5HRXA

Crystal structure of the fifth bromodomain of human pb1 in complex with 1-butylisochromeno[3,4-c]pyrazol-5(2h)-one) compound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
110
structure length
110
Chain Sequence
YMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein polybromo-1
publication title Discovery and Optimization of a Selective Ligand for the Switch/Sucrose Nonfermenting-Related Bromodomains of Polybromo Protein-1 by the Use of Virtual Screening and Hydration Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5hrxA00
4Q0NA 3FKMX 5IGKA 5LKZA 4Z6IA 5ETDA 2MJVB 4A9EA 4WIVA 4LZRA 4AKNA 3O35A 5IBNA 5CQ5A 5FE4A 2I7KA 4IR6A 4BJXA 4UIVA 5E7DA 5K29A 4YABA 3NXBA 4Z93A 4PS5A 4TT4A 5I1QA 3JVLA 4YYJA 4A9OA 2DVRA 4O77A 4PCIA 4HXNA 5BT4A 5HRWA 5E74A 5D3HA 4KCXA 5EK9A 5FE5A 4O71A 4O7AA 1ZS5A 3O36A 2YELA 3UVYA 5D3RA 5I29A 4MEOA 4DONA 5EWHA 4NUDA 5CUAA 2I8NA 3U5JA 3G0JA 5DYXA 4UIXA 5II2A 5CUBA 3MULA 5FE9A 5FFVA 5CRMA 5DLXA 3QZTA 3UVXA 5FDZA 4QY4A 3G0LA 3S91A 2OSSA 1JSPB 4MR3A 5IGNA 5CGPA 5FG6A 2YEMA 4UIUA 4A9LA 5EPSA 4N3WA 5ENJA 3I3JA 5FG4A 4C67A 4O74A 4XY8A 4YADA 3DWYA 5LUUA 2YYNA 4IOOA 5HEMA 5CQ4A 4IORA 5F63A 5E3DA 5HJCA 3K2JA 3GG3A 5E9IA 5EICA 3O34A 4Y03A 4O7CA 5F1LA 4YC9A 5I83A 5AD2A 5I7YA 4YK0A 4Z6HA 5LVRA 2L84A 5HQ6A 4ALHA 3S92A 1JM4B 5EA1A 5F36A 5COIA 5A5SA 4HXMA 4O75A 2NXBA 5KO4A 3O37A 5L98A 5A82A 5I7XA 5D0CA 4C66A 2R0SA 4CUSA 4OUFA 2L85A 4TTEA 4O7FA 4CL9A 5L8TA 5A85A 5LJ1A 4HBYA 5C7NA 4QUUA 2F6NA 1E6IA 4YYMA 4QYDA 3SVFA 5D3SA 4NYWA 5D24A 3LQIA 5L96A 5EWWA 4KV4A 2DATA 4MEPA 4QC1A 4QEWA 4TT2A 5L8UA 4O78A 2E7NA 3JVJA 5ENHA 5EQ1A 5LKXA 5EM3A 4YYKA 5C8GA 5E9KA 5DFDA 5CY9A 5TCMA 4QSRA 5A5OA 3MB3A 1X0JA 2R0YA 4A9JA 4YY4A 5E9YA 5FH7A 4QSXA 4KV1A 4MEQA 4QEVA 4CUTA 5C89A 2F6JA 4N4GA 4A9FA 5HLSA 4NR9A 5G4SA 3LQHA 4YY6A 5DKDA 2R0VA 4A9NA 5F3AA 5JWMA 3P1EA 4MR4A 4Q0OA 3U5NA 5IGMA 4LYWA 4TU6A 4X2IA 5C4QA 4O70A 2RI7A 4UYHA 4TT6A 4BHWA 2YEKA 5A5NA 4QSWA 3UVWA 3MUKA 5H1VA 4PTBA 4CFKA 4O7EA 4PKLA 5KHMA 5II1A 2OO1A 5J0DA 4QC3A 2DWWA 4IR4A 4MR6A 4O72A 5E0RA 5HENA 4HXRA 5EU1A 5FB1A 5FBXA 2H60A 4NQNA 5IIDA 4XYAA 4YAXA 2E3KA 4HBWA 4HBVA 4LZ2A 3UV2A 4PY6A 4YYIA 5ACYA 5EWDA 5DFBA 4NRBA 3SVHA 3U5KA 4O7BA 4QSPA 5D3NA 5EI4A 2DVSA 2DKWA 5KTUA 4LR6A 4YH3A 5DY7A 3Q2FA 4QSTA 5F2PA 4YBMA 3UV5A 5LKTA 5CQ8A 2WP1A 4BW2A 1F68A 5I89A 5CUDA 4ZQLA 3HMEA 4YYNA 4FLPA 5HCLA 5TB6A 5AD3A 5CQAA 4NXJA 4F3IA 4QR4A 5C85A 5D3JA 5EVAA 4RVRA 5ENBA 5CU8A 4MENA 3QZSA 2RS9B 5D26A 5F1HA 4QR5A 5I80A 5A5QA 3AADA 4Z1QA 4QSVA 4QSQA 5CTLA 5ENCA 5LJ0A 4HXOA 5D3PA 4A9IA 4HXKA 5C87A 2N9GA 4NYVA 4YH4A 5G4RA 3UV4A 4NRCA 4NYXA 5DYUA 4IR3A 5FE6A 2D82A 4TYLA 5ENIA 3AQAA 5L99A 4UYGA 2G4AA 4NR6A 4ZW1A 5DBMA 3UVDA 5H85A 4A9KA 4YBTA 5EWVA 3ZYUA 4CUUA 5LVQA 3U5PA 5KTXA 4BW3A 2DVQA 5CPEA 4IR5A 5CUEA 5FFYA 3D7CA 4TZ2A 4HXLA 5HFRA 4NUCA 2D9EA 4OGIA 5E3GA 1N72A 4TQNA 5LJ2A 3O33A 4UIYA 5A7CA 4NS5A 5FH8A 5F25A 4CFLA 4QYLA 4NUEA 5CQ6A 5EPBA 2RO1A 2RNXA 5KTWA 5DX4A 4NRAA 3MXFA 4XY9A 5FH6A 1EQFA 5I40A 3IU5A 4NR7A 4Z1SA 4QUTA 5IGLA 5HRXA 5E73A 2FSAA 5F62A 3MB4A 5EWCA 4BW4A 5FE8A 5CQ3A 2RNWA 3P1FA 5CRZA 5DLZA 5KU3A 1WUMA 2KTBB 3HMHA 4HXSA 5DW1A 4N4HA 4QSUA 4CLBA 4J3IA 5FFWA 4UIZA 4QR3A 3U5LA 4CURA 5D3TA 4QBMA 2DVVA 2YW5A 4YYGA 3Q2EA 3IU6A 3JVKA 5E9VA 5I86A 5LKUA 5F60A 5FE7A 3P5OA 4PCEA 5HQ7A 2GRCA 5DKHA 5IG6A 3SVGA 2E7OA 5FE2A 4ALGA 4NQMA 4TZ8A 3HMFA 5HQ5A 5CUCA 4XUAA 5L97A 5E9LA 5I88A 2L5EA 3QZVA 3DAIA 4HXPA 5H1TA 2RNYA 5AMEA 5EP7A 5ETBA 