE A;  5J39 A;  1FX7 A;  4XTY A;  3JAM E;  4EMH A;  2YRV A;  1AWO A;  5I21 A;  5EPR A;  2KRO A;  4EPC A;  1JO8 A;  5LKX A;  2DXT A;  1HK9 A;  2XHC A;  1AZE A;  4LDF A;  2OTJ A;  2R0V A;  5DFC A;  1QVP A;  2DJQ A;  4NUD A;  2DFU A;  2RN8 A;  4BDY A;  1K76 A;  2M9U A;  4DBH A;  3UWN A;  1D1C A;  3JCM X;  2C0T A;  1ZBJ A;  3JCM P;  4IR5 A;  1GFC A;  2K3X A;  1UGP B;  2DEU A;  1VQ4 Q;  3VS3 A;  3EG0 A;  3U5P A;  1GRI A;  3MO8 A;  4Z1Q A;  2EQI A;  1YJ9 T;  5GAN g;  2DAT A;  3OYL A;  2RHY A;  5D6W A;  1M90 R;  3VKH A;  2RNA A;  3S3O A;  4NR5 A;  1PCX A;  4L59 A;  4HXK A;  5AD3 A;  1BCM A;  4ORZ A;  3MUL A;  2DF6 A;  3V8L A;  2D9T A;  1MND A;  3RES A;  3LGL A;  2CRE A;  1BKB A;  2DXC A;  3G71 Q;  2RJF A;  2FSA A;  5FE4 A;  5D3S A;  1IXD A;  1Q82 C;  2DVR A;  4MEP A;  3QDF A;  3G1J A;  3N5B B;  2P0K A;  3QZV A;  1HJD A;  5LVR A;  5I2M A;  5EPB A;  2QQA A;  5F63 A;  2E5Q A;  4ZTJ A;  1T3L A;  4CC2 A;  2JN0 A;  4FU6 A;  3MHX A;  2L0A A;  4O7C A;  5E9L A;  4PL6 A;  3VU3 C;  1N5Z A;  4N0A C;  4HCC A;  4HXR A;  5CP5 A;  4CUQ A;  3NTK A;  1QMC A;  1QLY A;  2CP5 A;  4EDU A;  1YI2 Q;  3NGP A;  3OSS C;  1X69 A;  3LQI A;  4MR6 A;  3E19 A;  4QUT A;  5I83 A;  4YC9 A;  3CBM A;  2EGC A;  5F25 A;  3M0S A;  5ENB A;  1R0B G;  1RL2 A;  2LRQ A;  4ZGE B;  1I8F A;  5DLQ E;  4F7U B;  3O33 A;  3FJP A;  1YIJ Q;  3VYH B;  1TWB A;  1H8K A;  3CCU T;  5A82 A;  1UGV A;  2E7O A;  5F62 A;  2F5K A;  3VJP A;  2O4X B;  5IBN A;  2K7A A;  4IR6 A;  4NRC A;  3M58 A;  3OYJ A;  1QVG P;  4JJC A;  2XKO C;  2DE0 X;  1UGR B;  4Q5W A;  4DBF A;  1Y96 A;  3SEM A;  5EWC A;  1IGU A;  5GAO m;  2MJV B;  5CRM A;  5LJ1 A;  1VQL A;  4UIT A;  2AZS A;  5DKD A;  3CBO A;  2LSP B;  2PVO B;  3OYF A;  1TXQ A;  1YCY A;  4O74 A;  4LZ2 A;  5FE3 A;  2MK5 A;  3EHQ A;  3REB B;  1UJY A;  3GLX A;  1WUG A;  5KO4 A;  4OGJ A;  2BZ8 A;  3EGD A;  4PKC C;  2EW3 A;  5A5P A;  5GAN 3;  3LH0 A;  2JMC A;  4J9E A;  3TCJ A;  5LJ3 d;  4F7U E;  4PJN A;  2RNX A;  4OMQ A;  5KE3 A;  3A8G B;  1SHF A;  3I9Q A;  4HKE A;  1M3B A;  4JJB A;  3UVX A;  3L2V A;  1M1K C;  3MEA A;  2AHJ B;  2KXC A;  4E7J A;  3JB9 I;  3JCM d;  2DVQ A;  2X9H A;  5GAN 4;  1AT1 B;  2EQK A;  5E9M A;  1X2K A;  3QG1 A;  3PNW C;  1VQ4 A;  2WP2 A;  5EU1 A;  3BFM A;  4M7D A;  4IOO A;  4KH0 B;  2PUO B;  4C8Q C;  4A4H A;  5I89 A;  2E3K A;  2E3I A;  4IIO A;  2JW4 A;  1A0N B;  1MGQ A;  2DMO A;  3CCL Q;  1I0C A;  2AKL A;  4PCE A;  3I56 T;  4C92 F;  1XTD A;  1ZUK A;  4NQM A;  4UIZ A;  1Q86 C;  2QQ9 A;  2J6O A;  1QP3 A;  1HYO A;  3IU6 A;  3VS7 A;  1KD1 C;  3JB9 F;  2CZ6 B;  2YLB A;  3VS5 A;  4O78 A;  1KC8 R;  1FMK A;  5HEM A;  4HXS A;  2P4T A;  2C0I A;  1F1B B;  5AME A;  2GTO A;  3X25 B;  1QVF S;  5GAO r;  2L2P A;  4CUR A;  4TU4 A;  3L2U A;  5HRV A;  2BTT A;  5GAN d;  4UIW A;  4HBW A;  4QB3 A;  5D6X A;  2EYX A;  5BT3 A;  2RFJ A;  1YI2 A;  1F68 A;  3V7C A;  1QCO A;  1SHG A;  1W70 A;  1AWW A;  3UVY A;  1D3B B;  4IKF A;  3PT9 A;  1G2B A;  2MPX C;  3QZS A;  3TQ7 P;  4JJD A;  1BI1 A;  4ZGJ B;  3T9N A;  1VQ6 Q;  3GP8 A;  2GRC A;  7AT1 B;  4E47 A;  1VA7 A;  1KHI A;  1YIJ A;  2V26 A;  4XUA A;  2JOY A;  1UG1 A;  3G7Z A;  2MYS A;  2NUP B;  2FL7 A;  3JVJ A;  1VQM A;  2M1H A;  1P92 A;  4KGX B;  3D7C A;  2GQI A;  5DYC A;  4JPB W;  2D0N A;  2EYZ A;  3MXF A;  4QSW A;  1T3S A;  3A98 A;  5CVI A;  2LCC A;  1WHG A;  2FYK A;  3L2W A;  4Z02 A;  2L3Q A;  4C8Q A;  2MAM A;  5CU8 A;  4QSP A;  1FMW A;  3H0H A;  4RCB A;  4QR3 A;  2KRS A;  4C92 G;  2M16 A;  1OI1 A;  2EJF A;  5C0M A;  3RR6 A;  3TSW A;  2DL3 A;  5FH7 A;  2OO1 A;  3CQT A;  5GAM e;  5L8T A;  3E1S A;  4M7A D;  2J6F A;  3SWN A;  3CCE Q;  4C5E A;  2RJE A;  4O75 A;  4YY6 A;  2JTE A;  2KE9 A;  3J81 E;  2K6D A;  2KDS A;  4O72 A;  4JZ3 A;  3UVW A;  1JJ2 P;  2OTL T;  2EKH A;  5I11 A;  4QSU A;  4KV1 A;  3JB9 G;  3CC4 T;  3R6O A;  4J5Y A;  4IR4 A;  3CCS T;  4QQD A;  2W0Z A;  3HPW A;  4AMC A;  3I55 Q;  5L97 A;  2VGM A;  3EG2 A;  2K57 A;  2KR3 A;  1KC8 U;  2D82 A;  1ZUU A;  1GBR A;  2ED0 A;  1IHW A;  2K5F A;  1BYM A;  4M78 B;  1VQ9 T;  1VQ7 T;  4BI8 B;  1M90 C;  1M30 A;  5LJ3 j;  1KSW A;  3BY7 A;  3A8M