5DYAA

Crystal structure of the human brpf1 bromodomain in complex with seed5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5dyaA00
4NR6A 5KTUA 5DYCA 5I89A 4TU6A 5E9IA 5D3PA 5II2A 4QSSA 5K29A 5E3DA 4J0RA 5FBXA 4O7AA 4UIWA 4ZW1A 3P1FA 3HMFA 5FFVA 4GPJA 4CURA 5H1TA 5JI8A 4HBWA 5DX4A 5CUAA 4QNSA 5FDZA 3JVMA 4PCEA 2RFJA 2RS9B 4TS8A 5ETDA 2YQDA 4O78A 5DFBA 4NYVA 4UITA 5EICA 4CUSA 5L98A 5CUBA 5FH8A 2LSPB 5DYUA 5HEMA 2YEMA 3UVXA 3U5NA 2G4AA 5IGKA 3LJWA 5E7DA 5A81A 5H1UA 4YK0A 5EPSA 2RI7A 5CQ3A 5L8TA 3Q2FA 4LYWA 3QZSA 3UVYA 4A9OA 4YBSA 4IOQA 4O7CA 5C7NA 5FE3A 4NYXA 5CQTA 2DVRA 5AD2A 4HBYA 4QEUA 3O33A 4A9HA 5F62A 5D3HA 3JVLA 4HXSA 4AKNA 2DWWA 5CUGA 2NXBA 4YYNA 5CQAA 2H60A 5A85A 4A9EA 3ZYUA 4YABA 5AMFA 4A9FA 1F68A 5LKTA 2YDWA 3HMEA 5E0RA 5HLSA 1WUGA 2L5EA 4HBXA 2I7KA 2RNWA 5EWVA 5C85A 4XUBA 4O76A 4YADA 5E9YA 4OGJA 5D25A 4O77A 5HRVA 5LKZA 3G0LA 5C4QA 4XUAA 4A9JA 5COIA 4HXLA 5I40A 4RVRA 5L96A 5IGNA 4LC2A 4TZ8A 4PKLA 4QSPA 5FB0A 4OGIA 4WHWA 4QZSA 5IGLA 5EISA 5IBNA 1ZS5A 5ETBA 5F36A 3TLPA 4LDFA 4QUUA 4BW4A 4PS5A 4CFKA 5IIDA 5LKXA 4IORA 4YATA 3LXJA 5CRZA 3G0JA 5D3NA 4LZRA 4QBMA 4J0SA 5I80A 4UYEA 4TT6A 2OSSA 4HXPA 5KTXA 4QSQA 4LZ2A 5LKUA 1WUMA 4TZ2A 5F2PA 4Z1SA 2DVQA 5J0DA 4YC9A 4LYIA 2RNXA 5G4RA 5HELA 2F6JA 5E9MA 4HBVA 5F25A 3MQMA 3S92A 3P1CA 5F61A 3AADA 1E6IA 2DKWA 5DKHA 5F60A 4E96A 4YY4A 2OO1A 3UV5A 4N4HA 5D26A 3S91A 5I88A 4NR8A 4QR4A 3O34A 2F6NA 4O70A 4HXMA 5FB1A 4A9NA 4UIZA 5EK9A 2DVSA 4J1PA 5EM3A 5CQ7A 4UIXA 2YW5A 5EU1A 4O7BA 5DBMA 2DVVA 5KHMA 5A5RA 5FG5A 2E7NA 4WHUA 3IU6A 3NXBA 5D24A 4CL9A 5HFRA 4CFLA 4BJXA 5I83A 5I7XA 4YYJA 5E74A 4KCXA 2RO1A 4YBMA 5E3GA 2D82A 5EWDA 4LR6A 3MB4A 4UIVA 4X2IA 5A5QA 3GG3A 5DLZA 4CUQA 4CLBA 4QEWA 4QSWA 4YYHA 4NR5A 5EWCA 3MB3A 1JM4B 4DONA 5ACYA 5IG6A 4NUCA 5F63A 4NUDA 5DFCA 5CFWA 5D3LA 3AQAA 4Q0OA 2OUOA 5CQ4A 5CUCA 4Y03A 5LVRA 2E7OA 4IR3A 4BW2A 3UV4A 3U5JA 3LQIA 2GRCA 3UW9A 5FG6A 4NR9A 4NRAA 5A82A 4QSRA 5FE8A 4UYFA 5JWMA 5F5ZA 5HQ5A 3O36A 5HRXA 5D7XA 2WP2A 4QSVA 5H1VA 5BT3A 5IGMA 5BT4A 3U5PA 4TU4A 4YYKA 5A5PA 4YYGA 4QSTA 4NRCA 5FH6A 4A9KA 2FSAA 5CGPA 4YH4A 5LJ2A 4CUPA 4PCIA 4Q0NA 4MEQA 4O72A 3LQHA 4QC3A 4YYIA 5DW2A 2YYNA 4QSXA 5EVAA 4O74A 2MJVB 3ONIA 5A7CA 5L97A 3Q2EA 4QYDA 4Z1QA 5FE7A 5L8UA 5DYXA 5ENCA 3IU5A 5D3JA 5FE6A 4TYLA 4QSUA 5LUUA 5II1A 5CTLA 4N4FA 5LJ1A 4A9IA 4O71A 4NS5A 5FE9A 5LJ0A 5A5SA 5FFWA 3MXFA 4QC1A 4NR7A 4NUEA 4NYWA 4PTBA 4C67A 4UYDA 4LRGA 5C87A 5E9VA 3DAIA 3D7CA 5AD3A 5DFDA 3MULA 5FE4A 4O7EA 3O35A 5A5OA 2YELA 3UVWA 4F3IA 3SVGA 5FH7A 2KTBB 5H85A 4QR5A 5KO4A 2R0VA 5HQ6A 5DW1A 5ENEA 5AMEA 4UYGA 5CS8A 5FE0A 5KTWA 2E3KA 4TT4A 5CUEA 5FG4A 5EA1A 5CY9A 4QUTA 4C66A 5CZGA 2RNYA 5LVQA 4YH3A 5TCMA 5HQ7A 2I8NA 5HJCA 5CRMA 4YYMA 3U5MA 5I86A 5L99A 4J3IA 4NQNA 3U5OA 4YAXA 5ENFA 3MUKA 4IR4A 2R0YA 4MR4A 3O37A 4XYAA 4QEVA 5CQ5A 4N4GA 4BW3A 3K2JA 4FLPA 5ENIA 4UIYA 4UYFB 4NR4A 4TQNA 4QB3A 2WP1A 4NQMA 5HCLA 5I29A 4CUUA 5HFQA 4ALGA 4N4IA 2L85A 4HXKA 5DLXA 2N9GA 2R10A 5CU8A 4Z93A 3U5KA 4YBTA 1JSPB 5FE2A 2L84A 4A9MA 3DWYA 5G4SA 4MEOA 5DKCA 4LZSA 5CQ8A 5TB6A 5KU3A 5CPEA 4KV4A 5EI4A 4TT2A 5D3RA 4HXOA 4NXJA 5EPRA 4QR3A 5DY7A 5BT5A 4NRBA 4UIUA 3P5OA 4PY6A 4MR6A 5F1HA 5ENJA 5HENA 5CUDA 2R0SA 5F3AA 4N3WA 3QZVA 5ENHA 2DATA 3HMHA 5HRWA 4CUTA 1N72A 5E9KA 4TTEA 2YEKA 5DYAA 4Z6HA 5I1QA 3JVKA 5D3TA 5CQ6A 5A5NA 3SVFA 2D9EA 5ENGA 4YY6A 3P1DA 4IR5A 3SVHA 4WIVA 3JVJA 5HM0A 4HXNA 5EV9A 5F1LA 4HXRA 5C89A 3P1EA 5ENBA 4UYHA 4A9LA 5EQ1A 4XY8A 4MR5A 5E73A 4MENA 5FE1A 4QY4A 5D0CA 4LYSA 5DKDA 4O7FA 4O75A 1X0JA 4ALHA 4QYLA 4ZQLA 3UV2A 4KV1A 4BHWA 5C8GA 4Z6IA 3LQJA 1EQFA 4IR6A 3QZTA 5FFYA 5EWWA 5CP5A 4BW1A 4OUFA 4YYDA 4ZC9A 4MR3A 4XY9A 5E9LA 5FE5A 4MEPA 5EPBA 5A83A 5D3SA 3I3JA 3U5LA 5I7YA 5EGUA 3UVDA 5EWHA 4IOOA 3RCWA 3FKMX 5EP7A