4YYDA 5DYCA 5D25A 4J1PA 3U5OA 4NR5A 3P1DA 4LDFA 4N4FA 3RCWA 4UYFA 4TU4A 4LYIA 4LRGA 5CP5A 2R10A 5FB0A 4ZC9A 4UYDA 4A9MA 5D7XA 5CQTA 4UYEA 5A5PA 2LSPB 2OUOA 4XUBA 4YYHA 3LXJA 4OGJA 4NR4A 4QNSA 5AMFA 4YATA 5CZGA 5BT3A 5A81A 3MQMA 4J0SA 3LQJA 1WUGA 5ENFA 5DYAA 5HFQA 5CFWA 4QEUA 2RFJA 5DFCA 5E9MA 3P1CA 5CUGA 3LJWA 4UITA 4UIWA 3JVMA 5BT5A 4N4IA 5EPRA 5FG5A 2YQDA 4QZSA 3ONIA 2YDWA 4WHWA 4NR8A 4CUQA 5ENEA 3UW9A 5JI8A 4E96A 4TS8A 4QB3A 4A9HA 4WHUA 5EGUA 5F61A 4LYSA 5CQ7A 5DKCA 4QSSA 4LC2A 3U5MA 5HM0A 4YBSA 4UYFB 5FE0A 3TLPA 5HRVA 5HELA 4IOQA 4HBXA 5A5RA 4LZSA 5F5ZA 5CS8A 4GPJA 4O76A 5ENGA 5EV9A 2WP2A 4MR5A 5D3LA 4J0RA 5DW2A 4BW1A 5A83A 5FE3A 4CUPA 5FE1A 5EISA 5H1UA
chains in the Genus database with same CATH superfamily
4Q0NA 3FKMX 3VKHA 5IGKA 5LKZA 4Z6IA 5ETDA 2MJVB 4A9EA 4WIVA 4LZRA 4AKNA 3O35A 5IBNA 5CQ5A 5FE4A 2I7KA 4IR6A 4BJXA 4UIVA 5E7DA 5K29A 4YABA 3NXBA 4Z93A 4PS5A 4TT4A 5I1QA 3JVLA 4YYJA 4A9OA 2DVRA 4O77A 4PCIA 4HXNA 5BT4A 5HRWA 5E74A 5D3HA 4KCXA 5EK9A 5FE5A 4O71A 4O7AA 1ZS5A 3O36A 2YELA 3UVYA 5D3RA 5I29A 4MEOA 4DONA 5EWHA 4NUDA 5CUAA 2I8NA 3U5JA 3G0JA 5DYXA 4UIXA 5II2A 5CUBA 3MULA 5FE9A 5FFVA 5CRMA 5DLXA 3QZTA 3UVXA 4AKIA 5FDZA 4QY4A 3G0LA 3S91A 2OSSA 1JSPB 4MR3A 5IGNA 5CGPA 5FG6A 2YEMA 4UIUA 4A9LA 5EPSA 4N3WA 5ENJA 3I3JA 5FG4A 4C67A 4O74A 4XY8A 4YADA 3DWYA 5LUUA 2YYNA 4IOOA 5HEMA 5CQ4A 4IORA 5F63A 5E3DA 5HJCA 3K2JA 3GG3A 5E9IA 5EICA 3O34A 4Y03A 4O7CA 5F1LA 4YC9A 5I83A 5AD2A 5I7YA 4YK0A 4Z6HA 5LVRA 2L84A 5HQ6A 3D1BA 4ALHA 3S92A 1JM4B 5EA1A 5F36A 5COIA 5A5SA 4HXMA 4O75A 2NXBA 5KO4A 3O37A 5L98A 5A82A 5I7XA 5D0CA 4C66A 2R0SA 4CUSA 4OUFA 2L85A 4TTEA 4O7FA 4CL9A 5L8TA 5A85A 5LJ1A 4HBYA 5C7NA 4QUUA 2F6NA 1E6IA 4YYMA 4QYDA 3SVFA 5D3SA 4NYWA 5D24A 3LQIA 5L96A 5EWWA 4KV4A 2DATA 4MEPA 4QC1A 4QEWA 4TT2A 5L8UA 4O78A 2E7NA 3JVJA 5ENHA 5EQ1A 5LKXA 5EM3A 4YYKA 5C8GA 4AKGA 5E9KA 5DFDA 5CY9A 5TCMA 4QSRA 5A5OA 3MB3A 1X0JA 2R0YA 4A9JA 4YY4A 5E9YA 5FH7A 4AI6A 4QSXA 4KV1A 4MEQA 4QEVA 4CUTA 5C89A 2F6JA 3ERRA 4N4GA 4A9FA 5HLSA 4NR9A 5G4SA 3LQHA 4YY6A 5DKDA 1PUOA 2R0VA 4A9NA 5F3AA 5JWMA 3P1EA 4MR4A 4Q0OA 3U5NA 5IGMA 4LYWA 4TU6A 4X2IA 5C4QA 4O70A 2RI7A 4UYHA 4TT6A 4BHWA 2YEKA 5A5NA 4QSWA 3UVWA 3MUKA 5H1VA 4PTBA 4CFKA 4O7EA 4PKLA 5KHMA 5II1A 2OO1A 5J0DA 4QC3A 2DWWA 4IR4A 4MR6A 4O72A 5E0RA 5HENA 4HXRA 5EU1A 5FB1A 5FBXA 2H60A 4NQNA 5IIDA 4XYAA 4YAXA 2E3KA 4HBWA 4HBVA 4LZ2A 3UV2A 4PY6A 4YYIA 5ACYA 5EWDA 5DFBA 4NRBA 3SVHA 3U5KA 4O7BA 4QSPA 5D3NA 5EI4A 2DVSA 2DKWA 5KTUA 4LR6A 4YH3A 5DY7A 3Q2FA 4QSTA 5F2PA 4YBMA 3UV5A 5LKTA 5CQ8A 2WP1A 4BW2A 1F68A 5I89A 5CUDA 4ZQLA 3HMEA 4YYNA 4FLPA 5HCLA 5TB6A 5AD3A 5CQAA 4NXJA 4F3IA 4QR4A 5C85A 5D3JA 5EVAA 4RVRA 5ENBA 5CU8A 4MENA 3QZSA 2RS9B 5D26A 5F1HA 4QR5A 5I80A 5A5QA 3AADA 4Z1QA 4QSVA 4QSQA 5CTLA 5ENCA 5LJ0A 4HXOA 5D3PA 4A9IA 4HXKA 5C87A 2N9GA 4NYVA 4YH4A 5G4RA 3UV4A 4NRCA 4NYXA 5DYUA 4IR3A 5FE6A 2D82A 4TYLA 5ENIA 3AQAA 5L99A 4UYGA 2G4AA 4NR6A 4ZW1A 5DBMA 3UVDA 5H85A 4A9KA 4YBTA 5EWVA 3ZYUA 4CUUA 5LVQA 3U5PA 5KTXA 4BW3A 2DVQA 5CPEA 4IR5A 5CUEA 5FFYA 3D7CA 4TZ2A 4HXLA 5HFRA 4NUCA 2D9EA 4OGIA 5E3GA 1N72A 4TQNA 5LJ2A 3O33A 4UIYA 5A7CA 4NS5A 5FH8A 5F25A 4CFLA 4QYLA 4NUEA 5CQ6A 5EPBA 2RO1A 2RNXA 5KTWA 5DX4A 4NRAA 3MXFA 4XY9A 5FH6A 1EQFA 5I40A 3IU5A 4NR7A 4Z1SA 4QUTA 5IGLA 5HRXA 5E73A 2FSAA 5F62A 3MB4A 5EWCA 4BW4A 5FE8A 5CQ3A 2RNWA 3P1FA 5CRZA 5DLZA 5KU3A 1WUMA 2KTBB 3HMHA 4HXSA 5DW1A 4N4HA 4QSUA 4CLBA 4J3IA 5FFWA 4UIZA 4QR3A 3U5LA 4CURA 5D3TA 4QBMA 2DVVA 2YW5A 4YYGA 3Q2EA 