B;  2XK0 A;  1W2B A;  3UW9 A;  4OGE A;  2EQU A;  2JXB A;  5LKT A;  1SSH A;  2EVR A;  4NUE A;  2LX9 A;  3CCL A;  4YYN A;  4HA8 A;  1RLP C;  2WSC E;  5FBX A;  2R58 A;  2R5M A;  3EFO B;  4J83 A;  1HXD A;  1U06 A;  5DLO A;  1GCQ C;  2A3L A;  2RM4 A;  3F70 A;  5LJ5 d;  3U5N A;  1K0S A;  4ATO A;  4J9C A;  5H1U A;  4UIY A;  4HT9 A;  5KYY B;  5CIU A;  2K3Y A;  4Z6I A;  1WI7 A;  4M77 D;  4BW3 A;  3OYE A;  3CCQ T;  1BIA A;  3AT1 B;  2JTF A;  2KYM A;  3CCR T;  3IQL A;  3A8L B;  2CP6 A;  4O5V A;  3EG1 A;  4M78 E;  2X51 A;  2R10 A;  5IGN A;  5CS8 A;  2QA4 T;  2ZPG B;  1NEG A;  2YUP A;  2X4X A;  4E7Z A;  2ZPF B;  4R55 A;  4XUB A;  2CZ1 B;  2KY9 A;  1M8V A;  4XTZ A;  2D8J A;  3ZL7 C;  1S72 T;  2N9G A;  5EGU A;  4JLI A;  2LZ6 B;  2BZY A;  2QK0 A;  5FE2 A;  1PHT A;  1Y57 A;  1VQ6 A;  2HCK A;  1KFZ A;  3Q2E A;  2H8H A;  4NUC A;  4A9J A;  2X4Y A;  4UIU A;  5C7N A;  4CLB A;  3U5J A;  2K9G A;  2RK2 A;  4FIB A;  1EZZ B;  1ZUY A;  5E9V A;  2KBT A;  1WHH A;  5II2 A;  3RKW A;  5D26 A;  2MOX A;  2DTI A;  2WSF E;  4M75 B;  4PY6 A;  3JCM J;  2P84 A;  4QVD A;  2LC4 A;  1Y71 A;  5HRW A;  5DY9 A;  1BB9 A;  3PVQ A;  2V8K A;  3TSZ A;  3TU4 K;  2GQV A;  2E6Z A;  5L8U A;  1M8M A;  3CCV T;  1FYN A;  3FC3 A;  4NR6 A;  5C8G A;  3A1P A;  4UIV A;  3CCE A;  4F7U A;  4MZP A;  3OW2 A;  4R0K A;  1GCQ A;  4JS4 A;  2J05 A;  3ASK A;  3GBQ A;  1XJW B;  1NE8 A;  5CTL A;  1VOM A;  2O4X A;  2OTL Q;  4IOR A;  4A63 B;  4PCI A;  1WHM A;  4O77 A;  4C66 A;  2LX7 A;  3I55 A;  3CMA A;  5CQA A;  2E41 A;  5LJ3 h;  4TQN A;  1UHF A;  1YJW T;  1SSF A;  1VQN T;  4HCB A;  2DTH A;  2CT4 A;  4ZN1 A;  3KBG A;  4FW2 A;  5HFR A;  2O01 E;  4QT7 A;  2DL8 A;  5J0D A;  4RKU E;  4A9L A;  1DJ7 B;  4LDU A;  5CCA A;  4XU1 A;  4C0G A;  1QQJ A;  1U5S A;  4N4G A;  4C0D B;  1QP2 A;  4AI6 A;  3MEU A;  2MWP A;  3IU5 A;  1EQF A;  3HHT B;  1D09 B;  2QEX Q;  3THK A;  2XG8 D;  2L3R A;  5CUC A;  4JZ4 A;  4PK4 A;  2HL3 A;  4Y92 A;  3NTI A;  4LD6 A;  4XTU A;  5L99 A;  2ABL A;  1VQP A;  2RI5 A;  1XQH A;  4EIK A;  1JSP B;  1KC8 C;  5GAN 5;  4B6M A;  3CCM Q;  3RMS A;  2MF2 A;  1MMG A;  2XIC A;  1WHL A;  2HBP A;  4O7F A;  4XK8 E;  1MNE A;  2D0Q B;  4MR3 A;  2GFU A;  3RCW A;  3M55 A;  4JS5 A;  4J7I A;  3J7A F;  2IPO B;  4CC7 A;  1WPY A;  3OMG A;  1PG5 B;  4MMK A;  5GAN 6;  1B07 A;  3CCQ Q;  4D6W A;  4GBQ A;  4CUT A;  3CCR Q;  2ZGW A;  2NUT B;  5LJ5 j;  4C92 D;  5IGM A;  4DQ2 A;  2SRC A;  5FRN A;  4J0R A;  4QVC A;  4NR9 A;  2QA4 Q;  2E70 A;  2IIM A;  2NXB A;  2RHX A;  1R8O B;  3QJY A;  5FG6 A;  2DVV A;  2P0P A;  4CC4 B;  2XU8 A;  3EHR A;  4LNP A;  4M7D E;  4L5G A;  3RNJ A;  5D3L A;  4AFZ C;  3OBY A;  3H0F A;  2IG0 A;  5GAM h;  5GAO p;  2H3J A;  4QVZ A;  1VQ5 Q;  5J26 A;  4C5G A;  2FRY A;  5K29 A;  3VYG A;  1GBQ A;  4KRT A;  4DOV A;  3O36 A;  2HNI A;  2NYS A;  1AD5 A;  2ROL A;  5CQ5 A;  3VKI A;  4AG1 C;  5DW1 A;  3URG A;  4IIM A;  4E7K A;  4M78 C;  4PTB A;  1MV3 A;  3CC2 Q;  4Z6H A;  4XY9 A;  2FPF A;  5A2Q E;  4XY8 A;  1UE9 A;  2QQS A;  3AHU A;  3OYD A;  1OOT A;  1D3B A;  1Q95 G;  3DB4 A;  5L23 A;  2JUF A;  2RK1 A;  1VQO A;  1D0X A;  4E7S A;  1ZA2 B;  4ZW1 A;  1MMN A;  2A7Y A;  5AT1 B;  4NRB A;  2E4H A;  5L96 A;  2NLU A;  4RG2 A;  4PLL A;  5EP7 A;  3GIB A;  2HZY A;  3QWY A;  2R5A A;  5EWW A;  2NUP A;  4XU3 A;  9ATC B;  1WDX A;  4M7A F;  1HSQ A;  3CCJ Q;  3DLM A;  4XTV A;  2LMJ A;  1RAD B;  5LJ3 g;  5HEN A;  4GLM A;  2KAF A;  5HK3 A;  1W2B S;  5D3T A;  5IG6 A;  4FSX A;  3PMI A;  3S92 A;  3U5L A;  1YJW Q;  2JM8 A;  4ZC9 A;  3MP6 A;  5COI A;  3M5A A;  2FG0 A;  3JCM W;  2RO0 A;  1M1K U;  1C6V X;  2X3X D;  4LDX A;  4B9W A;  3QPH A;  3RIR A;  5EWH A;  2KQW A;  1X43 A;  2I2L A;  2BKD N;  5CQ7 A;  5FWB A;  5LKZ A;  5EVA A;  2QEX A;  3V7R A;  2VXF A;  4HVW A;  2ROT A;  3SVG A;  3UVD A;  3VS6 A;  2RA2 A;  3AAD A;  5C87 A;  2RQR A;  4YH4 A;  1ZLM A;  2JS2 A;  4X9D A;  5CQT A;  1WZO A;  4RUG A;  3QZ9 B;  5EIS A;  4HBX A;  2O2O A;  2EYW A;  4QEU A;  3CCM A;  4UYH A;  4LDV A;  4M78 A;  1MV0 B;  1VIF A;  2L89 A;  5LJ5 h;  1Q86 U;  3H41 A;  2O9S A;  4P5N A;  2Y4X A;  5GMK j;  4J6X A;  2ATC B;  2X35 