chains in the Genus database with same CATH superfamily
4NR6A 5KTUA 5DYCA 5I89A 4TU6A 5E9IA 5D3PA 5II2A 4QSSA 5K29A 5E3DA 4J0RA 5FBXA 4O7AA 4UIWA 4ZW1A 3P1FA 3HMFA 5FFVA 4GPJA 4CURA 5H1TA 5JI8A 4HBWA 5DX4A 5CUAA 4QNSA 5FDZA 3JVMA 4PCEA 2RFJA 2RS9B 4TS8A 5ETDA 2YQDA 4O78A 5DFBA 4NYVA 4UITA 5EICA 4CUSA 5L98A 5CUBA 5FH8A 2LSPB 5DYUA 1PUOA 5HEMA 2YEMA 3UVXA 3U5NA 2G4AA 5IGKA 3LJWA 5E7DA 5A81A 5H1UA 4YK0A 5EPSA 2RI7A 5CQ3A 5L8TA 3Q2FA 4LYWA 3QZSA 3UVYA 4A9OA 4YBSA 4IOQA 4O7CA 5C7NA 5FE3A 4NYXA 5CQTA 2DVRA 5AD2A 4HBYA 4QEUA 3ERRA 3O33A 4A9HA 5F62A 5D3HA 3JVLA 4HXSA 4AKNA 2DWWA 5CUGA 2NXBA 4YYNA 5CQAA 2H60A 5A85A 4A9EA 4AI6A 3ZYUA 4YABA 5AMFA 4A9FA 1F68A 5LKTA 2YDWA 3HMEA 5E0RA 5HLSA 1WUGA 2L5EA 4HBXA 2I7KA 2RNWA 5EWVA 5C85A 4XUBA 4O76A 4YADA 5E9YA 4OGJA 5D25A 4O77A 5HRVA 5LKZA 3G0LA 5C4QA 4XUAA 4A9JA 5COIA 4HXLA 5I40A 4RVRA 5L96A 5IGNA 4LC2A 4TZ8A 4PKLA 4QSPA 5FB0A 4OGIA 4WHWA 4QZSA 5IGLA 5EISA 5IBNA 1ZS5A 5ETBA 5F36A 3TLPA 4LDFA 4QUUA 4BW4A 4PS5A 4CFKA 5IIDA 5LKXA 4IORA 4YATA 3LXJA 5CRZA 3G0JA 5D3NA 4LZRA 4QBMA 4J0SA 5I80A 4UYEA 4TT6A 2OSSA 4HXPA 5KTXA 4QSQA 4LZ2A 5LKUA 1WUMA 4TZ2A 5F2PA 4Z1SA 2DVQA 5J0DA 4YC9A 4LYIA 2RNXA 5G4RA 5HELA 2F6JA 5E9MA 4HBVA 5F25A 3MQMA 3S92A 3P1CA 5F61A 3AADA 1E6IA 2DKWA 5DKHA 5F60A 4E96A 4YY4A 2OO1A 3UV5A 4N4HA 5D26A 3S91A 5I88A 4NR8A 4QR4A 3O34A 2F6NA 4O70A 4HXMA 5FB1A 4A9NA 4UIZA 4AKIA 5EK9A 2DVSA 4J1PA 5EM3A 3D1DA 5CQ7A 4UIXA 2YW5A 5EU1A 4O7BA 5DBMA 2DVVA 5KHMA 5A5RA 5FG5A 2E7NA 4WHUA 3IU6A 3NXBA 5D24A 4CL9A 5HFRA 4CFLA 4BJXA 5I83A 5I7XA 4YYJA 5E74A 4KCXA 2RO1A 4YBMA 5E3GA 2D82A 5EWDA 4LR6A 3MB4A 4UIVA 4X2IA 5A5QA 3GG3A 5DLZA 4CUQA 4CLBA 4QEWA 4QSWA 4YYHA 4NR5A 5EWCA 3MB3A 1JM4B 4DONA 5ACYA 5IG6A 4NUCA 5F63A 4NUDA 5DFCA 5CFWA 5D3LA 3AQAA 4Q0OA 2OUOA 5CQ4A 5CUCA 4Y03A 5LVRA 2E7OA 4IR3A 4BW2A 3UV4A 3U5JA 3LQIA 2EJNA 2GRCA 3UW9A 5FG6A 4NR9A 4NRAA 5A82A 4QSRA 5FE8A 4UYFA 5JWMA 5F5ZA 5HQ5A 3O36A 5HRXA 5D7XA 2WP2A 4QSVA 5H1VA 5BT3A 5IGMA 5BT4A 3U5PA 4TU4A 4YYKA 5A5PA 4YYGA 4QSTA 4NRCA 5FH6A 4A9KA 4AKGA 2FSAA 5CGPA 4YH4A 5LJ2A 4CUPA 4PCIA 4Q0NA 4MEQA 4O72A 3LQHA 4QC3A 4YYIA 5DW2A 2YYNA 4QSXA 5EVAA 4O74A 2MJVB 3ONIA 5A7CA 5L97A 3Q2EA 4QYDA 4Z1QA 5FE7A 5L8UA 5DYXA 5ENCA 3IU5A 5D3JA 5FE6A 4TYLA 4QSUA 5LUUA 5II1A 5CTLA 4N4FA 5LJ1A 4A9IA 4O71A 4NS5A 4AKHA 5FE9A 5LJ0A 5A5SA 5FFWA 3MXFA 4QC1A 4NR7A 4NUEA 4NYWA 4PTBA 4C67A 4UYDA 4LRGA 5C87A 5E9VA 3DAIA 3D7CA 5AD3A 5DFDA 3MULA 5FE4A 4O7EA 3O35A 5A5OA 2YELA 3UVWA 4F3IA 3SVGA 5FH7A 2KTBB 5H85A 4QR5A 5KO4A 2R0VA 5HQ6A 5DW1A 3VKHA 5ENEA 5AMEA 4UYGA 5CS8A 5FE0A 5KTWA 2E3KA 4TT4A 5CUEA 5FG4A 5EA1A 5CY9A 4QUTA 4C66A 5CZGA 2RNYA 5LVQA 4YH3A 5TCMA 5HQ7A 2I8NA 5HJCA 5CRMA 4YYMA 3U5MA 5I86A 5L99A 4J3IA 4NQNA 3U5OA 4YAXA 5ENFA 3MUKA 4IR4A 2R0YA 4MR4A 3O37A 4XYAA 3D1BA 4QEVA 5CQ5A 4N4GA 4BW3A 3K2JA 4FLPA 5ENIA 4UIYA 4UYFB 4NR4A 4TQNA 4QB3A 2WP1A 3VKGA 4NQMA 5HCLA 5I29A 4CUUA 5HFQA 4ALGA 4N4IA 2L85A 4HXKA 5DLXA 2N9GA 2R10A 5CU8A 4Z93A 3U5KA 4YBTA 1JSPB 5FE2A 2L84A 4A9MA 3DWYA 5G4SA 4MEOA 5DKCA 4LZSA 5CQ8A 5TB6A 5KU3A 5CPEA 4KV4A 5EI4A 4TT2A 5D3RA 4HXOA 4NXJA 5EPRA 4QR3A 5DY7A 5BT5A 4NRBA 4UIUA 3P5OA 4PY6A 4MR6A 5F1HA 5ENJA 5HENA 5CUDA 