3IU6A 3JVKA 5E9VA 5I86A 5LKUA 2EJNA 5F60A 5FE7A 3P5OA 4PCEA 5HQ7A 2GRCA 5DKHA 5IG6A 3SVGA 2E7OA 5FE2A 4ALGA 4NQMA 4TZ8A 3HMFA 5HQ5A 5CUCA 1ZKRA 4XUAA 5L97A 5E9LA 5I88A 2L5EA 3QZVA 3DAIA 4HXPA 5H1TA 2RNYA 5AMEA 5EP7A 5ETBA 4YYDA 3VKGA 5DYCA 5D25A 4J1PA 3U5OA 4NR5A 3P1DA 4LDFA 4N4FA 3RCWA 4UYFA 4TU4A 4LYIA 4LRGA 5CP5A 2R10A 5FB0A 4ZC9A 4UYDA 4A9MA 5D7XA 5CQTA 4UYEA 5A5PA 2LSPB 2OUOA 4XUBA 4YYHA 3LXJA 4OGJA 4NR4A 4QNSA 5AMFA 4YATA 5CZGA 5BT3A 5A81A 3MQMA 4J0SA 3LQJA 1WUGA 5ENFA 5DYAA 5HFQA 5CFWA 4QEUA 2RFJA 5DFCA 5E9MA 3P1CA 5CUGA 3LJWA 4UITA 4UIWA 3JVMA 5BT5A 4N4IA 5EPRA 5FG5A 2YQDA 4QZSA 3ONIA 2YDWA 4WHWA 4NR8A 4CUQA 5ENEA 3UW9A 5JI8A 4E96A 4AKHA 4TS8A 4QB3A 4A9HA 4WHUA 5EGUA 5F61A 4LYSA 5CQ7A 5DKCA 4QSSA 4LC2A 3U5MA 5HM0A 4YBSA 4UYFB 5FE0A 3TLPA 5HRVA 5HELA 4IOQA 4HBXA 5A5RA 4LZSA 3D1DA 5F5ZA 5CS8A 4GPJA 4O76A 5ENGA 5EV9A 2WP2A 4MR5A 5D3LA 4J0RA 5DW2A 4BW1A 5A83A 5FE3A 4CUPA 5FE1A 5EISA 5H1UA
chains in the Genus database with same CATH topology
4Q0NA 3FKMX 5IGKA 5LKZA 4Z6IA 5ETDA 2MJVB 4A9EA 4WIVA 4LZRA 4AKNA 3O35A 5IBNA 5CQ5A 5FE4A 2I7KA 4IR6A 4BJXA 4UIVA 5E7DA 5K29A 4YABA 3NXBA 4Z93A 4PS5A 4TT4A 5I1QA 3JVLA 4YYJA 4A9OA 2DVRA 4O77A 4PCIA 4HXNA 5BT4A 5HRWA 5E74A 5D3HA 4KCXA 5EK9A 5FE5A 4O71A 4O7AA 1ZS5A 3O36A 2YELA 3UVYA 5D3RA 5I29A 4MEOA 4DONA 5EWHA 4NUDA 5CUAA 2I8NA 3U5JA 3G0JA 5DYXA 4UIXA 5II2A 5CUBA 3MULA 5FE9A 5FFVA 5CRMA 5DLXA 3QZTA 3UVXA 5FDZA 4QY4A 3G0LA 3S91A 2OSSA 1JSPB 4MR3A 5IGNA 5CGPA 5FG6A 2YEMA 4UIUA 4A9LA 5EPSA 4N3WA 5ENJA 3I3JA 5FG4A 4C67A 4O74A 4XY8A 4YADA 3DWYA 5LUUA 2YYNA 4IOOA 5HEMA 5CQ4A 4IORA 5F63A 5E3DA 5HJCA 3K2JA 3GG3A 5E9IA 5EICA 3O34A 4Y03A 4O7CA 5F1LA 4YC9A 5I83A 5AD2A 5I7YA 4YK0A 4Z6HA 5LVRA 2L84A 5HQ6A 4ALHA 3S92A 1JM4B 5EA1A 5F36A 5COIA 5A5SA 4HXMA 4O75A 2NXBA 5KO4A 3O37A 5L98A 5A82A 5I7XA 5D0CA 4C66A 2R0SA 4CUSA 4OUFA 2L85A 4TTEA 4O7FA 4CL9A 5L8TA 5A85A 5LJ1A 4HBYA 5C7NA 4QUUA 2F6NA 1E6IA 4YYMA 4QYDA 3SVFA 5D3SA 4NYWA 5D24A 3LQIA 5L96A 5EWWA 4KV4A 2DATA 4MEPA 4QC1A 4QEWA 4TT2A 5L8UA 4O78A 2E7NA 3JVJA 5ENHA 5EQ1A 5LKXA 5EM3A 4YYKA 5C8GA 5E9KA 5DFDA 5CY9A 5TCMA 4QSRA 5A5OA 3MB3A 1X0JA 2R0YA 4A9JA 4YY4A 5E9YA 5FH7A 4QSXA 4KV1A 4MEQA 4QEVA 4CUTA 5C89A 2F6JA 4N4GA 4A9FA 5HLSA 4NR9A 5G4SA 3LQHA 4YY6A 5DKDA 2R0VA 4A9NA 5F3AA 5JWMA 3P1EA 4MR4A 4Q0OA 3U5NA 5IGMA 4LYWA 4TU6A 4X2IA 5C4QA 4O70A 2RI7A 4UYHA 4TT6A 4BHWA 2YEKA 5A5NA 4QSWA 3UVWA 3MUKA 5H1VA 4PTBA 4CFKA 4O7EA 4PKLA 5KHMA 5II1A 2OO1A 5J0DA 4QC3A 2DWWA 4IR4A 4MR6A 4O72A 5E0RA 5HENA 4HXRA 5EU1A 5FB1A 5FBXA 2H60A 4NQNA 5IIDA 4XYAA 4YAXA 2E3KA 4HBWA 4HBVA 4LZ2A 3UV2A 4PY6A 4YYIA 5ACYA 5EWDA 5DFBA 4NRBA 3SVHA 3U5KA 4O7BA 4QSPA 5D3NA 5EI4A 2DVSA 2DKWA 5KTUA 4LR6A 4YH3A 5DY7A 3Q2FA 4QSTA 5F2PA 4YBMA 3UV5A 5LKTA 5CQ8A 2WP1A 4BW2A 1F68A 5I89A 5CUDA 4ZQLA 3HMEA 4YYNA 4FLPA 5HCLA 5TB6A 5AD3A 5CQAA 4NXJA 4F3IA 4QR4A 5C85A 5D3JA 5EVAA 4RVRA 5ENBA 5CU8A 4MENA 3QZSA 2RS9B 5D26A 5F1HA 4QR5A 5I80A 5A5QA 3AADA 4Z1QA 4QSVA 4QSQA 5CTLA 5ENCA 5LJ0A 4HXOA 5D3PA 4A9IA 4HXKA 5C87A 2N9GA 4NYVA 4YH4A 5G4RA 3UV4A 4NRCA 4NYXA 5DYUA 4IR3A 5FE6A 2D82A 4TYLA 5ENIA 3AQAA 5L99A 4UYGA 2G4AA 4NR6A 4ZW1A 5DBMA 3UVDA 5H85A 4A9KA 4YBTA 5EWVA 3ZYUA 4CUUA 5LVQA 3U5PA 5KTXA 4BW3A 2DVQA 5CPEA 4IR5A 5CUEA 5FFYA 3D7CA 4TZ2A 4HXLA 5HFRA 4NUCA 2D9EA 4OGIA 5E3GA 1N72A 4TQNA 5LJ2A 3O33A 4UIYA 5A7CA 4NS5A 5FH8A 5F25A 4CFLA 4QYLA 4NUEA 5CQ6A 5EPBA 2RO1A 2RNXA 5KTWA 5DX4A 4NRAA 3MXFA 4XY9A 5FH6A 1EQFA 5I40A 3IU5A 4NR7A 4Z1SA 4QUTA 5IGLA 5HRXA 