A;  3M0T A;  2Y90 A;  1AWJ A;  3VRY A;  2DZ9 A;  1KD1 U;  3OS5 A;  1M2V A;  2DER A;  1YCS B;  2EJN A;  4AG2 C;  4M77 F;  5D3H A;  3QSU A;  3EFO A;  2RPN A;  2OAU A;  1VQ8 T;  2RQV A;  3M0U A;  4LUE A;  1I81 A;  1PKT A;  2DXB A;  2QXF A;  2XD0 A;  4DEX A;  3A8H B;  4M7A G;  1SKU B;  5II1 A;  5KYY A;  5CAI A;  5CKD A;  2LQ8 A;  4OML A;  1M4Z A;  5CUB A;  3AQA A;  1J3T A;  1D1A A;  1VQ5 A;  4HVV A;  4F04 B;  4QQ6 A;  3P1D A;  2BZX A;  3REA B;  1K73 R;  2HEQ A;  3M0P A;  1LOJ A;  4J9D A;  5IT9 E;  2LVM A;  1ARK A;  2DX1 A;  2GFA A;  3UDC A;  3HSB A;  1KIK A;  2J06 A;  2L85 A;  4YYM A;  4LE9 A;  2CZ7 B;  3WXM B;  1WJQ A;  2JVV A;  1OU8 A;  3CC2 A;  4C0D C;  2O88 A;  4F14 A;  4BW4 A;  2ECZ A;  3OB9 A;  5CQ6 A;  4HXJ A;  4XU2 A;  1YIT T;  4X34 A;  3OW2 S;  5I29 A;  3O5Z A;  2KI7 A;  1H64 1;  1E7O A;  4ME7 A;  4MR4 A;  5IHN A;  4BE2 A;  3FRN A;  4M7D C;  1RAB B;  1QVG A;  1YHQ Q;  2HQX A;  1WXT A;  3G0J A;  1G3S A;  3MB4 A;  2G3R A;  2LDM A;  4HCK A;  2FPD A;  2DL5 A;  2R0Y A;  1EFN A;  5TB6 A;  3D1D A;  2ZAE A;  3SB2 A;  3CCJ A;  4M75 A;  4J6W A;  5AMF A;  3O8V A;  1TTH B;  1K1Z A;  3RKY A;  4F3I A;  3S91 A;  2HDA A;  4CC3 A;  2DA9 A;  2KVQ G;  1SPK A;  4M77 G;  8ATC B;  4J6Y A;  4Z93 A;  5D25 A;  5DW2 A;  5D3P A;  1W1F A;  1M3A A;  4A9F A;  3I5R A;  1NM7 A;  1OQK A;  4RTU A;  1BI3 A;  5ETB A;  1NZ9 A;  4YAB A;  2PUK B;  4MDX A;  4NYW A;  2QAS A;  2D9E A;  3MPU B;  2DIL A;  1M90 U;  3V7S A;  3LLR A;  4GPJ A;  2VVK A;  5GMK h;  4OGI A;  5ETD A;  1LPL A;  3HTR A;  5C89 A;  5I88 A;  2F5T X;  4EMG A;  1YN8 A;  3L42 A;  1CSK A;  3M4G A;  4UYD A;  1Z9Z A;  3QZT A;  4Z88 A;  3CD6 T;  2C0O A;  2YUQ A;  4FYV B;  5LJ5 g;  2E7N A;  1YJN T;  3R6N A;  3ZFJ A;  4OMM A;  1OUL A;  2XDP A;  1MMD A;  5F60 A;  5GJV B;  2VV5 A;  5A7C A;  1AWX A;  4TZ8 A;  3QHS A;  2YW5 A;  3P1F A;  1RAC B;  2EJ9 A;  4JRI A;  4LN2 A;  3EAE A;  2PVD B;  2E64 A;  3I3J A;  5FG4 A;  4R56 A;  2QDY B;  1WQ7 A;  1WYX A;  4YK0 A;  2KYB A;  4C8Q D;  2RQW A;  1PKS A;  2LP5 A;  3OSV A;  4RTT A;  4HXN A;  4LYI A;  4E7L A;  3CC7 T;  5GAO n;  5DKC A;  1IZ6 A;  1Y7X A;  2DZC A;  3C95 A;  1YJ9 Q;  4E7I A;  1XNI A;  5EQ1 A;  3FB9 A;  3SWN C;  3LQH A;  5CZG A;  3G71 A;  1OZ2 A;  1X6G A;  2P0Q A;  1VYU A;  3CME T;  4A4F A;  4J9H A;  5HM0 A;  1JXO A;  4F17 A;  2NUT A;  1RI9 A;  5HQ6 A;  5I80 A;  1PD1 A;  2K4Y A;  2V1R A;  4QBM A;  2ZCF B;  2LT4 A;  2F6N A;  5IXB A;  4XTX A;  3GG3 A;  5FWC A;  3PIO A;  4YYJ A;  5GMK i;  4M78 F;  5FH6 A;  5KH6 A;  4A9O A;  3U5K A;  4QSR A;  2L5E A;  3MEV A;  2I0N A;  1B7T A;  4QST A;  1FWZ A;  4OF1 A;  2LJ0 A;  3PMT A;  1YHQ A;  1X75 C;  4Z89 A;  4PJO B;  3JCM e;  5GAM d;  4LR6 A;  4O6J A;  2L84 A;  4BI4 A;  3ZEH A;  4PJM A;  4II1 A;  1UGS B;  1ABQ A;  1QCN A;  1UHC A;  3A5Z B;  5DY7 A;  1WIE A;  5H85 A;  1JJ2 A;  2DL7 A;  5EIC A;  3MB3 A;  3VS2 A;  4O76 A;  1PNJ A;  3FDR A;  3D1B A;  5LKU A;  5KE2 A;  4Q0N A;  2B8A A;  5I2S A;  4CI0 C;  2K79 A;  3MP1 A;  3CCU Q;  3HFO A;  1WGS A;  4YTL A;  1TUG B;  3SD4 A;  2YEM A;  3P1E A;  2KNB B;  2MWO A;  4QEV A;  1VQK T;  5IHI A;  1PRL C;  3G4S T;  3VS4 A;  5CQ4 A;  3DWY A;  5ENF A;  1W4S A;  4PJO E;  1G3T A;  1I4K 1;  4WHU A;  2QYZ A;  2RS9 B;  2AKK A;  2XDB A;  3QZ5 B;  2ZPE B;  5KYN A;  1M9S A;  1RUW A;  1BU1 A;  4TZ2 A;  4JRK A;  4Y28 E;  5CQ3 A;  5GAN e;  4PFO A;  4FYX B;  1TH7 A;  5HJC A;  3X26 B;  2M0Y A;  3HP9 A;  3OYB A;  2JM9 A;  5FFY A;  2PU9 B;  5LJ3 f;  2LQW A;  4M78 G;  4FW1 A;  4IR3 A;  4C92 B;  2RI7 A;  5FW9 A;  5CY9 A;  1I07 A;  5DYA A;  2COY A;  3H0I A;  2E3H A;  3JCM f;  2KMT A;  3VUB A;  2DBM A;  2EIF A;  2GBQ A;  2DET A;  4NR7 A;  2CS7 A;  1YJ9 A;  2E65 A;  2KK4 A;  1K73 C;  3OBW A;  2MIO A;  3M59 A;  3UV5 A;  3OYN A;  5FDZ A;  4OP0 A;  3I56 Q;  5ECA A;  1ZBX A;  2NUZ A;  2PTK A;  4AKG A;  2ENM A;  5F61 A;  3CPW P;  1JBM A;  3CXC P;  5BT5 A;  4NYX A;  4QR4 A;  2DLP A;  1H3Z A;  1FMV A;  3G6E T;  5FH8 A;  3DKM A;  2V8J A;  5IID A;  3ME9 A;  4C92 E;  4J1P A;  1K9M R;  1QVG S;  4QSS A;  2QGG A;  4NYV A;  1Q7Y R;  4RG8 A;  4BW2 A;  3QUI A;  4PKL A;  4QYD A;  1I1J A;  