2R0SA 5F3AA 4N3WA 3QZVA 5ENHA 2DATA 3HMHA 1ZKRA 5HRWA 4CUTA 1N72A 5E9KA 4TTEA 2YEKA 5DYAA 4Z6HA 5I1QA 3JVKA 5D3TA 5CQ6A 5A5NA 3SVFA 2D9EA 5ENGA 4YY6A 3P1DA 4IR5A 3SVHA 4WIVA 3JVJA 5HM0A 4HXNA 5EV9A 5F1LA 4HXRA 5C89A 3P1EA 5ENBA 4UYHA 4A9LA 5EQ1A 4XY8A 4MR5A 5E73A 4MENA 5FE1A 4QY4A 5D0CA 4LYSA 5DKDA 4O7FA 4O75A 1X0JA 4ALHA 4QYLA 4ZQLA 3UV2A 4KV1A 4BHWA 5C8GA 4Z6IA 3LQJA 1EQFA 4IR6A 3QZTA 5FFYA 5EWWA 5CP5A 4BW1A 4OUFA 4YYDA 4ZC9A 4MR3A 4XY9A 5E9LA 5FE5A 4MEPA 5EPBA 5A83A 5D3SA 3I3JA 3U5LA 5I7YA 5EGUA 3UVDA 5EWHA 4IOOA 3RCWA 3FKMX 5EP7A
chains in the Genus database with same CATH topology
4NR6A 5KTUA 5DYCA 5I89A 4TU6A 5E9IA 5D3PA 5II2A 4QSSA 5K29A 5E3DA 4J0RA 5FBXA 4O7AA 4UIWA 4ZW1A 3P1FA 3HMFA 5FFVA 4GPJA 4CURA 5H1TA 5JI8A 4HBWA 5DX4A 5CUAA 4QNSA 5FDZA 3JVMA 4PCEA 2RFJA 2RS9B 4TS8A 5ETDA 2YQDA 4O78A 5DFBA 4NYVA 4UITA 5EICA 4CUSA 5L98A 5CUBA 5FH8A 2LSPB 5DYUA 5HEMA 2YEMA 3UVXA 3U5NA 2G4AA 5IGKA 3LJWA 5E7DA 5A81A 5H1UA 4YK0A 5EPSA 2RI7A 5CQ3A 5L8TA 3Q2FA 4LYWA 3QZSA 3UVYA 4A9OA 4YBSA 4IOQA 4O7CA 5C7NA 5FE3A 4NYXA 5CQTA 2DVRA 5AD2A 4HBYA 4QEUA 3O33A 4A9HA 5F62A 5D3HA 3JVLA 4HXSA 4AKNA 2DWWA 5CUGA 2NXBA 4YYNA 5CQAA 2H60A 5A85A 4A9EA 3ZYUA 4YABA 5AMFA 4A9FA 1F68A 5LKTA 2YDWA 3HMEA 5E0RA 5HLSA 1WUGA 2L5EA 4HBXA 2I7KA 2RNWA 5EWVA 5C85A 4XUBA 4O76A 4YADA 5E9YA 4OGJA 5D25A 4O77A 5HRVA 5LKZA 3G0LA 5C4QA 4XUAA 4A9JA 5COIA 4HXLA 5I40A 4RVRA 5L96A 5IGNA 4LC2A 4TZ8A 4PKLA 4QSPA 5FB0A 4OGIA 4WHWA 4QZSA 5IGLA 5EISA 5IBNA 1ZS5A 5ETBA 5F36A 3TLPA 4LDFA 4QUUA 4BW4A 4PS5A 4CFKA 5IIDA 5LKXA 4IORA 4YATA 3LXJA 5CRZA 3G0JA 5D3NA 4LZRA 4QBMA 4J0SA 5I80A 4UYEA 4TT6A 2OSSA 4HXPA 5KTXA 4QSQA 4LZ2A 5LKUA 1WUMA 4TZ2A 5F2PA 4Z1SA 2DVQA 5J0DA 4YC9A 4LYIA 2RNXA 5G4RA 5HELA 2F6JA 5E9MA 4HBVA 5F25A 3MQMA 3S92A 3P1CA 5F61A 3AADA 1E6IA 2DKWA 5DKHA 5F60A 4E96A 4YY4A 2OO1A 3UV5A 4N4HA 5D26A 3S91A 5I88A 4NR8A 4QR4A 3O34A 2F6NA 4O70A 4HXMA 5FB1A 4A9NA 4UIZA 5EK9A 2DVSA 4J1PA 5EM3A 5CQ7A 4UIXA 2YW5A 5EU1A 4O7BA 5DBMA 2DVVA 5KHMA 5A5RA 5FG5A 2E7NA 4WHUA 3IU6A 3NXBA 5D24A 4CL9A 5HFRA 4CFLA 4BJXA 5I83A 5I7XA 4YYJA 5E74A 4KCXA 2RO1A 4YBMA 5E3GA 2D82A 5EWDA 4LR6A 3MB4A 4UIVA 4X2IA 5A5QA 3GG3A 5DLZA 4CUQA 4CLBA 4QEWA 4QSWA 4YYHA 4NR5A 5EWCA 3MB3A 1JM4B 4DONA 5ACYA 5IG6A 4NUCA 5F63A 4NUDA 5DFCA 5CFWA 5D3LA 3AQAA 4Q0OA 2OUOA 5CQ4A 5CUCA 4Y03A 5LVRA 2E7OA 4IR3A 4BW2A 3UV4A 3U5JA 3LQIA 2GRCA 3UW9A 5FG6A 4NR9A 4NRAA 5A82A 4QSRA 5FE8A 4UYFA 5JWMA 5F5ZA 5HQ5A 3O36A 5HRXA 5D7XA 2WP2A 4QSVA 5H1VA 5BT3A 5IGMA 5BT4A 3U5PA 4TU4A 4YYKA 5A5PA 4YYGA 4QSTA 4NRCA 5FH6A 4A9KA 2FSAA 5CGPA 4YH4A 5LJ2A 4CUPA 4PCIA 4Q0NA 4MEQA 4O72A 3LQHA 4QC3A 4YYIA 5DW2A 2YYNA 4QSXA 5EVAA 4O74A 2MJVB 3ONIA 5A7CA 5L97A 3Q2EA 4QYDA 4Z1QA 5FE7A 5L8UA 5DYXA 5ENCA 3IU5A 5D3JA 5FE6A 4TYLA 4QSUA 5LUUA 5II1A 5CTLA 4N4FA 5LJ1A 4A9IA 4O71A 4NS5A 5FE9A 5LJ0A 5A5SA 5FFWA 3MXFA 4QC1A 4NR7A 4NUEA 4NYWA 4PTBA 4C67A 4UYDA 4LRGA 5C87A 5E9VA 3DAIA 3D7CA 5AD3A 5DFDA 3MULA 5FE4A 4O7EA 3O35A 5A5OA 2YELA 3UVWA 4F3IA 3SVGA 5FH7A 2KTBB 5H85A 4QR5A 5KO4A 2R0VA 5HQ6A 5DW1A 5ENEA 5AMEA 4UYGA 5CS8A 5FE0A 5KTWA 2E3KA 4TT4A 5CUEA 5FG4A 5EA1A 5CY9A 4QUTA 4C66A 5CZGA 2RNYA 5LVQA 4YH3A 5TCMA 5HQ7A 2I8NA 5HJCA 5CRMA 4YYMA 3U5MA 5I86A 5L99A 4J3IA 4NQNA 3U5OA 4YAXA 5ENFA 3MUKA 4IR4A 2R0YA 4MR4A 3O37A 4XYAA 4QEVA 5CQ5A 4N4GA 4BW3A 3K2JA 4FLPA 5ENIA 4UIYA 4UYFB 4NR4A 4TQNA 4QB3A 2WP1A 4NQMA 5HCLA 5I29A 4CUUA 5HFQA 4ALGA 4N4IA 2L85A 4HXKA 5DLXA 2N9GA 2R10A 5CU8A 4Z93A 3U5KA 4YBTA 