5E73A 2FSAA 5F62A 3MB4A 5EWCA 4BW4A 5FE8A 5CQ3A 2RNWA 3P1FA 5CRZA 5DLZA 5KU3A 1WUMA 2KTBB 3HMHA 4HXSA 5DW1A 4N4HA 4QSUA 4CLBA 4J3IA 5FFWA 4UIZA 4QR3A 3U5LA 4CURA 5D3TA 4QBMA 2DVVA 2YW5A 4YYGA 3Q2EA 3IU6A 3JVKA 5E9VA 5I86A 5LKUA 5F60A 5FE7A 3P5OA 4PCEA 5HQ7A 2GRCA 5DKHA 5IG6A 3SVGA 2E7OA 5FE2A 4ALGA 4NQMA 4TZ8A 3HMFA 5HQ5A 5CUCA 4XUAA 5L97A 5E9LA 5I88A 2L5EA 3QZVA 3DAIA 4HXPA 5H1TA 2RNYA 5AMEA 5EP7A 5ETBA 4YYDA 5DYCA 5D25A 4J1PA 3U5OA 4NR5A 3P1DA 4LDFA 4N4FA 3RCWA 4UYFA 4TU4A 4LYIA 4LRGA 5CP5A 2R10A 5FB0A 4ZC9A 4UYDA 4A9MA 5D7XA 5CQTA 4UYEA 5A5PA 2LSPB 2OUOA 4XUBA 4YYHA 3LXJA 4OGJA 4NR4A 4QNSA 5AMFA 4YATA 5CZGA 5BT3A 5A81A 3MQMA 4J0SA 3LQJA 1WUGA 5ENFA 5DYAA 5HFQA 5CFWA 4QEUA 2RFJA 5DFCA 5E9MA 3P1CA 5CUGA 3LJWA 4UITA 4UIWA 3JVMA 5BT5A 4N4IA 5EPRA 5FG5A 2YQDA 4QZSA 3ONIA 2YDWA 4WHWA 4NR8A 4CUQA 5ENEA 3UW9A 5JI8A 4E96A 4TS8A 4QB3A 4A9HA 4WHUA 5EGUA 5F61A 4LYSA 5CQ7A 5DKCA 4QSSA 4LC2A 3U5MA 5HM0A 4YBSA 4UYFB 5FE0A 3TLPA 5HRVA 5HELA 4IOQA 4HBXA 5A5RA 4LZSA 5F5ZA 5CS8A 4GPJA 4O76A 5ENGA 5EV9A 2WP2A 4MR5A 5D3LA 4J0RA 5DW2A 4BW1A 5A83A 5FE3A 4CUPA 5FE1A 5EISA 5H1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q0N A;  3FKM X;  5IGK A;  5LKZ A;  4Z6I A;  5ETD A;  2MJV B;  4A9E A;  4WIV A;  4LZR A;  4AKN A;  3O35 A;  5IBN A;  5CQ5 A;  5FE4 A;  2I7K A;  4IR6 A;  4BJX A;  4UIV A;  5E7D A;  5K29 A;  4YAB A;  3NXB A;  4Z93 A;  4PS5 A;  4TT4 A;  5I1Q A;  3JVL A;  4YYJ A;  4A9O A;  2DVR A;  4O77 A;  4PCI A;  4HXN A;  5BT4 A;  5HRW A;  5E74 A;  5D3H A;  4KCX A;  5EK9 A;  5FE5 A;  4O71 A;  4O7A A;  1ZS5 A;  3O36 A;  2YEL A;  3UVY A;  5D3R A;  5I29 A;  4MEO A;  4DON A;  5EWH A;  4NUD A;  5CUA A;  2I8N A;  3U5J A;  3G0J A;  5DYX A;  4UIX A;  5II2 A;  5CUB A;  3MUL A;  5FE9 A;  5FFV A;  5CRM A;  5DLX A;  3QZT A;  3UVX A;  5FDZ A;  4QY4 A;  3G0L A;  3S91 A;  2OSS A;  1JSP B;  4MR3 A;  5IGN A;  5CGP A;  5FG6 A;  2YEM A;  4UIU A;  4A9L A;  5EPS A;  4N3W A;  5ENJ A;  3I3J A;  5FG4 A;  4C67 A;  4O74 A;  4XY8 A;  4YAD A;  3DWY A;  5LUU A;  2YYN A;  4IOO A;  5HEM A;  5CQ4 A;  4IOR A;  5F63 A;  5E3D A;  5HJC A;  3K2J A;  3GG3 A;  5E9I A;  5EIC A;  3O34 A;  4Y03 A;  4O7C A;  5F1L A;  4YC9 A;  5I83 A;  5AD2 A;  5I7Y A;  4YK0 A;  4Z6H A;  5LVR A;  2L84 A;  5HQ6 A;  4ALH A;  3S92 A;  1JM4 B;  5EA1 A;  5F36 A;  5COI A;  5A5S A;  4HXM A;  4O75 A;  2NXB A;  5KO4 A;  3O37 A;  5L98 A;  5A82 A;  5I7X A;  5D0C A;  4C66 A;  2R0S A;  4CUS A;  4OUF A;  2L85 A;  4TTE A;  4O7F A;  4CL9 A;  5L8T A;  5A85 A;  5LJ1 A;  4HBY A;  5C7N A;  4QUU A;  2F6N A;  1E6I A;  4YYM A;  4QYD A;  3SVF A;  5D3S A;  4NYW A;  5D24 A;  3LQI A;  5L96 A;  5EWW A;  4KV4 A;  2DAT A;  4MEP A;  4QC1 A;  4QEW A;  4TT2 A;  5L8U A;  4O78 A;  2E7N A;  3JVJ A;  5ENH A;  5EQ1 A;  5LKX A;  5EM3 A;  4YYK A;  5C8G A;  5E9K A;  5DFD A;  5CY9 A;  5TCM A;  4QSR A;  5A5O A;  3MB3 A;  1X0J A;  2R0Y A;  4A9J A;  4YY4 A;  5E9Y A;  5FH7 A;  4QSX A;  4KV1 A;  4MEQ A;  4QEV A;  4CUT A;  5C89 A;  2F6J A;  4N4G A;  4A9F A;  5HLS A;  4NR9 A;  5G4S A;  3LQH A;  4YY6 A;  5DKD A;  2R0V A;  4A9N A;  5F3A A;  5JWM A;  3P1E A;  4MR4 A;  4Q0O A;  3U5N A;  5IGM A;  4LYW A;  4TU6 A;  4X2I A;  5C4Q A;  4O70 A;  2RI7 A;  4UYH A;  4TT6 A;  4BHW A;  2YEK A;  5A5N A;  4QSW A;  3UVW A;  3MUK A;  5H1V A;  4PTB A;  4CFK A;  4O7E A;  4PKL A;  5KHM A;  5II1 A;  2OO1 A;  5J0D A;  4QC3 A;  2DWW A;  4IR4 A;  4MR6 A;  4O72 A;  5E0R A;  5HEN A;  4HXR A;  5EU1 A;  5FB1 A;  5FBX A;  2H60 A;  