5DKH A;  5LJ0 A;  3VRZ A;  4D8K A;  4JJN K;  2RO1 A;  1YBY A;  1KK7 A;  3C4S A;  1YNZ A;  4ANJ A;  2YT6 A;  5GAN f;  3TEE A;  2OI3 A;  1RLQ C;  3NHN A;  5EM3 A;  3I5S A;  4J9F A;  4OB0 B;  5FE0 A;  3ZBD A;  1WQW A;  5CQY A;  3H8Z A;  4M7D F;  5HK0 A;  3BW1 A;  3M0Q A;  2DAQ A;  1LCK A;  2FZK B;  1QWE A;  4E7H A;  4KCX A;  2XMF A;  3DAI A;  2DJZ A;  1I5L A;  1NLO C;  2CKK A;  2YDL A;  5I7Y A;  3UAT A;  3U5O A;  3PE0 A;  3X24 B;  1ZSG A;  1PC0 A;  4HVU A;  3OYM A;  2YUN A;  3VS0 A;  3CCU A;  5F1H A;  4NRA A;  4DEY A;  5GAM j;  3BDL A;  4Z1S A;  2A36 A;  3SVF A;  4ALG A;  5IAY A;  4MDW A;  5CKH A;  4QEW A;  1ZQ1 A;  5CKB A;  5KCH A;  5EI4 A;  4CUP A;  3HMF A;  4BE1 A;  4JLG A;  1TG0 A;  5E3G A;  3X28 B;  1BIB A;  4XAX B;  1CKB A;  1M27 C;  5CUA A;  2DKW A;  1G3Y A;  3G4S Q;  2F69 A;  5CUD A;  2A08 A;  4A9M A;  3LX7 A;  2HMA A;  5H1V A;  2CP3 A;  2QGF B;  3JB9 J;  2LT1 A;  4BUG A;  1BBZ A;  5GMK l;  3CC4 Q;  3Q2F A;  4BDZ A;  2YEL A;  2EQJ A;  4YYK A;  2K2M A;  3CCS Q;  3S3M A;  1OU9 A;  2DD5 A;  1X2Q A;  2V1Q A;  5CR2 A;  5EWV A;  3L1A A;  4DBR A;  4N4I A;  2H3E B;  1ZSZ B;  3EGX B;  4M75 E;  2VAS A;  4YAD A;  1BCO A;  1IB8 A;  1X6O A;  1Q81 R;  5KYX B;  4YH3 A;  3PVL A;  2D1X A;  3INZ A;  3OQ5 A;  2MCN A;  1YFN A;  3EG3 A;  1VQ9 Q;  1VQ7 Q;  4PJO C;  2W10 A;  2YUO A;  3LJW A;  4M7D G;  2HSE B;  4HXP A;  3QJ6 A;  4LC2 A;  1UB4 A;  5A85 A;  2EQM A;  3U5M A;  1N72 A;  3QKJ A;  3HMH A;  2HD0 A;  4C8Q F;  4LDY A;  2FZG B;  4MML A;  2DEQ A;  3I56 A;  1Y0M A;  5GAO q;  1MMA A;  5ENE A;  2QI2 A;  1VQL T;  3BE3 A;  5F1L A;  2J6K A;  1NJI C;  3FIF A;  1WA7 A;  2AK5 A;  1QKX A;  1N27 A;  3NMZ C;  5FU6 B;  5LJ5 f;  2DIG A;  3OYA A;  2X4J A;  3FEO A;  5I1Q A;  4A9E A;  3G6E Q;  2H60 A;  1WXU A;  5CKF A;  2KRN A;  2E1H A;  5F2P A;  4IOQ A;  3MKD A;  2GNC A;  4BY6 B;  5CFW A;  3OYY A;  1IGQ A;  2DTO A;  1ZA1 B;  2KEA A;  2X3W D;  1OPL A;  1JJ2 S;  3KFV A;  5HEL A;  5D24 A;  2EKO A;  2CYZ B;  4Q0O A;  5FG5 A;  1S72 Q;  4CUU A;  3M4Y A;  1SF9 A;  1AEY A;  5EK9 A;  1JQQ A;  1VQ4 T;  2RQT A;  2YDW A;  1AHJ B;  5KYW B;  1BI2 A;  5A0G A;  4PS5 A;  3UT1 A;  4XTW A;  3L2R A;  4YYG A;  1KJW A;  2ED1 A;  4ELZ C;  2HSP A;  4M78 D;  2O9V A;  5FE8 A;  4RTX A;  5HKC A;  5KTX A;  3VKG A;  1JEG A;  4YBS A;  5HCK A;  1Q81 U;  2RH2 A;  4BHW A;  5A5Q A;  2CP0 A;  4IUP A;  2CGH A;  4PJO A;  5FE6 A;  1U1T A;  4CRI A;  2I7K A;  3C0C A;  4C8Q G;  2VWF A;  4BD3 A;  2DK3 A;  3PTA A;  3JRZ A;  3UA6 A;  3O37 A;  2QTV A;  4E96 A;  2CSQ A;  3CCV Q;  1TUC A;  1G83 A;  2I8N A;  5IXF A;  2LCL A;  2OTL A;  5FFV A;  3CPW S;  2K2V A;  3OMC A;  2EFI A;  3CC4 A;  4A9N A;  5LJ2 A;  2JS0 A;  4J9G A;  1YI2 T;  1WX6 A;  1E6G A;  4C5I A;  3CCS A;  1JU5 C;  4YBT A;  2YLC A;  3M57 A;  2CP7 A;  2K5L A;  5FE7 A;  2FZC B;  1VQN Q;  1SEM A;  3BDU A;  2FO0 A;  1GCP A;  4NQN A;  4ZNX A;  4NS5 A;  2JTM A;  3LQJ A;  1JB0 E;  2MMP A;  1VQ9 A;  1IO6 A;  1YIJ T;  1VQ7 A;  4A9I A;  1TSF A;  2F6J A;  3M9Q A;  4QQG A;  2A28 A;  1RAE B;  1VQM T;  2RNY A;  5ENG A;  1GL5 A;  1QW1 A;  1OX8 A;  4A54 A;  1LNX A;  4FL6 A;  2PQW A;  2NWM A;  1JXM A;  2Y4Y A;  2YHT A;  3HRT A;  5KCO A;  2HL5 C;  1ZS5 A;  5A81 A;  1PRM C;  2G6F X;  4C92 A;  2F2V A;  5E74 A;  2V8I A;  2XID A;  4WF2 A;  4LRG A;  2YRD A;  1EIF A;  1GFD A;  1AZG B;  3X20 B;  3C94 A;  5IN1 A;  1K9M C;  4F7U F;  2OUO A;  3FKM X;  3O35 A;  4M75 C;  2VB6 A;  2ZPI B;  1Q7Y C;  5IGK A;  3ZYU A;  4AFQ C;  1B34 B;  4QY4 A;  1H92 A;  5F36 A;  3DB3 A;  5H1T A;  1TUD A;  2AT1 B;  2EPD A;  1LJO A;  3CCQ A;  3CCR A;  2KT8 A;  4MEN A;  3OYC A;  5JWM A;  1JRI A;  3J80 E;  2QA4 A;  3SHW A;  3OA6 A;  3NXB A;  3EFR A;  5IHK A;  5HRX A;  4Y91 A;  2JZ2 A;  2LCS A;  1S72 A;  1PSE A;  2FVU A;  4BW1 A;  2K5I A;  4PJL A;  5GAM g;  4YYH A;  3LYI A;  4M4Z A;  1N8R R;  1NBE B;  4QKU A;  5I22 A;  1V29 B;  4LXC A;  3QYH B;  1D0Z A;  2DVJ A;  1PUO A;  1KQS P;  5HQ7 A;  1ZSZ C;  3HME A;  2DNU A;  3A8O B;  3CCL T;  4KGZ B;  2DVE A;  2RF0 A;  1G8X A;  4O7A A;  5EWD A;  3Q1J A;  2ZPH B;  1RAA B;  2FEI A;  2FHD A;  2AZV A;  4IUR A;  4ZN3 A;  