1JSPB 5FE2A 2L84A 4A9MA 3DWYA 5G4SA 4MEOA 5DKCA 4LZSA 5CQ8A 5TB6A 5KU3A 5CPEA 4KV4A 5EI4A 4TT2A 5D3RA 4HXOA 4NXJA 5EPRA 4QR3A 5DY7A 5BT5A 4NRBA 4UIUA 3P5OA 4PY6A 4MR6A 5F1HA 5ENJA 5HENA 5CUDA 2R0SA 5F3AA 4N3WA 3QZVA 5ENHA 2DATA 3HMHA 5HRWA 4CUTA 1N72A 5E9KA 4TTEA 2YEKA 5DYAA 4Z6HA 5I1QA 3JVKA 5D3TA 5CQ6A 5A5NA 3SVFA 2D9EA 5ENGA 4YY6A 3P1DA 4IR5A 3SVHA 4WIVA 3JVJA 5HM0A 4HXNA 5EV9A 5F1LA 4HXRA 5C89A 3P1EA 5ENBA 4UYHA 4A9LA 5EQ1A 4XY8A 4MR5A 5E73A 4MENA 5FE1A 4QY4A 5D0CA 4LYSA 5DKDA 4O7FA 4O75A 1X0JA 4ALHA 4QYLA 4ZQLA 3UV2A 4KV1A 4BHWA 5C8GA 4Z6IA 3LQJA 1EQFA 4IR6A 3QZTA 5FFYA 5EWWA 5CP5A 4BW1A 4OUFA 4YYDA 4ZC9A 4MR3A 4XY9A 5E9LA 5FE5A 4MEPA 5EPBA 5A83A 5D3SA 3I3JA 3U5LA 5I7YA 5EGUA 3UVDA 5EWHA 4IOOA 3RCWA 3FKMX 5EP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NR6 A;  5KTU A;  5DYC A;  5I89 A;  4TU6 A;  5E9I A;  5D3P A;  5II2 A;  4QSS A;  5K29 A;  5E3D A;  4J0R A;  5FBX A;  4O7A A;  4UIW A;  4ZW1 A;  3P1F A;  3HMF A;  5FFV A;  4GPJ A;  4CUR A;  5H1T A;  5JI8 A;  4HBW A;  5DX4 A;  5CUA A;  4QNS A;  5FDZ A;  3JVM A;  4PCE A;  2RFJ A;  2RS9 B;  4TS8 A;  5ETD A;  2YQD A;  4O78 A;  5DFB A;  4NYV A;  4UIT A;  5EIC A;  4CUS A;  5L98 A;  5CUB A;  5FH8 A;  2LSP B;  5DYU A;  5HEM A;  2YEM A;  3UVX A;  3U5N A;  2G4A A;  5IGK A;  3LJW A;  5E7D A;  5A81 A;  5H1U A;  4YK0 A;  5EPS A;  2RI7 A;  5CQ3 A;  5L8T A;  3Q2F A;  4LYW A;  3QZS A;  3UVY A;  4A9O A;  4YBS A;  4IOQ A;  4O7C A;  5C7N A;  5FE3 A;  4NYX A;  5CQT A;  2DVR A;  5AD2 A;  4HBY A;  4QEU A;  3O33 A;  4A9H A;  5F62 A;  5D3H A;  3JVL A;  4HXS A;  4AKN A;  2DWW A;  5CUG A;  2NXB A;  4YYN A;  5CQA A;  2H60 A;  5A85 A;  4A9E A;  3ZYU A;  4YAB A;  5AMF A;  4A9F A;  1F68 A;  5LKT A;  2YDW A;  3HME A;  5E0R A;  5HLS A;  1WUG A;  2L5E A;  4HBX A;  2I7K A;  2RNW A;  5EWV A;  5C85 A;  4XUB A;  4O76 A;  4YAD A;  5E9Y A;  4OGJ A;  5D25 A;  4O77 A;  5HRV A;  5LKZ A;  3G0L A;  5C4Q A;  4XUA A;  4A9J A;  5COI A;  4HXL A;  5I40 A;  4RVR A;  5L96 A;  5IGN A;  4LC2 A;  4TZ8 A;  4PKL A;  4QSP A;  5FB0 A;  4OGI A;  4WHW A;  4QZS A;  5IGL A;  5EIS A;  5IBN A;  1ZS5 A;  5ETB A;  5F36 A;  3TLP A;  4LDF A;  4QUU A;  4BW4 A;  4PS5 A;  4CFK A;  5IID A;  5LKX A;  4IOR A;  4YAT A;  3LXJ A;  5CRZ A;  3G0J A;  5D3N A;  4LZR A;  4QBM A;  4J0S A;  5I80 A;  4UYE A;  4TT6 A;  2OSS A;  4HXP A;  5KTX A;  4QSQ A;  4LZ2 A;  5LKU A;  1WUM A;  4TZ2 A;  5F2P A;  4Z1S A;  2DVQ A;  5J0D A;  4YC9 A;  4LYI A;  2RNX A;  5G4R A;  5HEL A;  2F6J A;  5E9M A;  4HBV A;  5F25 A;  3MQM A;  3S92 A;  3P1C A;  5F61 A;  3AAD A;  1E6I A;  2DKW A;  5DKH A;  5F60 A;  4E96 A;  4YY4 A;  2OO1 A;  3UV5 A;  4N4H A;  5D26 A;  3S91 A;  5I88 A;  4NR8 A;  4QR4 A;  3O34 A;  2F6N A;  4O70 A;  4HXM A;  5FB1 A;  4A9N A;  4UIZ A;  5EK9 A;  2DVS A;  4J1P A;  5EM3 A;  5CQ7 A;  4UIX A;  2YW5 A;  5EU1 A;  4O7B A;  5DBM A;  2DVV A;  5KHM A;  5A5R A;  5FG5 A;  2E7N A;  4WHU A;  3IU6 A;  3NXB A;  5D24 A;  4CL9 A;  5HFR A;  4CFL A;  4BJX A;  5I83 A;  5I7X A;  4YYJ A;  5E74 A;  4KCX A;  2RO1 A;  4YBM A;  5E3G A;  2D82 A;  5EWD A;  4LR6 A;  3MB4 A;  4UIV A;  4X2I A;  5A5Q A;  3GG3 A;  5DLZ A;  4CUQ A;  4CLB A;  4QEW A;  4QSW A;  4YYH A;  4NR5 A;  5EWC A;  3MB3 A;  1JM4 B;  4DON A;  5ACY A;  5IG6 A;  4NUC A;  5F63 A;  4NUD A;  5DFC A;  5CFW A;  5D3L A;  3AQA A;  4Q0O A;  2OUO A;  5CQ4 A;  5CUC A;  4Y03 A;  5LVR A;  2E7O A;  4IR3 A;  4BW2 A;  3UV4 A;  3U5J A;  3LQI A;  2GRC A;  3UW9 A;  