4NQN A;  5IID A;  4XYA A;  4YAX A;  2E3K A;  4HBW A;  4HBV A;  4LZ2 A;  3UV2 A;  4PY6 A;  4YYI A;  5ACY A;  5EWD A;  5DFB A;  4NRB A;  3SVH A;  3U5K A;  4O7B A;  4QSP A;  5D3N A;  5EI4 A;  2DVS A;  2DKW A;  5KTU A;  4LR6 A;  4YH3 A;  5DY7 A;  3Q2F A;  4QST A;  5F2P A;  4YBM A;  3UV5 A;  5LKT A;  5CQ8 A;  2WP1 A;  4BW2 A;  1F68 A;  5I89 A;  5CUD A;  4ZQL A;  3HME A;  4YYN A;  4FLP A;  5HCL A;  5TB6 A;  5AD3 A;  5CQA A;  4NXJ A;  4F3I A;  4QR4 A;  5C85 A;  5D3J A;  5EVA A;  4RVR A;  5ENB A;  5CU8 A;  4MEN A;  3QZS A;  2RS9 B;  5D26 A;  5F1H A;  4QR5 A;  5I80 A;  5A5Q A;  3AAD A;  4Z1Q A;  4QSV A;  4QSQ A;  5CTL A;  5ENC A;  5LJ0 A;  4HXO A;  5D3P A;  4A9I A;  4HXK A;  5C87 A;  2N9G A;  4NYV A;  4YH4 A;  5G4R A;  3UV4 A;  4NRC A;  4NYX A;  5DYU A;  4IR3 A;  5FE6 A;  2D82 A;  4TYL A;  5ENI A;  3AQA A;  5L99 A;  4UYG A;  2G4A A;  4NR6 A;  4ZW1 A;  5DBM A;  3UVD A;  5H85 A;  4A9K A;  4YBT A;  5EWV A;  3ZYU A;  4CUU A;  5LVQ A;  3U5P A;  5KTX A;  4BW3 A;  2DVQ A;  5CPE A;  4IR5 A;  5CUE A;  5FFY A;  3D7C A;  4TZ2 A;  4HXL A;  5HFR A;  4NUC A;  2D9E A;  4OGI A;  5E3G A;  1N72 A;  4TQN A;  5LJ2 A;  3O33 A;  4UIY A;  5A7C A;  4NS5 A;  5FH8 A;  5F25 A;  4CFL A;  4QYL A;  4NUE A;  5CQ6 A;  5EPB A;  2RO1 A;  2RNX A;  5KTW A;  5DX4 A;  4NRA A;  3MXF A;  4XY9 A;  5FH6 A;  1EQF A;  5I40 A;  3IU5 A;  4NR7 A;  4Z1S A;  4QUT A;  5IGL A;  5HRX A;  5E73 A;  2FSA A;  5F62 A;  3MB4 A;  5EWC A;  4BW4 A;  5FE8 A;  5CQ3 A;  2RNW A;  3P1F A;  5CRZ A;  5DLZ A;  5KU3 A;  1WUM A;  2KTB B;  3HMH A;  4HXS A;  5DW1 A;  4N4H A;  4QSU A;  4CLB A;  4J3I A;  5FFW A;  4UIZ A;  4QR3 A;  3U5L A;  4CUR A;  5D3T A;  4QBM A;  2DVV A;  2YW5 A;  4YYG A;  3Q2E A;  3IU6 A;  3JVK A;  5E9V A;  5I86 A;  5LKU A;  5F60 A;  5FE7 A;  3P5O A;  4PCE A;  5HQ7 A;  2GRC A;  5DKH A;  5IG6 A;  3SVG A;  2E7O A;  5FE2 A;  4ALG A;  4NQM A;  4TZ8 A;  3HMF A;  5HQ5 A;  5CUC A;  4XUA A;  5L97 A;  5E9L A;  5I88 A;  2L5E A;  3QZV A;  3DAI A;  4HXP A;  5H1T A;  2RNY A;  5AME A;  5EP7 A;  5ETB A;  4YYD A;  5DYC A;  5D25 A;  4J1P A;  3U5O A;  4NR5 A;  3P1D A;  4LDF A;  4N4F A;  3RCW A;  4UYF A;  4TU4 A;  4LYI A;  4LRG A;  5CP5 A;  2R10 A;  5FB0 A;  4ZC9 A;  4UYD A;  4A9M A;  5D7X A;  5CQT A;  4UYE A;  5A5P A;  2LSP B;  2OUO A;  4XUB A;  4YYH A;  3LXJ A;  4OGJ A;  4NR4 A;  4QNS A;  5AMF A;  4YAT A;  5CZG A;  5BT3 A;  5A81 A;  3MQM A;  4J0S A;  3LQJ A;  1WUG A;  5ENF A;  5DYA A;  5HFQ A;  5CFW A;  4QEU A;  2RFJ A;  5DFC A;  5E9M A;  3P1C A;  5CUG A;  3LJW A;  4UIT A;  4UIW A;  3JVM A;  5BT5 A;  4N4I A;  5EPR A;  5FG5 A;  2YQD A;  4QZS A;  3ONI A;  2YDW A;  4WHW A;  4NR8 A;  4CUQ A;  5ENE A;  3UW9 A;  5JI8 A;  4E96 A;  4TS8 A;  4QB3 A;  4A9H A;  4WHU A;  5EGU A;  5F61 A;  4LYS A;  5CQ7 A;  5DKC A;  4QSS A;  4LC2 A;  3U5M A;  5HM0 A;  4YBS A;  4UYF B;  5FE0 A;  3TLP A;  5HRV A;  5HEL A;  4IOQ A;  4HBX A;  5A5R A;  4LZS A;  5F5Z A;  5CS8 A;  4GPJ A;  4O76 A;  5ENG A;  5EV9 A;  2WP2 A;  4MR5 A;  5D3L A;  4J0R A;  5DW2 A;  4BW1 A;  5A83 A;  5FE3 A;  4CUP A;  5FE1 A;  5EIS A;  5H1U A; 
#chains in the Genus database with same CATH topology