3EH1 A;  2VGN A;  4M7A B;  4HXM A;  4J7F A;  3LW5 E;  4TTE A;  1WLP B;  4M7D D;  2CDT A;  4DBQ A;  3CCV A;  3JVL A;  1UGQ B;  2WAC A;  2L8D A;  4TYL A;  1QCF A;  4F7U G;  3ERR A;  4TS8 A;  4QSQ A;  1RAG B;  1K9A A;  2COW A;  4XYA A;  4O7E A;  5FU6 C;  1OZ3 A;  1I5O B;  1RAI B;  3I35 A;  1UJ0 A;  3V8J A;  2CZ0 B;  3SVH A;  4C0Z A;  4MZM A;  1Q81 C;  2K3B A;  2EYY A;  2P4R A;  1YJW A;  4X9C A;  1VQN A;  2EWN A;  4QYL A;  3C12 A;  1VQ6 T;  4PFP A;  5A5R A;  4KGV B;  4BY6 C;  5DX4 A;  1WJR A;  1AOJ A;  1E6H A;  2GTJ A;  2RJD A;  4BB7 A;  1NEB A;  5KTU A;  4M7A E;  2RHI A;  3MUK A;  1PSF A;  4Z8A A;  3WVE B;  4OB2 B;  2RHZ A;  3PIP A;  3E2U A;  4UYF B;  4LDW A;  2HKQ B;  3ONI A;  1U1S A;  3H9N A;  3MJX A;  5E9I A;  5CKE A; 
#chains in the Genus database with same CATH homology
 3L2Q A;  4PJO F;  2ZZD A;  4LYW A;  2RJC A;  2VC8 A;  1N8R U;  2G4A A;  4M77 B;  1K73 U;  2RNW A;  5ENH A;  4C67 A;  2OSS A;  3MCA B;  1RI0 A;  4MR5 A;  4MEO A;  4C0F A;  3CCE T;  2BUD A;  4OB3 B;  2YEK A;  2BIV A;  4J8O A;  5FE5 A;  4ZTF A;  4OUF A;  4UYG A;  3O34 A;  5ACY A;  4RVR A;  5FRO A;  2DO3 A;  5A0D A;  3UV2 A;  3GNF B;  4A4E A;  5D0C A;  3CMA T;  3I55 T;  3RKX A;  3LWI A;  3OYK A;  3P8D A;  4TT4 A;  3OYI A;  3P1C A;  5DBM A;  3EFS A;  2GCX A;  1N9S A;  4N0A A;  5CQ8 A;  5FE1 A;  3QYG B;  3TLP A;  2E6N A;  3LWH A;  4M77 E;  3RUX A;  3S3N A;  4HBY A;  4A4G A;  3UV4 A;  5FB0 A;  4TT6 A;  2LTO A;  5J3B A;  4A53 A;  1GXI E;  4V2S A;  5DYX A;  1VQP T;  5EPS A;  1BI0 A;  5AYF A;  5LJ3 e;  2GF7 A;  2LNV A;  3JCM b;  2X4W A;  3HFN A;  5C4Q A;  4QC3 A;  4PJO G;  2M0O A;  3DLL A;  5GAO l;  5DM7 R;  4J3I A;  4X2I A;  2E10 A;  4QSV A;  4TVR A;  4BI3 A;  3QO3 A;  2DVS A;  5KU3 A;  4KUI A;  4OB1 B;  1IRE B;  1M1F A;  4KUD K;  5I7X A;  2DIQ A;  2EAY A;  5M9O A;  5IGL A;  4TT2 A;  5JI8 A;  2R57 A;  4ALH A;  4HBV A;  2HQE A;  4LYS A;  3P5O A;  4B9X A;  5E7D A;  3HL8 A;  5EV9 A;  4TU6 A;  3SFM A;  5C6S A;  3RMQ A;  5L98 A;  3WVD B;  3KUF A;  2RB6 A;  5D3J A;  3OS0 A;  3S6W A;  1WNL A;  3MET A;  3MQM A;  5FB1 A;  5DLX A;  1O9S A;  1VQO T;  4YYD A;  5A5N A;  3GPL A;  1KQS S;  5KTW A;  3L2Z A;  2RD1 A;  4XQ3 A;  1G3W A;  4OMF B;  3JVM A;  1JM4 B;  4HXO A;  4M7A C;  1NJI U;  3CPW A;  2QTX A;  1X0J A;  1ZHI A;  3CXC A;  4M75 F;  4EMK B;  3RER A;  3OS1 A;  1X01 A;  3LGF A;  3PFS A;  1VQ8 A;  4N3W A;  1N8R C;  4KV4 A;  2QQR A;  1KG1 A;  5E9Y A;  1O75 A;  3H6Z A;  5CQX A;  1B34 A;  2EJG A;  4YAX A;  4JDS A;  4BE0 A;  3QII A;  5FU7 B;  2QEX T;  5FLX E;  5FFW A;  4MEQ A;  1K8A U;  4AKN A;  4A9H A;  4L6V 5;  3LXJ A;  5DFD A;  5HY6 A;  2RI2 A;  3FLG A;  2FB7 A;  3GNG A;  1YIT A;  3CCM T;  3NTH A;  5GMK m;  3HRS A;  2DXU A;  3HKS A;  5G4R A;  2IVW A;  4NL3 A;  2DPP B;  2DKG A;  3VUZ A;  2OTJ T;  5D3N A;  3GOX A;  5LVQ A;  4CUS A;  2VXE A;  5I40 A;  5DYU A;  4M77 C;  4ELY C;  1XOV A;  5ENJ A;  2RI3 A;  5GAM f;  5C85 A;  3HRU A;  3GF5 A;  4M75 G;  4M7A A;  3V8K A;  4ZGD B;  4KT0 E;  5HLS A;  4WHW A;  3CPF A;  5A5O A;  2ZPB B;  4RMO A;  1UEB A;  5CO7 A;  4YY4 A;  4CFK A;  2YQD A;  1Y07 A;  1VQ5 T;  5LJ5 e;  3JB9 H;  4O71 A;  4GY5 A;  4OVA A;  5TCM A;  4HT8 A;  5CPE A;  4N4F A;  5GAN j;  3ER0 A;  2KSS A;  4UC4 A;  3CC2 T;  5A0L A;  4ZQL A;  4IUT A;  5E3D A;  2WSE E;  4DA4 A;  5HFQ A;  1N6A A;  4MZT A;  2EYQ A;  2RHU A;  4IUV A;  2PVG B;  3QXE B;  5CRZ A;  3CD6 A;  3JVK A;  1E6I A;  4PNO A;  4O7B A;  1YJN A;  4HCZ A;  1K9M U;  1OYX A;  4UYF A;  2E12 A;  4FLP A;  5CUE A;  4CL9 A;  2VYT A;  1Y96 B;  1Q7Y U;  4N4H A;  3CCJ T;  3OYG A;  4YYI A;  2D6F A;  4PJO D;  1FXX A;  2C06 A;  4M77 A;  5CK9 A;  5I86 A;  3E9F A;  3CC7 A;  4BJX A;  4A4K A;  1MHN A;  3K2J A;  1KQ1 A;  1NPR A;  4DOW A;  4YBM A;  3G0L A;  1KHC A;  4A9K A;  3JCM h;  2VUB A;  1WUM A;  2DD4 A;  3CME A;  2KTB B;  4NR4 A;  1VUB A;  3M54 A;  3JCM Q;  3VV0 A;  5GAN 2;  2HAX A;  4M7D B;  5ENI A;  5LUU A;  1KQ2 A;  4FM4 B;  5E9K A;  4QR5 A;  3MP8 A;  3PGG A;  4LZS A;  4JUV A;  5FRM A;  3QDR B;  1M5Q 1;  1Q82 U;  5A83 A;  3SDZ A;  1U8R A;  2JNG A;  1K8A C;  4RCC A;  4BAC A;  4QNS A;  4GLK A;  