5FG6 A;  4NR9 A;  4NRA A;  5A82 A;  4QSR A;  5FE8 A;  4UYF A;  5JWM A;  5F5Z A;  5HQ5 A;  3O36 A;  5HRX A;  5D7X A;  2WP2 A;  4QSV A;  5H1V A;  5BT3 A;  5IGM A;  5BT4 A;  3U5P A;  4TU4 A;  4YYK A;  5A5P A;  4YYG A;  4QST A;  4NRC A;  5FH6 A;  4A9K A;  2FSA A;  5CGP A;  4YH4 A;  5LJ2 A;  4CUP A;  4PCI A;  4Q0N A;  4MEQ A;  4O72 A;  3LQH A;  4QC3 A;  4YYI A;  5DW2 A;  2YYN A;  4QSX A;  5EVA A;  4O74 A;  2MJV B;  3ONI A;  5A7C A;  5L97 A;  3Q2E A;  4QYD A;  4Z1Q A;  5FE7 A;  5L8U A;  5DYX A;  5ENC A;  3IU5 A;  5D3J A;  5FE6 A;  4TYL A;  4QSU A;  5LUU A;  5II1 A;  5CTL A;  4N4F A;  5LJ1 A;  4A9I A;  4O71 A;  4NS5 A;  5FE9 A;  5LJ0 A;  5A5S A;  5FFW A;  3MXF A;  4QC1 A;  4NR7 A;  4NUE A;  4NYW A;  4PTB A;  4C67 A;  4UYD A;  4LRG A;  5C87 A;  5E9V A;  3DAI A;  3D7C A;  5AD3 A;  5DFD A;  3MUL A;  5FE4 A;  4O7E A;  3O35 A;  5A5O A;  2YEL A;  3UVW A;  4F3I A;  3SVG A;  5FH7 A;  2KTB B;  5H85 A;  4QR5 A;  5KO4 A;  2R0V A;  5HQ6 A;  5DW1 A;  5ENE A;  5AME A;  4UYG A;  5CS8 A;  5FE0 A;  5KTW A;  2E3K A;  4TT4 A;  5CUE A;  5FG4 A;  5EA1 A;  5CY9 A;  4QUT A;  4C66 A;  5CZG A;  2RNY A;  5LVQ A;  4YH3 A;  5TCM A;  5HQ7 A;  2I8N A;  5HJC A;  5CRM A;  4YYM A;  3U5M A;  5I86 A;  5L99 A;  4J3I A;  4NQN A;  3U5O A;  4YAX A;  5ENF A;  3MUK A;  4IR4 A;  2R0Y A;  4MR4 A;  3O37 A;  4XYA A;  4QEV A;  5CQ5 A;  4N4G A;  4BW3 A;  3K2J A;  4FLP A;  5ENI A;  4UIY A;  4UYF B;  4NR4 A;  4TQN A;  4QB3 A;  2WP1 A;  4NQM A;  5HCL A;  5I29 A;  4CUU A;  5HFQ A;  4ALG A;  4N4I A;  2L85 A;  4HXK A;  5DLX A;  2N9G A;  2R10 A;  5CU8 A;  4Z93 A;  3U5K A;  4YBT A;  1JSP B;  5FE2 A;  2L84 A;  4A9M A;  3DWY A;  5G4S A;  4MEO A;  5DKC A;  4LZS A;  5CQ8 A;  5TB6 A;  5KU3 A;  5CPE A;  4KV4 A;  5EI4 A;  4TT2 A;  5D3R A;  4HXO A;  4NXJ A;  5EPR A;  4QR3 A;  5DY7 A;  5BT5 A;  4NRB A;  4UIU A;  3P5O A;  4PY6 A;  4MR6 A;  5F1H A;  5ENJ A;  5HEN A;  5CUD A;  2R0S A;  5F3A A;  4N3W A;  3QZV A;  5ENH A;  2DAT A;  3HMH A;  5HRW A;  4CUT A;  1N72 A;  5E9K A;  4TTE A;  2YEK A;  5DYA A;  4Z6H A;  5I1Q A;  3JVK A;  5D3T A;  5CQ6 A;  5A5N A;  3SVF A;  2D9E A;  5ENG A;  4YY6 A;  3P1D A;  4IR5 A;  3SVH A;  4WIV A;  3JVJ A;  5HM0 A;  4HXN A;  5EV9 A;  5F1L A;  4HXR A;  5C89 A;  3P1E A;  5ENB A;  4UYH A;  4A9L A;  5EQ1 A;  4XY8 A;  4MR5 A;  5E73 A;  4MEN A;  5FE1 A;  4QY4 A;  5D0C A;  4LYS A;  5DKD A;  4O7F A;  4O75 A;  1X0J A;  4ALH A;  4QYL A;  4ZQL A;  3UV2 A;  4KV1 A;  4BHW A;  5C8G A;  4Z6I A;  3LQJ A;  1EQF A;  4IR6 A;  3QZT A;  5FFY A;  5EWW A;  5CP5 A;  4BW1 A;  4OUF A;  4YYD A;  4ZC9 A;  4MR3 A;  4XY9 A;  5E9L A;  5FE5 A;  4MEP A;  5EPB A;  5A83 A;  5D3S A;  3I3J A;  3U5L A;  5I7Y A;  5EGU A;  3UVD A;  5EWH A;  4IOO A;  3RCW A;  3FKM X;  5EP7 A; 
#chains in the Genus database with same CATH topology
 4NR6 A;  5KTU A;  5DYC A;  5I89 A;  4TU6 A;  5E9I A;  5D3P A;  5II2 A;  4QSS A;  5K29 A;  5E3D A;  4J0R A;  5FBX A;  4O7A A;  4UIW A;  4ZW1 A;  3P1F A;  3HMF A;  5FFV A;  4GPJ A;  4CUR A;  5H1T A;  5JI8 A;  4HBW A;  5DX4 A;  5CUA A;  4QNS A;  5FDZ A;  3JVM A;  4PCE A;  2RFJ A;  2RS9 B;  4TS8 A;  5ETD A;  2YQD A;  4O78 A;  5DFB A;  4NYV A;  4UIT A;  5EIC A;  4CUS A;  5L98 A;  5CUB A;  5FH8 A;  2LSP B;  5DYU A;  1PUO A;  5HEM A;  2YEM A;  3UVX A;  3U5N A;  2G4A A;  5IGK A;  3LJW A;  5E7D A;  5A81 A;  5H1U A;  4YK0 A;  5EPS A;  2RI7 A;  5CQ3 A;  5L8T A;  3Q2F A;  4LYW A;  3QZS A;  3UVY A;  4A9O A;  4YBS A;  4IOQ A;  