 4Q0N A;  3FKM X;  3VKH A;  5IGK A;  5LKZ A;  4Z6I A;  5ETD A;  2MJV B;  4A9E A;  4WIV A;  4LZR A;  4AKN A;  3O35 A;  5IBN A;  5CQ5 A;  5FE4 A;  2I7K A;  4IR6 A;  4BJX A;  4UIV A;  5E7D A;  5K29 A;  4YAB A;  3NXB A;  4Z93 A;  4PS5 A;  4TT4 A;  5I1Q A;  3JVL A;  4YYJ A;  4A9O A;  2DVR A;  4O77 A;  4PCI A;  4HXN A;  5BT4 A;  5HRW A;  5E74 A;  5D3H A;  4KCX A;  5EK9 A;  5FE5 A;  4O71 A;  4O7A A;  1ZS5 A;  3O36 A;  2YEL A;  3UVY A;  5D3R A;  5I29 A;  4MEO A;  4DON A;  5EWH A;  4NUD A;  5CUA A;  2I8N A;  3U5J A;  3G0J A;  5DYX A;  4UIX A;  5II2 A;  5CUB A;  3MUL A;  5FE9 A;  5FFV A;  5CRM A;  5DLX A;  3QZT A;  3UVX A;  4AKI A;  5FDZ A;  4QY4 A;  3G0L A;  3S91 A;  2OSS A;  1JSP B;  4MR3 A;  5IGN A;  5CGP A;  5FG6 A;  2YEM A;  4UIU A;  4A9L A;  5EPS A;  4N3W A;  5ENJ A;  3I3J A;  5FG4 A;  4C67 A;  4O74 A;  4XY8 A;  4YAD A;  3DWY A;  5LUU A;  2YYN A;  4IOO A;  5HEM A;  5CQ4 A;  4IOR A;  5F63 A;  5E3D A;  5HJC A;  3K2J A;  3GG3 A;  5E9I A;  5EIC A;  3O34 A;  4Y03 A;  4O7C A;  5F1L A;  4YC9 A;  5I83 A;  5AD2 A;  5I7Y A;  4YK0 A;  4Z6H A;  5LVR A;  2L84 A;  5HQ6 A;  3D1B A;  4ALH A;  3S92 A;  1JM4 B;  5EA1 A;  5F36 A;  5COI A;  5A5S A;  4HXM A;  4O75 A;  2NXB A;  5KO4 A;  3O37 A;  5L98 A;  5A82 A;  5I7X A;  5D0C A;  4C66 A;  2R0S A;  4CUS A;  4OUF A;  2L85 A;  4TTE A;  4O7F A;  4CL9 A;  5L8T A;  5A85 A;  5LJ1 A;  4HBY A;  5C7N A;  4QUU A;  2F6N A;  1E6I A;  4YYM A;  4QYD A;  3SVF A;  5D3S A;  4NYW A;  5D24 A;  3LQI A;  5L96 A;  5EWW A;  4KV4 A;  2DAT A;  4MEP A;  4QC1 A;  4QEW A;  4TT2 A;  5L8U A;  4O78 A;  2E7N A;  3JVJ A;  5ENH A;  5EQ1 A;  5LKX A;  5EM3 A;  4YYK A;  5C8G A;  4AKG A;  5E9K A;  5DFD A;  5CY9 A;  5TCM A;  4QSR A;  5A5O A;  3MB3 A;  1X0J A;  2R0Y A;  4A9J A;  4YY4 A;  5E9Y A;  5FH7 A;  4AI6 A;  4QSX A;  4KV1 A;  4MEQ A;  4QEV A;  4CUT A;  5C89 A;  2F6J A;  3ERR A;  4N4G A;  4A9F A;  5HLS A;  4NR9 A;  5G4S A;  3LQH A;  4YY6 A;  5DKD A;  1PUO A;  2R0V A;  4A9N A;  5F3A A;  5JWM A;  3P1E A;  4MR4 A;  4Q0O A;  3U5N A;  5IGM A;  4LYW A;  4TU6 A;  4X2I A;  5C4Q A;  4O70 A;  2RI7 A;  4UYH A;  4TT6 A;  4BHW A;  2YEK A;  5A5N A;  4QSW A;  3UVW A;  3MUK A;  5H1V A;  4PTB A;  4CFK A;  4O7E A;  4PKL A;  5KHM A;  5II1 A;  2OO1 A;  5J0D A;  4QC3 A;  2DWW A;  4IR4 A;  4MR6 A;  4O72 A;  5E0R A;  5HEN A;  4HXR A;  5EU1 A;  5FB1 A;  5FBX A;  2H60 A;  4NQN A;  5IID A;  4XYA A;  4YAX A;  2E3K A;  4HBW A;  4HBV A;  4LZ2 A;  3UV2 A;  4PY6 A;  4YYI A;  5ACY A;  5EWD A;  5DFB A;  4NRB A;  3SVH A;  3U5K A;  4O7B A;  4QSP A;  5D3N A;  5EI4 A;  2DVS A;  2DKW A;  5KTU A;  4LR6 A;  4YH3 A;  5DY7 A;  3Q2F A;  4QST A;  5F2P A;  4YBM A;  3UV5 A;  5LKT A;  5CQ8 A;  2WP1 A;  4BW2 A;  1F68 A;  5I89 A;  5CUD A;  4ZQL A;  3HME A;  4YYN A;  4FLP A;  5HCL A;  5TB6 A;  5AD3 A;  5CQA A;  4NXJ A;  4F3I A;  4QR4 A;  5C85 A;  5D3J A;  5EVA A;  4RVR A;  5ENB A;  5CU8 A;  4MEN A;  3QZS A;  2RS9 B;  5D26 A;  5F1H A;  4QR5 A;  5I80 A;  5A5Q A;  3AAD A;  4Z1Q A;  4QSV A;  4QSQ A;  5CTL A;  5ENC A;  5LJ0 A;  4HXO A;  5D3P A;  4A9I A;  4HXK A;  5C87 A;  2N9G A;  4NYV A;  4YH4 A;  5G4R A;  3UV4 A;  4NRC A;  4NYX A;  5DYU A;  4IR3 A;  5FE6 A;  2D82 A;  4TYL A;  5ENI A;  3AQA A;  5L99 A;  4UYG A;  2G4A A;  4NR6 A;  4ZW1 A;  5DBM A;  3UVD A;  5H85 A;  4A9K A;  4YBT A;  5EWV A;  3ZYU A;  4CUU A;  5LVQ A;  3U5P A;  5KTX A;  4BW3 A;  2DVQ A;  5CPE A;  4IR5 A;  5CUE A;  5FFY A;  3D7C A;  4TZ2 A;  4HXL A;  5HFR A;  4NUC A;  2D9E A;  4OGI A;  5E3G A;  1N72 A;  4TQN A;  5LJ2 A;  3O33 A;  4UIY A;  5A7C A;  4NS5 A;  5FH8 A;  5F25 A;  4CFL A;  4QYL A;  4NUE A;  5CQ6 A;  5EPB A;  2RO1 A;  2RNX A;  5KTW A;  5DX4 A;  4NRA A;  3MXF A;  4XY9 A;  5FH6 A;  1EQF A;  5I40 A;  3IU5 A;  4NR7 A;  4Z1S A;  4QUT A;  5IGL A;  5HRX A;  5E73 A;  2FSA A;  5F62 A;  3MB4 