4NXJ A;  4C92 C;  4QC1 A;  1M1G A;  5GMK e;  4HXL A;  5G4S A;  4EMK C;  5GAN h;  2WP1 A;  4IUU A;  2MI6 A;  3JCM V;  4OGC A;  4LD9 K;  5F5Z A;  4NR8 A;  4UYE A;  5EG2 A;  3G71 T;  4O70 A;  3JB9 D;  5D3R A;  4WIV A;  1VQK A;  3JSC A;  1WJS A;  5L8R E;  3P8H A;  3MEW A;  5D6Y A;  3CEY A;  3G4S A;  5CUG A;  4UIX A;  5FU7 C;  1NPP A;  4JRQ A;  5HCL A;  5KHM A;  4JRP A;  3CXC S;  1G5V A;  3JCM c;  5LL6 S;  2XI9 A;  5F3A A;  3E9G A;  2R0S A;  4Y03 A;  1YHQ T;  4NOY A;  2XDD A;  5FE9 A;  5E0R A;  3M53 A;  3OY9 A;  4C8Q B;  1QVF A;  2DWW A;  5CGP A;  2QQB A;  5EA1 A;  4QZS A;  3M56 A;  3OYH A;  4J0S A;  4YAT A;  4PLI A;  3QBY A;  4VUB A;  3SWN B;  5BT4 A;  5D7X A;  3NFC A;  3KXT A;  5A5S A;  4KBM B;  4FT2 A;  4IUQ A;  4DON A;  5DFB A;  2LQK A;  3TRE A;  4KUL A;  5DLZ A;  4XU0 A;  4QSX A;  2YYN A;  4QW2 A;  4C5H A;  5HQ5 A;  5E73 A;  5AD2 A;  3OS2 A;  4CFL A;  3JCM g;  4LZR A;  4EMK A;  4FT4 A;  5GAN 8;  4M75 D;  3UPU A;  3P8B B;  4NL2 A;  5ENC A;  4QUU A;  3CBP A;  4C8Q E;  3G6E A;  1N9R A;  1KQS A;  2L5Q A;  5GAN 7;  1VIE A;  5J39 A;  1FX7 A;  4XTY A;  3JAM E;  4EMH A;  2YRV A;  5I21 A;  5EPR A;  4EPC A;  5LKX A;  2DXT A;  1HK9 A;  2XHC A;  4LDF A;  2OTJ A;  2R0V A;  5DFC A;  1QVP A;  4NUD A;  4BDY A;  2M9U A;  3UWN A;  3JCM X;  3JCM P;  4IR5 A;  2K3X A;  1UGP B;  3U5P A;  3MO8 A;  4Z1Q A;  1YJ9 T;  5GAN g;  2DAT A;  3OYL A;  2RHY A;  5D6W A;  3S3O A;  4NR5 A;  4L59 A;  4HXK A;  5AD3 A;  3MUL A;  3V8L A;  2D9T A;  3RES A;  3LGL A;  1BKB A;  2DXC A;  2RJF A;  2FSA A;  5FE4 A;  5D3S A;  1Q82 C;  2DVR A;  4MEP A;  3N5B B;  2P0K A;  3QZV A;  5LVR A;  5I2M A;  5EPB A;  2QQA A;  5F63 A;  2E5Q A;  4ZTJ A;  2JN0 A;  4FU6 A;  3MHX A;  4O7C A;  5E9L A;  4PL6 A;  3VU3 C;  4N0A C;  4HCC A;  4HXR A;  5CP5 A;  4CUQ A;  3NTK A;  4EDU A;  3OSS C;  3LQI A;  4MR6 A;  3E19 A;  4QUT A;  5I83 A;  4YC9 A;  3CBM A;  5F25 A;  5ENB A;  1RL2 A;  2LRQ A;  4ZGE B;  1I8F A;  5DLQ E;  4F7U B;  3O33 A;  3FJP A;  3VYH B;  3CCU T;  5A82 A;  2E7O A;  5F62 A;  2F5K A;  3VJP A;  2O4X B;  5IBN A;  4IR6 A;  4NRC A;  3M58 A;  3OYJ A;  2XKO C;  1UGR B;  4Q5W A;  1Y96 A;  5EWC A;  5GAO m;  2MJV B;  5CRM A;  5LJ1 A;  1VQL A;  4UIT A;  3CBO A;  5DKD A;  2LSP B;  2PVO B;  3OYF A;  1YCY A;  4O74 A;  4LZ2 A;  5FE3 A;  3GLX A;  1WUG A;  5KO4 A;  4OGJ A;  4PKC C;  5A5P A;  5GAN 3;  3LH0 A;  3TCJ A;  5LJ3 d;  4F7U E;  2RNX A;  5KE3 A;  3A8G B;  4HKE A;  3UVX A;  3L2V A;  1M1K C;  3MEA A;  2AHJ B;  4E7J A;  3JB9 I;  3JCM d;  2DVQ A;  5GAN 4;  2EQK A;  5E9M A;  3QG1 A;  3PNW C;  1VQ4 A;  2WP2 A;  5EU1 A;  3BFM A;  4M7D A;  4IOO A;  2PUO B;  4C8Q C;  4A4H A;  5I89 A;  2E3K A;  1MGQ A;  4PCE A;  3I56 T;  4C92 F;  1XTD A;  4NQM A;  4UIZ A;  1Q86 C;  2QQ9 A;  1QP3 A;  3IU6 A;  1KD1 C;  3JB9 F;  2CZ6 B;  2YLB A;  4O78 A;  5HEM A;  4HXS A;  2P4T A;  5AME A;  3X25 B;  1QVF S;  5GAO r;  4CUR A;  4TU4 A;  3L2U A;  5HRV A;  5GAN d;  4UIW A;  4HBW A;  4QB3 A;  5D6X A;  5BT3 A;  2RFJ A;  1YI2 A;  1F68 A;  3V7C A;  3UVY A;  1D3B B;  4IKF A;  3PT9 A;  3QZS A;  1BI1 A;  4ZGJ B;  3T9N A;  3GP8 A;  2GRC A;  4E47 A;  1KHI A;  1YIJ A;  4XUA A;  2JOY A;  3G7Z A;  2FL7 A;  3JVJ A;  1VQM A;  2M1H A;  1P92 A;  3D7C A;  5DYC A;  3MXF A;  4QSW A;  5CVI A;  2LCC A;  2FYK A;  3L2W A;  4Z02 A;  4C8Q A;  2MAM A;  5CU8 A;  4QSP A;  4RCB A;  4C92 G;  4QR3 A;  2M16 A;  1OI1 A;  2EJF A;  5C0M A;  5FH7 A;  2OO1 A;  5GAM e;  5L8T A;  3E1S A;  4M7A D;  3SWN A;  4C5E A;  2RJE A;  4O75 A;  4YY6 A;  3J81 E;  2KDS A;  4O72 A;  3UVW A;  2OTL T;  4QSU A;  4KV1 A;  3JB9 G;  3CC4 T;  3R6O A;  4J5Y A;  4IR4 A;  3CCS T;  4QQD A;  3HPW A;  5L97 A;  2VGM A;  2K57 A;  1KC8 U;  2D82 A;  2K5F A;  1BYM A;  4M78 B;  1VQ9 T;  1VQ7 T;  4BI8 B;  1M90 C;  5LJ3 j;  3BY7 A;  3A8M B;  2XK0 A;  1W2B A;  3UW9 A;  4OGE A;  2EQU A;  5LKT A;  4NUE A;  2LX9 A;  3CCL A;  4YYN A;  4HA8 A;  2WSC E;  5FBX A;  2R58 A;  2R5M A;  4J83 A;  1HXD A;  5DLO A;  2A3L A;  2RM4 A;  3F70 A;  5LJ5 d;  3U5N A;  4ATO A;  5H1U A;  4UIY A;  4HT9 A;  5CIU A;  2K3Y A;  4Z6I A;  4M77 D;  4BW3 A;  3OYE A;  3CCQ T;  1BIA A;  2JTF A;  