4O7C A;  5C7N A;  5FE3 A;  4NYX A;  5CQT A;  2DVR A;  5AD2 A;  4HBY A;  4QEU A;  3ERR A;  3O33 A;  4A9H A;  5F62 A;  5D3H A;  3JVL A;  4HXS A;  4AKN A;  2DWW A;  5CUG A;  2NXB A;  4YYN A;  5CQA A;  2H60 A;  5A85 A;  4A9E A;  4AI6 A;  3ZYU A;  4YAB A;  5AMF A;  4A9F A;  1F68 A;  5LKT A;  2YDW A;  3HME A;  5E0R A;  5HLS A;  1WUG A;  2L5E A;  4HBX A;  2I7K A;  2RNW A;  5EWV A;  5C85 A;  4XUB A;  4O76 A;  4YAD A;  5E9Y A;  4OGJ A;  5D25 A;  4O77 A;  5HRV A;  5LKZ A;  3G0L A;  5C4Q A;  4XUA A;  4A9J A;  5COI A;  4HXL A;  5I40 A;  4RVR A;  5L96 A;  5IGN A;  4LC2 A;  4TZ8 A;  4PKL A;  4QSP A;  5FB0 A;  4OGI A;  4WHW A;  4QZS A;  5IGL A;  5EIS A;  5IBN A;  1ZS5 A;  5ETB A;  5F36 A;  3TLP A;  4LDF A;  4QUU A;  4BW4 A;  4PS5 A;  4CFK A;  5IID A;  5LKX A;  4IOR A;  4YAT A;  3LXJ A;  5CRZ A;  3G0J A;  5D3N A;  4LZR A;  4QBM A;  4J0S A;  5I80 A;  4UYE A;  4TT6 A;  2OSS A;  4HXP A;  5KTX A;  4QSQ A;  4LZ2 A;  5LKU A;  1WUM A;  4TZ2 A;  5F2P A;  4Z1S A;  2DVQ A;  5J0D A;  4YC9 A;  4LYI A;  2RNX A;  5G4R A;  5HEL A;  2F6J A;  5E9M A;  4HBV A;  5F25 A;  3MQM A;  3S92 A;  3P1C A;  5F61 A;  3AAD A;  1E6I A;  2DKW A;  5DKH A;  5F60 A;  4E96 A;  4YY4 A;  2OO1 A;  3UV5 A;  4N4H A;  5D26 A;  3S91 A;  5I88 A;  4NR8 A;  4QR4 A;  3O34 A;  2F6N A;  4O70 A;  4HXM A;  5FB1 A;  4A9N A;  4UIZ A;  4AKI A;  5EK9 A;  2DVS A;  4J1P A;  5EM3 A;  3D1D A;  5CQ7 A;  4UIX A;  2YW5 A;  5EU1 A;  4O7B A;  5DBM A;  2DVV A;  5KHM A;  5A5R A;  5FG5 A;  2E7N A;  4WHU A;  3IU6 A;  3NXB A;  5D24 A;  4CL9 A;  5HFR A;  4CFL A;  4BJX A;  5I83 A;  5I7X A;  4YYJ A;  5E74 A;  4KCX A;  2RO1 A;  4YBM A;  5E3G A;  2D82 A;  5EWD A;  4LR6 A;  3MB4 A;  4UIV A;  4X2I A;  5A5Q A;  3GG3 A;  5DLZ A;  4CUQ A;  4CLB A;  4QEW A;  4QSW A;  4YYH A;  4NR5 A;  5EWC A;  3MB3 A;  1JM4 B;  4DON A;  5ACY A;  5IG6 A;  4NUC A;  5F63 A;  4NUD A;  5DFC A;  5CFW A;  5D3L A;  3AQA A;  4Q0O A;  2OUO A;  5CQ4 A;  5CUC A;  4Y03 A;  5LVR A;  2E7O A;  4IR3 A;  4BW2 A;  3UV4 A;  3U5J A;  3LQI A;  2EJN A;  2GRC A;  3UW9 A;  5FG6 A;  4NR9 A;  4NRA A;  5A82 A;  4QSR A;  5FE8 A;  4UYF A;  5JWM A;  5F5Z A;  5HQ5 A;  3O36 A;  5HRX A;  5D7X A;  2WP2 A;  4QSV A;  5H1V A;  5BT3 A;  5IGM A;  5BT4 A;  3U5P A;  4TU4 A;  4YYK A;  5A5P A;  4YYG A;  4QST A;  4NRC A;  5FH6 A;  4A9K A;  4AKG A;  2FSA A;  5CGP A;  4YH4 A;  5LJ2 A;  4CUP A;  4PCI A;  4Q0N A;  4MEQ A;  4O72 A;  3LQH A;  4QC3 A;  4YYI A;  5DW2 A;  2YYN A;  4QSX A;  5EVA A;  4O74 A;  2MJV B;  3ONI A;  5A7C A;  5L97 A;  3Q2E A;  4QYD A;  4Z1Q A;  5FE7 A;  5L8U A;  5DYX A;  5ENC A;  3IU5 A;  5D3J A;  5FE6 A;  4TYL A;  4QSU A;  5LUU A;  5II1 A;  5CTL A;  4N4F A;  5LJ1 A;  4A9I A;  4O71 A;  4NS5 A;  4AKH A;  5FE9 A;  5LJ0 A;  5A5S A;  5FFW A;  3MXF A;  4QC1 A;  4NR7 A;  4NUE A;  4NYW A;  4PTB A;  4C67 A;  4UYD A;  4LRG A;  5C87 A;  5E9V A;  3DAI A;  3D7C A;  5AD3 A;  5DFD A;  3MUL A;  5FE4 A;  4O7E A;  3O35 A;  5A5O A;  2YEL A;  3UVW A;  4F3I A;  3SVG A;  5FH7 A;  2KTB B;  5H85 A;  4QR5 A;  5KO4 A;  2R0V A;  5HQ6 A;  5DW1 A;  3VKH A;  5ENE A;  5AME A;  4UYG A;  5CS8 A;  5FE0 A;  5KTW A;  2E3K A;  4TT4 A;  5CUE A;  5FG4 A;  5EA1 A;  5CY9 A;  4QUT A;  4C66 A;  5CZG A;  2RNY A;  5LVQ A;  4YH3 A;  5TCM A;  5HQ7 A;  2I8N A;  5HJC A;  5CRM A;  4YYM A;  3U5M A;  5I86 A;  5L99 A;  4J3I A;  4NQN A;  3U5O A;  4YAX A;  5ENF A;  3MUK A;  4IR4 A;  2R0Y A;  4MR4 A;  3O37 A;  4XYA A;  3D1B A;  4QEV A;  5CQ5 A;  