A;  5EWC A;  4BW4 A;  5FE8 A;  5CQ3 A;  2RNW A;  3P1F A;  5CRZ A;  5DLZ A;  5KU3 A;  1WUM A;  2KTB B;  3HMH A;  4HXS A;  5DW1 A;  4N4H A;  4QSU A;  4CLB A;  4J3I A;  5FFW A;  4UIZ A;  4QR3 A;  3U5L A;  4CUR A;  5D3T A;  4QBM A;  2DVV A;  2YW5 A;  4YYG A;  3Q2E A;  3IU6 A;  3JVK A;  5E9V A;  5I86 A;  5LKU A;  2EJN A;  5F60 A;  5FE7 A;  3P5O A;  4PCE A;  5HQ7 A;  2GRC A;  5DKH A;  5IG6 A;  3SVG A;  2E7O A;  5FE2 A;  4ALG A;  4NQM A;  4TZ8 A;  3HMF A;  5HQ5 A;  5CUC A;  1ZKR A;  4XUA A;  5L97 A;  5E9L A;  5I88 A;  2L5E A;  3QZV A;  3DAI A;  4HXP A;  5H1T A;  2RNY A;  5AME A;  5EP7 A;  5ETB A;  4YYD A;  3VKG A;  5DYC A;  5D25 A;  4J1P A;  3U5O A;  4NR5 A;  3P1D A;  4LDF A;  4N4F A;  3RCW A;  4UYF A;  4TU4 A;  4LYI A;  4LRG A;  5CP5 A;  2R10 A;  5FB0 A;  4ZC9 A;  4UYD A;  4A9M A;  5D7X A;  5CQT A;  4UYE A;  5A5P A;  2LSP B;  2OUO A;  4XUB A;  4YYH A;  3LXJ A;  4OGJ A;  4NR4 A;  4QNS A;  5AMF A;  4YAT A;  5CZG A;  5BT3 A;  5A81 A;  3MQM A;  4J0S A;  3LQJ A;  1WUG A;  5ENF A;  5DYA A;  5HFQ A;  5CFW A;  4QEU A;  2RFJ A;  5DFC A;  5E9M A;  3P1C A;  5CUG A;  3LJW A;  4UIT A;  4UIW A;  3JVM A;  5BT5 A;  4N4I A;  5EPR A;  5FG5 A;  2YQD A;  4QZS A;  3ONI A;  2YDW A;  4WHW A;  4NR8 A;  4CUQ A;  5ENE A;  3UW9 A;  5JI8 A;  4E96 A;  4AKH A;  4TS8 A;  4QB3 A;  4A9H A;  4WHU A;  5EGU A;  5F61 A;  4LYS A;  5CQ7 A;  5DKC A;  4QSS A;  4LC2 A;  3U5M A;  5HM0 A;  4YBS A;  4UYF B;  5FE0 A;  3TLP A;  5HRV A;  5HEL A;  4IOQ A;  4HBX A;  5A5R A;  4LZS A;  3D1D A;  5F5Z A;  5CS8 A;  4GPJ A;  4O76 A;  5ENG A;  5EV9 A;  2WP2 A;  4MR5 A;  5D3L A;  4J0R A;  5DW2 A;  4BW1 A;  5A83 A;  5FE3 A;  4CUP A;  5FE1 A;  5EIS A;  5H1U A; 
#chains in the Genus database with same CATH homology
 4Q0N A;  3FKM X;  5IGK A;  5LKZ A;  4Z6I A;  5ETD A;  2MJV B;  4A9E A;  4WIV A;  4LZR A;  4AKN A;  3O35 A;  5IBN A;  5CQ5 A;  5FE4 A;  2I7K A;  4IR6 A;  4BJX A;  4UIV A;  5E7D A;  5K29 A;  4YAB A;  3NXB A;  4Z93 A;  4PS5 A;  4TT4 A;  5I1Q A;  3JVL A;  4YYJ A;  4A9O A;  2DVR A;  4O77 A;  4PCI A;  4HXN A;  5BT4 A;  5HRW A;  5E74 A;  5D3H A;  4KCX A;  5EK9 A;  5FE5 A;  4O71 A;  4O7A A;  1ZS5 A;  3O36 A;  2YEL A;  3UVY A;  5D3R A;  5I29 A;  4MEO A;  4DON A;  5EWH A;  4NUD A;  5CUA A;  2I8N A;  3U5J A;  3G0J A;  5DYX A;  4UIX A;  5II2 A;  5CUB A;  3MUL A;  5FE9 A;  5FFV A;  5CRM A;  5DLX A;  3QZT A;  3UVX A;  5FDZ A;  4QY4 A;  3G0L A;  3S91 A;  2OSS A;  1JSP B;  4MR3 A;  5IGN A;  5CGP A;  5FG6 A;  2YEM A;  4UIU A;  4A9L A;  5EPS A;  4N3W A;  5ENJ A;  3I3J A;  5FG4 A;  4C67 A;  4O74 A;  4XY8 A;  4YAD A;  3DWY A;  5LUU A;  2YYN A;  4IOO A;  5HEM A;  5CQ4 A;  4IOR A;  5F63 A;  5E3D A;  5HJC A;  3K2J A;  3GG3 A;  5E9I A;  5EIC A;  3O34 A;  4Y03 A;  4O7C A;  5F1L A;  4YC9 A;  5I83 A;  5AD2 A;  5I7Y A;  4YK0 A;  4Z6H A;  5LVR A;  2L84 A;  5HQ6 A;  4ALH A;  3S92 A;  1JM4 B;  5EA1 A;  5F36 A;  5COI A;  5A5S A;  4HXM A;  4O75 A;  2NXB A;  5KO4 A;  3O37 A;  5L98 A;  5A82 A;  5I7X A;  5D0C A;  4C66 A;  2R0S A;  4CUS A;  4OUF A;  2L85 A;  4TTE A;  4O7F A;  4CL9 A;  5L8T A;  5A85 A;  5LJ1 A;  4HBY A;  5C7N A;  4QUU A;  2F6N A;  1E6I A;  4YYM A;  4QYD A;  3SVF A;  5D3S A;  4NYW A;  5D24 A;  3LQI A;  5L96 A;  5EWW A;  4KV4 A;  2DAT A;  4MEP A;  4QC1 A;  4QEW A;  4TT2 A;  5L8U A;  4O78 A;  2E7N A;  3JVJ A;  5ENH A;  5EQ1 A;  5LKX A;  5EM3 A;  4YYK A;  5C8G A;  5E9K A;  5DFD A;  5CY9 A;  5TCM A;  4QSR A;  5A5O A;  3MB3 A;  1X0J A;  2R0Y A;  4A9J A;  