3CCR T;  3A8L B;  4O5V A;  4M78 E;  2R10 A;  5IGN A;  5CS8 A;  2QA4 T;  2ZPG B;  2X4X A;  2ZPF B;  4R55 A;  4XUB A;  2CZ1 B;  2KY9 A;  1M8V A;  4XTZ A;  1S72 T;  2N9G A;  5EGU A;  4JLI A;  5FE2 A;  1VQ6 A;  3Q2E A;  4NUC A;  4A9J A;  2X4Y A;  4UIU A;  5C7N A;  4CLB A;  3U5J A;  2RK2 A;  4FIB A;  5E9V A;  5II2 A;  3RKW A;  5D26 A;  2DTI A;  2WSF E;  4M75 B;  4PY6 A;  3JCM J;  4QVD A;  2LC4 A;  1Y71 A;  5HRW A;  5DY9 A;  2V8K A;  3TU4 K;  2GQV A;  2E6Z A;  5L8U A;  3CCV T;  3FC3 A;  4NR6 A;  5C8G A;  4UIV A;  3CCE A;  4F7U A;  4MZP A;  3OW2 A;  4JS4 A;  3ASK A;  1NE8 A;  5CTL A;  2O4X A;  4IOR A;  4PCI A;  4O77 A;  4C66 A;  3CMA A;  3I55 A;  5CQA A;  2E41 A;  5LJ3 h;  4TQN A;  1YJW T;  1SSF A;  1VQN T;  4HCB A;  2DTH A;  4ZN1 A;  3KBG A;  5HFR A;  2O01 E;  5J0D A;  4RKU E;  4A9L A;  1DJ7 B;  4LDU A;  5CCA A;  4XU1 A;  4C0G A;  4N4G A;  4C0D B;  1QP2 A;  3MEU A;  2MWP A;  3IU5 A;  1EQF A;  3HHT B;  2XG8 D;  2L3R A;  5CUC A;  3NTI A;  4LD6 A;  4XTU A;  5L99 A;  1VQP A;  2RI5 A;  1XQH A;  1JSP B;  1KC8 C;  5GAN 5;  3RMS A;  2MF2 A;  2XIC A;  2HBP A;  4O7F A;  4XK8 E;  2D0Q B;  4MR3 A;  2GFU A;  3RCW A;  3M55 A;  4JS5 A;  4J7I A;  3J7A F;  1WPY A;  3OMG A;  4MMK A;  5GAN 6;  4D6W A;  4CUT A;  2ZGW A;  5LJ5 j;  4C92 D;  5IGM A;  4DQ2 A;  5FRN A;  4J0R A;  4QVC A;  4NR9 A;  2E70 A;  2NXB A;  2RHX A;  1R8O B;  3QJY A;  5FG6 A;  2DVV A;  2P0P A;  2XU8 A;  4M7D E;  4L5G A;  5D3L A;  3OBY A;  2IG0 A;  5GAM h;  5GAO p;  2H3J A;  4QVZ A;  5J26 A;  4C5G A;  5K29 A;  3VYG A;  4DOV A;  3O36 A;  2HNI A;  5CQ5 A;  3VKI A;  5DW1 A;  3URG A;  4E7K A;  4M78 C;  4PTB A;  4Z6H A;  4XY9 A;  5A2Q E;  4XY8 A;  2QQS A;  3AHU A;  3OYD A;  1D3B A;  3DB4 A;  2JUF A;  2RK1 A;  1VQO A;  4ZW1 A;  2A7Y A;  4NRB A;  5L96 A;  2NLU A;  4RG2 A;  4PLL A;  5EP7 A;  3GIB A;  2R5A A;  5EWW A;  4XU3 A;  4M7A F;  3DLM A;  4XTV A;  5LJ3 g;  5HEN A;  2KAF A;  5HK3 A;  1W2B S;  5D3T A;  5IG6 A;  4FSX A;  3PMI A;  3S92 A;  3U5L A;  4ZC9 A;  3MP6 A;  5COI A;  3M5A A;  3JCM W;  2RO0 A;  1M1K U;  4LDX A;  4B9W A;  3QPH A;  3RIR A;  5EWH A;  2KQW A;  2I2L A;  2BKD N;  5CQ7 A;  5LKZ A;  5EVA A;  2QEX A;  3V7R A;  2VXF A;  3SVG A;  3UVD A;  2RA2 A;  3AAD A;  5C87 A;  4YH4 A;  4X9D A;  5CQT A;  3QZ9 B;  5EIS A;  4HBX A;  4QEU A;  3CCM A;  4UYH A;  4LDV A;  4M78 A;  1VIF A;  2L89 A;  5LJ5 h;  1Q86 U;  4P5N A;  2Y4X A;  5GMK j;  4J6X A;  2X35 A;  2Y90 A;  2DZ9 A;  1KD1 U;  3OS5 A;  4M77 F;  5D3H A;  3QSU A;  2OAU A;  1VQ8 T;  1I81 A;  2DXB A;  2QXF A;  2XD0 A;  3A8H B;  4M7A G;  5II1 A;  5CAI A;  5CKD A;  2LQ8 A;  1M4Z A;  5CUB A;  3AQA A;  1VQ5 A;  4QQ6 A;  3P1D A;  1LOJ A;  5IT9 E;  2LVM A;  2GFA A;  3HSB A;  3UDC A;  2L85 A;  4YYM A;  2CZ7 B;  3WXM B;  1WJQ A;  2JVV A;  3CC2 A;  4C0D C;  4BW4 A;  3OB9 A;  5CQ6 A;  4XU2 A;  1YIT T;  4X34 A;  3OW2 S;  5I29 A;  1H64 1;  4ME7 A;  4MR4 A;  4BE2 A;  3FRN A;  4M7D C;  1QVG A;  2HQX A;  3G0J A;  1G3S A;  3MB4 A;  2G3R A;  2LDM A;  2R0Y A;  5TB6 A;  3SB2 A;  3CCJ A;  4M75 A;  4J6W A;  5AMF A;  3O8V A;  3RKY A;  4F3I A;  3S91 A;  2KVQ G;  4M77 G;  4J6Y A;  4Z93 A;  5D25 A;  5DW2 A;  5D3P A;  4A9F A;  1BI3 A;  5ETB A;  1NZ9 A;  4YAB A;  2PUK B;  4MDX A;  4NYW A;  2D9E A;  1M90 U;  3V7S A;  3LLR A;  4GPJ A;  5GMK h;  4OGI A;  5ETD A;  5C89 A;  5I88 A;  2F5T X;  4EMG A;  3L42 A;  3M4G A;  4UYD A;  3QZT A;  3CD6 T;  5LJ5 g;  2E7N A;  1YJN T;  3ZFJ A;  2XDP A;  5F60 A;  2VV5 A;  5A7C A;  4TZ8 A;  3QHS A;  2YW5 A;  3P1F A;  2EJ9 A;  4JRI A;  3EAE A;  2PVD B;  2E64 A;  3I3J A;  5FG4 A;  4R56 A;  2QDY B;  1WQ7 A;  4YK0 A;  4C8Q D;  3OSV A;  4HXN A;  4LYI A;  4E7L A;  3CC7 T;  5GAO n;  5DKC A;  1IZ6 A;  1Y7X A;  2DZC A;  3C95 A;  4E7I A;  1XNI A;  5EQ1 A;  3FB9 A;  3SWN C;  3LQH A;  5CZG A;  3G71 A;  1OZ2 A;  2P0Q A;  3CME T;  4A4F A;  5HM0 A;  5HQ6 A;  5I80 A;  2K4Y A;  4QBM A;  2ZCF B;  2LT4 A;  2F6N A;  4XTX A;  3GG3 A;  3PIO A;  4YYJ A;  5GMK i;  4M78 F;  5FH6 A;  5KH6 A;  4A9O A;  3U5K A;  4QSR A;  2L5E A;  3MEV A;  4QST A;  1FWZ A;  4OF1 A;  3PMT A;  1YHQ A;  1X75 C;  4PJO B;  3JCM e;  5GAM d;  4LR6 A;  4O6J