4N4G A;  4BW3 A;  3K2J A;  4FLP A;  5ENI A;  4UIY A;  4UYF B;  4NR4 A;  4TQN A;  4QB3 A;  2WP1 A;  3VKG A;  4NQM A;  5HCL A;  5I29 A;  4CUU A;  5HFQ A;  4ALG A;  4N4I A;  2L85 A;  4HXK A;  5DLX A;  2N9G A;  2R10 A;  5CU8 A;  4Z93 A;  3U5K A;  4YBT A;  1JSP B;  5FE2 A;  2L84 A;  4A9M A;  3DWY A;  5G4S A;  4MEO A;  5DKC A;  4LZS A;  5CQ8 A;  5TB6 A;  5KU3 A;  5CPE A;  4KV4 A;  5EI4 A;  4TT2 A;  5D3R A;  4HXO A;  4NXJ A;  5EPR A;  4QR3 A;  5DY7 A;  5BT5 A;  4NRB A;  4UIU A;  3P5O A;  4PY6 A;  4MR6 A;  5F1H A;  5ENJ A;  5HEN A;  5CUD A;  2R0S A;  5F3A A;  4N3W A;  3QZV A;  5ENH A;  2DAT A;  3HMH A;  1ZKR A;  5HRW A;  4CUT A;  1N72 A;  5E9K A;  4TTE A;  2YEK A;  5DYA A;  4Z6H A;  5I1Q A;  3JVK A;  5D3T A;  5CQ6 A;  5A5N A;  3SVF A;  2D9E A;  5ENG A;  4YY6 A;  3P1D A;  4IR5 A;  3SVH A;  4WIV A;  3JVJ A;  5HM0 A;  4HXN A;  5EV9 A;  5F1L A;  4HXR A;  5C89 A;  3P1E A;  5ENB A;  4UYH A;  4A9L A;  5EQ1 A;  4XY8 A;  4MR5 A;  5E73 A;  4MEN A;  5FE1 A;  4QY4 A;  5D0C A;  4LYS A;  5DKD A;  4O7F A;  4O75 A;  1X0J A;  4ALH A;  4QYL A;  4ZQL A;  3UV2 A;  4KV1 A;  4BHW A;  5C8G A;  4Z6I A;  3LQJ A;  1EQF A;  4IR6 A;  3QZT A;  5FFY A;  5EWW A;  5CP5 A;  4BW1 A;  4OUF A;  4YYD A;  4ZC9 A;  4MR3 A;  4XY9 A;  5E9L A;  5FE5 A;  4MEP A;  5EPB A;  5A83 A;  5D3S A;  3I3J A;  3U5L A;  5I7Y A;  5EGU A;  3UVD A;  5EWH A;  4IOO A;  3RCW A;  3FKM X;  5EP7 A; 
#chains in the Genus database with same CATH homology
 4NR6 A;  5KTU A;  5DYC A;  5I89 A;  4TU6 A;  5E9I A;  5D3P A;  5II2 A;  4QSS A;  5K29 A;  5E3D A;  4J0R A;  5FBX A;  4O7A A;  4UIW A;  4ZW1 A;  3P1F A;  3HMF A;  5FFV A;  4GPJ A;  4CUR A;  5H1T A;  5JI8 A;  4HBW A;  5DX4 A;  5CUA A;  4QNS A;  5FDZ A;  3JVM A;  4PCE A;  2RFJ A;  2RS9 B;  4TS8 A;  5ETD A;  2YQD A;  4O78 A;  5DFB A;  4NYV A;  4UIT A;  5EIC A;  4CUS A;  5L98 A;  5CUB A;  5FH8 A;  2LSP B;  5DYU A;  5HEM A;  2YEM A;  3UVX A;  3U5N A;  2G4A A;  5IGK A;  3LJW A;  5E7D A;  5A81 A;  5H1U A;  4YK0 A;  5EPS A;  2RI7 A;  5CQ3 A;  5L8T A;  3Q2F A;  4LYW A;  3QZS A;  3UVY A;  4A9O A;  4YBS A;  4IOQ A;  4O7C A;  5C7N A;  5FE3 A;  4NYX A;  5CQT A;  2DVR A;  5AD2 A;  4HBY A;  4QEU A;  3O33 A;  4A9H A;  5F62 A;  5D3H A;  3JVL A;  4HXS A;  4AKN A;  2DWW A;  5CUG A;  2NXB A;  4YYN A;  5CQA A;  2H60 A;  5A85 A;  4A9E A;  3ZYU A;  4YAB A;  5AMF A;  4A9F A;  1F68 A;  5LKT A;  2YDW A;  3HME A;  5E0R A;  5HLS A;  1WUG A;  2L5E A;  4HBX A;  2I7K A;  2RNW A;  5EWV A;  5C85 A;  4XUB A;  4O76 A;  4YAD A;  5E9Y A;  4OGJ A;  5D25 A;  4O77 A;  5HRV A;  5LKZ A;  3G0L A;  5C4Q A;  4XUA A;  4A9J A;  5COI A;  4HXL A;  5I40 A;  4RVR A;  5L96 A;  5IGN A;  4LC2 A;  4TZ8 A;  4PKL A;  4QSP A;  5FB0 A;  4OGI A;  4WHW A;  4QZS A;  5IGL A;  5EIS A;  5IBN A;  1ZS5 A;  5ETB A;  5F36 A;  3TLP A;  4LDF A;  4QUU A;  4BW4 A;  4PS5 A;  4CFK A;  5IID A;  5LKX A;  4IOR A;  4YAT A;  3LXJ A;  5CRZ A;  3G0J A;  5D3N A;  4LZR A;  4QBM A;  4J0S A;  5I80 A;  4UYE A;  4TT6 A;  2OSS A;  4HXP A;  5KTX A;  4QSQ A;  4LZ2 A;  5LKU A;  1WUM A;  4TZ2 A;  5F2P A;  4Z1S A;  2DVQ A;  5J0D A;  4YC9 A;  4LYI A;  2RNX A;  5G4R A;  5HEL A;  2F6J A;  5E9M A;  4HBV A;  5F25 A;  3MQM A;  3S92 A;  3P1C A;  5F61 A;  3AAD A;  1E6I A;  2DKW A;  5DKH A;  5F60 A;  4E96 A;  4YY4 A;  2OO1 A;  3UV5 A;  4N4H A;  5D26 A;  3S91 A;  5I88 A;  4NR8 A;  4QR4 A;  3O34 A;  2F6N A;  4O70 A;  4HXM A;  5FB1 A;  4A9N A;  4UIZ A;  5EK9 A;  2DVS A;  4J1P A;  5EM3 