A;  2L84 A;  4BI4 A;  3ZEH A;  4II1 A;  1UGS B;  3A5Z B;  5DY7 A;  5H85 A;  1JJ2 A;  5EIC A;  3MB3 A;  4O76 A;  3FDR A;  5LKU A;  5KE2 A;  4Q0N A;  2B8A A;  5I2S A;  4CI0 C;  3MP1 A;  3HFO A;  1WGS A;  4YTL A;  3SD4 A;  2YEM A;  3P1E A;  2MWO A;  4QEV A;  1VQK T;  3G4S T;  5CQ4 A;  3DWY A;  5ENF A;  1W4S A;  4PJO E;  1G3T A;  1I4K 1;  4WHU A;  2RS9 B;  2XDB A;  3QZ5 B;  2ZPE B;  1M9S A;  4TZ2 A;  4JRK A;  4Y28 E;  5CQ3 A;  5GAN e;  1TH7 A;  5HJC A;  3X26 B;  3HP9 A;  3OYB A;  5FFY A;  2PU9 B;  5LJ3 f;  4M78 G;  4IR3 A;  4C92 B;  2RI7 A;  5CY9 A;  5DYA A;  3JCM f;  2KMT A;  3VUB A;  2EIF A;  4NR7 A;  2CS7 A;  1YJ9 A;  2E65 A;  2KK4 A;  1K73 C;  3OBW A;  3M59 A;  3UV5 A;  3OYN A;  5FDZ A;  4OP0 A;  1ZBX A;  5F61 A;  1JBM A;  5BT5 A;  4NYX A;  4QR4 A;  1H3Z A;  3G6E T;  5FH8 A;  3DKM A;  2V8J A;  5IID A;  3ME9 A;  4C92 E;  4J1P A;  1QVG S;  4QSS A;  4NYV A;  4RG8 A;  4BW2 A;  3QUI A;  4PKL A;  4QYD A;  5DKH A;  5LJ0 A;  4JJN K;  2RO1 A;  1YBY A;  3C4S A;  5GAN f;  3TEE A;  5EM3 A;  4OB0 B;  3ZBD A;  5FE0 A;  1WQW A;  5CQY A;  3H8Z A;  4M7D F;  5HK0 A;  3BW1 A;  2DAQ A;  4E7H A;  4KCX A;  3DAI A;  2DJZ A;  1I5L A;  2CKK A;  5I7Y A;  3U5O A;  3X24 B;  3OYM A;  3CCU A;  5F1H A;  4NRA A;  5GAM j;  3BDL A;  4Z1S A;  3SVF A;  4ALG A;  5IAY A;  4MDW A;  5CKH A;  4QEW A;  1ZQ1 A;  5CKB A;  5KCH A;  5EI4 A;  4CUP A;  3HMF A;  4BE1 A;  4JLG A;  5E3G A;  3X28 B;  1BIB A;  4XAX B;  5CUA A;  2DKW A;  1G3Y A;  2F69 A;  5CUD A;  4A9M A;  3LX7 A;  5H1V A;  3JB9 J;  2LT1 A;  4BUG A;  5GMK l;  3Q2F A;  4BDZ A;  2YEL A;  2EQJ A;  4YYK A;  3S3M A;  2DD5 A;  5CR2 A;  5EWV A;  3L1A A;  4N4I A;  4M75 E;  4YAD A;  1X6O A;  4YH3 A;  3INZ A;  3OQ5 A;  4PJO C;  3LJW A;  4M7D G;  4HXP A;  3QJ6 A;  4LC2 A;  1UB4 A;  5A85 A;  2EQM A;  3U5M A;  1N72 A;  3QKJ A;  3HMH A;  2HD0 A;  4C8Q F;  4LDY A;  4MML A;  2DEQ A;  3I56 A;  5GAO q;  5ENE A;  2QI2 A;  1VQL T;  5F1L A;  1NJI C;  3FIF A;  1N27 A;  5FU6 B;  5LJ5 f;  2DIG A;  3OYA A;  2X4J A;  3FEO A;  5I1Q A;  4A9E A;  2H60 A;  5CKF A;  2E1H A;  5F2P A;  4IOQ A;  4BY6 B;  5CFW A;  3OYY A;  2DTO A;  1JJ2 S;  5HEL A;  5D24 A;  2EKO A;  2CYZ B;  4Q0O A;  5FG5 A;  4CUU A;  3M4Y A;  5EK9 A;  1VQ4 T;  2YDW A;  1AHJ B;  1BI2 A;  5A0G A;  4PS5 A;  3UT1 A;  4XTW A;  3L2R A;  4YYG A;  4ELZ C;  4M78 D;  5FE8 A;  5HKC A;  5KTX A;  4YBS A;  1Q81 U;  2RH2 A;  4BHW A;  5A5Q A;  4IUP A;  2CGH A;  4PJO A;  5FE6 A;  1U1T A;  4CRI A;  2I7K A;  4C8Q G;  4BD3 A;  2DK3 A;  3PTA A;  3JRZ A;  3O37 A;  4E96 A;  2I8N A;  2LCL A;  2OTL A;  5FFV A;  3CPW S;  2K2V A;  3OMC A;  2EFI A;  3CC4 A;  4A9N A;  5LJ2 A;  1YI2 T;  4C5I A;  3CCS A;  4YBT A;  2YLC A;  3M57 A;  2K5L A;  5FE7 A;  3BDU A;  4NQN A;  4NS5 A;  2JTM A;  3LQJ A;  1JB0 E;  2MMP A;  1VQ9 A;  1YIJ T;  1VQ7 A;  4A9I A;  2F6J A;  3M9Q A;  4QQG A;  1VQM T;  2RNY A;  5ENG A;  1QW1 A;  4A54 A;  1LNX A;  4FL6 A;  2PQW A;  2Y4Y A;  2YHT A;  3HRT A;  5KCO A;  1ZS5 A;  5A81 A;  4C92 A;  2V8I A;  5E74 A;  2XID A;  4WF2 A;  4LRG A;  1EIF A;  3X20 B;  3C94 A;  5IN1 A;  1K9M C;  4F7U F;  2OUO A;  3FKM X;  3O35 A;  4M75 C;  2ZPI B;  1Q7Y C;  5IGK A;  3ZYU A;  1B34 B;  4QY4 A;  5F36 A;  3DB3 A;  5H1T A;  1LJO A;  3CCQ A;  3CCR A;  4MEN A;  3OYC A;  5JWM A;  1JRI A;  3J80 E;  2QA4 A;  3OA6 A;  3NXB A;  3EFR A;  5HRX A;  4Y91 A;  2JZ2 A;  1S72 A;  1PSE A;  2FVU A;  4BW1 A;  2K5I A;  5GAM g;  4YYH A;  3LYI A;  1V29 B;  3QYH B;  5HQ7 A;  3HME A;  3A8O B;  3CCL T;  2DVE A;  4O7A A;  3Q1J A;  5EWD A;  2ZPH B;  2FHD A;  4IUR A;  4ZN3 A;  4M7A B;  2VGN A;  4HXM A;  4J7F A;  3LW5 E;  4TTE A;  4M7D D;  3CCV A;  3JVL A;  1UGQ B;  2WAC A;  2L8D A;  4TYL A;  4F7U G;  4TS8 A;  4QSQ A;  4XYA A;  4O7E A;  5FU6 C;  1OZ3 A;  3V8J A;  2CZ0 B;  3SVH A;  4C0Z A;  4MZM A;  1Q81 C;  1YJW A;  4X9C A;  1VQN A;  2EWN A;  4QYL A;  3C12 A;  1VQ6 T;  5A5R A;  4BY6 C;  5DX4 A;  1WJR A;  2RJD A;  4BB7 A;  5KTU A;  4M7A E;  2RHI A;  3MUK A;  1PSF A;  3WVE B;  4OB2 B;  2RHZ A;  3PIP A;  4UYF B;  4LDW A;  3ONI A;  1U1S A;  5E9I A;  5CKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...