A;  5CQ7 A;  4UIX A;  2YW5 A;  5EU1 A;  4O7B A;  5DBM A;  2DVV A;  5KHM A;  5A5R A;  5FG5 A;  2E7N A;  4WHU A;  3IU6 A;  3NXB A;  5D24 A;  4CL9 A;  5HFR A;  4CFL A;  4BJX A;  5I83 A;  5I7X A;  4YYJ A;  5E74 A;  4KCX A;  2RO1 A;  4YBM A;  5E3G A;  2D82 A;  5EWD A;  4LR6 A;  3MB4 A;  4UIV A;  4X2I A;  5A5Q A;  3GG3 A;  5DLZ A;  4CUQ A;  4CLB A;  4QEW A;  4QSW A;  4YYH A;  4NR5 A;  5EWC A;  3MB3 A;  1JM4 B;  4DON A;  5ACY A;  5IG6 A;  4NUC A;  5F63 A;  4NUD A;  5DFC A;  5CFW A;  5D3L A;  3AQA A;  4Q0O A;  2OUO A;  5CQ4 A;  5CUC A;  4Y03 A;  5LVR A;  2E7O A;  4IR3 A;  4BW2 A;  3UV4 A;  3U5J A;  3LQI A;  2GRC A;  3UW9 A;  5FG6 A;  4NR9 A;  4NRA A;  5A82 A;  4QSR A;  5FE8 A;  4UYF A;  5JWM A;  5F5Z A;  5HQ5 A;  3O36 A;  5HRX A;  5D7X A;  2WP2 A;  4QSV A;  5H1V A;  5BT3 A;  5IGM A;  5BT4 A;  3U5P A;  4TU4 A;  4YYK A;  5A5P A;  4YYG A;  4QST A;  4NRC A;  5FH6 A;  4A9K A;  2FSA A;  5CGP A;  4YH4 A;  5LJ2 A;  4CUP A;  4PCI A;  4Q0N A;  4MEQ A;  4O72 A;  3LQH A;  4QC3 A;  4YYI A;  5DW2 A;  2YYN A;  4QSX A;  5EVA A;  4O74 A;  2MJV B;  3ONI A;  5A7C A;  5L97 A;  3Q2E A;  4QYD A;  4Z1Q A;  5FE7 A;  5L8U A;  5DYX A;  5ENC A;  3IU5 A;  5D3J A;  5FE6 A;  4TYL A;  4QSU A;  5LUU A;  5II1 A;  5CTL A;  4N4F A;  5LJ1 A;  4A9I A;  4O71 A;  4NS5 A;  5FE9 A;  5LJ0 A;  5A5S A;  5FFW A;  3MXF A;  4QC1 A;  4NR7 A;  4NUE A;  4NYW A;  4PTB A;  4C67 A;  4UYD A;  4LRG A;  5C87 A;  5E9V A;  3DAI A;  3D7C A;  5AD3 A;  5DFD A;  3MUL A;  5FE4 A;  4O7E A;  3O35 A;  5A5O A;  2YEL A;  3UVW A;  4F3I A;  3SVG A;  5FH7 A;  2KTB B;  5H85 A;  4QR5 A;  5KO4 A;  2R0V A;  5HQ6 A;  5DW1 A;  5ENE A;  5AME A;  4UYG A;  5CS8 A;  5FE0 A;  5KTW A;  2E3K A;  4TT4 A;  5CUE A;  5FG4 A;  5EA1 A;  5CY9 A;  4QUT A;  4C66 A;  5CZG A;  2RNY A;  5LVQ A;  4YH3 A;  5TCM A;  5HQ7 A;  2I8N A;  5HJC A;  5CRM A;  4YYM A;  3U5M A;  5I86 A;  5L99 A;  4J3I A;  4NQN A;  3U5O A;  4YAX A;  5ENF A;  3MUK A;  4IR4 A;  2R0Y A;  4MR4 A;  3O37 A;  4XYA A;  4QEV A;  5CQ5 A;  4N4G A;  4BW3 A;  3K2J A;  4FLP A;  5ENI A;  4UIY A;  4UYF B;  4NR4 A;  4TQN A;  4QB3 A;  2WP1 A;  4NQM A;  5HCL A;  5I29 A;  4CUU A;  5HFQ A;  4ALG A;  4N4I A;  2L85 A;  4HXK A;  5DLX A;  2N9G A;  2R10 A;  5CU8 A;  4Z93 A;  3U5K A;  4YBT A;  1JSP B;  5FE2 A;  2L84 A;  4A9M A;  3DWY A;  5G4S A;  4MEO A;  5DKC A;  4LZS A;  5CQ8 A;  5TB6 A;  5KU3 A;  5CPE A;  4KV4 A;  5EI4 A;  4TT2 A;  5D3R A;  4HXO A;  4NXJ A;  5EPR A;  4QR3 A;  5DY7 A;  5BT5 A;  4NRB A;  4UIU A;  3P5O A;  4PY6 A;  4MR6 A;  5F1H A;  5ENJ A;  5HEN A;  5CUD A;  2R0S A;  5F3A A;  4N3W A;  3QZV A;  5ENH A;  2DAT A;  3HMH A;  5HRW A;  4CUT A;  1N72 A;  5E9K A;  4TTE A;  2YEK A;  5DYA A;  4Z6H A;  5I1Q A;  3JVK A;  5D3T A;  5CQ6 A;  5A5N A;  3SVF A;  2D9E A;  5ENG A;  4YY6 A;  3P1D A;  4IR5 A;  3SVH A;  4WIV A;  3JVJ A;  5HM0 A;  4HXN A;  5EV9 A;  5F1L A;  4HXR A;  5C89 A;  3P1E A;  5ENB A;  4UYH A;  4A9L A;  5EQ1 A;  4XY8 A;  4MR5 A;  5E73 A;  4MEN A;  5FE1 A;  4QY4 A;  5D0C A;  4LYS A;  5DKD A;  4O7F A;  4O75 A;  1X0J A;  4ALH A;  4QYL A;  4ZQL A;  3UV2 A;  4KV1 A;  4BHW A;  5C8G A;  4Z6I A;  3LQJ A;  1EQF A;  4IR6 A;  3QZT A;  5FFY A;  5EWW A;  5CP5 A;  4BW1 A;  4OUF A;  4YYD A;  4ZC9 A;  4MR3 A;  4XY9 A;  5E9L A;  5FE5 A;  4MEP A;  5EPB A;  5A83 A;  5D3S A;  3I3J A;  3U5L A;  5I7Y A;  5EGU A;  3UVD A;  5EWH A;  4IOO A;  3RCW A;  3FKM X;  5EP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...