4YY4 A;  5E9Y A;  5FH7 A;  4QSX A;  4KV1 A;  4MEQ A;  4QEV A;  4CUT A;  5C89 A;  2F6J A;  4N4G A;  4A9F A;  5HLS A;  4NR9 A;  5G4S A;  3LQH A;  4YY6 A;  5DKD A;  2R0V A;  4A9N A;  5F3A A;  5JWM A;  3P1E A;  4MR4 A;  4Q0O A;  3U5N A;  5IGM A;  4LYW A;  4TU6 A;  4X2I A;  5C4Q A;  4O70 A;  2RI7 A;  4UYH A;  4TT6 A;  4BHW A;  2YEK A;  5A5N A;  4QSW A;  3UVW A;  3MUK A;  5H1V A;  4PTB A;  4CFK A;  4O7E A;  4PKL A;  5KHM A;  5II1 A;  2OO1 A;  5J0D A;  4QC3 A;  2DWW A;  4IR4 A;  4MR6 A;  4O72 A;  5E0R A;  5HEN A;  4HXR A;  5EU1 A;  5FB1 A;  5FBX A;  2H60 A;  4NQN A;  5IID A;  4XYA A;  4YAX A;  2E3K A;  4HBW A;  4HBV A;  4LZ2 A;  3UV2 A;  4PY6 A;  4YYI A;  5ACY A;  5EWD A;  5DFB A;  4NRB A;  3SVH A;  3U5K A;  4O7B A;  4QSP A;  5D3N A;  5EI4 A;  2DVS A;  2DKW A;  5KTU A;  4LR6 A;  4YH3 A;  5DY7 A;  3Q2F A;  4QST A;  5F2P A;  4YBM A;  3UV5 A;  5LKT A;  5CQ8 A;  2WP1 A;  4BW2 A;  1F68 A;  5I89 A;  5CUD A;  4ZQL A;  3HME A;  4YYN A;  4FLP A;  5HCL A;  5TB6 A;  5AD3 A;  5CQA A;  4NXJ A;  4F3I A;  4QR4 A;  5C85 A;  5D3J A;  5EVA A;  4RVR A;  5ENB A;  5CU8 A;  4MEN A;  3QZS A;  2RS9 B;  5D26 A;  5F1H A;  4QR5 A;  5I80 A;  5A5Q A;  3AAD A;  4Z1Q A;  4QSV A;  4QSQ A;  5CTL A;  5ENC A;  5LJ0 A;  4HXO A;  5D3P A;  4A9I A;  4HXK A;  5C87 A;  2N9G A;  4NYV A;  4YH4 A;  5G4R A;  3UV4 A;  4NRC A;  4NYX A;  5DYU A;  4IR3 A;  5FE6 A;  2D82 A;  4TYL A;  5ENI A;  3AQA A;  5L99 A;  4UYG A;  2G4A A;  4NR6 A;  4ZW1 A;  5DBM A;  3UVD A;  5H85 A;  4A9K A;  4YBT A;  5EWV A;  3ZYU A;  4CUU A;  5LVQ A;  3U5P A;  5KTX A;  4BW3 A;  2DVQ A;  5CPE A;  4IR5 A;  5CUE A;  5FFY A;  3D7C A;  4TZ2 A;  4HXL A;  5HFR A;  4NUC A;  2D9E A;  4OGI A;  5E3G A;  1N72 A;  4TQN A;  5LJ2 A;  3O33 A;  4UIY A;  5A7C A;  4NS5 A;  5FH8 A;  5F25 A;  4CFL A;  4QYL A;  4NUE A;  5CQ6 A;  5EPB A;  2RO1 A;  2RNX A;  5KTW A;  5DX4 A;  4NRA A;  3MXF A;  4XY9 A;  5FH6 A;  1EQF A;  5I40 A;  3IU5 A;  4NR7 A;  4Z1S A;  4QUT A;  5IGL A;  5HRX A;  5E73 A;  2FSA A;  5F62 A;  3MB4 A;  5EWC A;  4BW4 A;  5FE8 A;  5CQ3 A;  2RNW A;  3P1F A;  5CRZ A;  5DLZ A;  5KU3 A;  1WUM A;  2KTB B;  3HMH A;  4HXS A;  5DW1 A;  4N4H A;  4QSU A;  4CLB A;  4J3I A;  5FFW A;  4UIZ A;  4QR3 A;  3U5L A;  4CUR A;  5D3T A;  4QBM A;  2DVV A;  2YW5 A;  4YYG A;  3Q2E A;  3IU6 A;  3JVK A;  5E9V A;  5I86 A;  5LKU A;  5F60 A;  5FE7 A;  3P5O A;  4PCE A;  5HQ7 A;  2GRC A;  5DKH A;  5IG6 A;  3SVG A;  2E7O A;  5FE2 A;  4ALG A;  4NQM A;  4TZ8 A;  3HMF A;  5HQ5 A;  5CUC A;  4XUA A;  5L97 A;  5E9L A;  5I88 A;  2L5E A;  3QZV A;  3DAI A;  4HXP A;  5H1T A;  2RNY A;  5AME A;  5EP7 A;  5ETB A;  4YYD A;  5DYC A;  5D25 A;  4J1P A;  3U5O A;  4NR5 A;  3P1D A;  4LDF A;  4N4F A;  3RCW A;  4UYF A;  4TU4 A;  4LYI A;  4LRG A;  5CP5 A;  2R10 A;  5FB0 A;  4ZC9 A;  4UYD A;  4A9M A;  5D7X A;  5CQT A;  4UYE A;  5A5P A;  2LSP B;  2OUO A;  4XUB A;  4YYH A;  3LXJ A;  4OGJ A;  4NR4 A;  4QNS A;  5AMF A;  4YAT A;  5CZG A;  5BT3 A;  5A81 A;  3MQM A;  4J0S A;  3LQJ A;  1WUG A;  5ENF A;  5DYA A;  5HFQ A;  5CFW A;  4QEU A;  2RFJ A;  5DFC A;  5E9M A;  3P1C A;  5CUG A;  3LJW A;  4UIT A;  4UIW A;  3JVM A;  5BT5 A;  4N4I A;  5EPR A;  5FG5 A;  2YQD A;  4QZS A;  3ONI A;  2YDW A;  4WHW A;  4NR8 A;  4CUQ A;  5ENE A;  3UW9 A;  5JI8 A;  4E96 A;  4TS8 A;  4QB3 A;  4A9H A;  4WHU A;  5EGU A;  5F61 A;  4LYS A;  5CQ7 A;  5DKC A;  4QSS A;  4LC2 A;  3U5M A;  5HM0 A;  4YBS A;  4UYF B;  5FE0 A;  3TLP A;  5HRV A;  5HEL A;  4IOQ A;  4HBX A;  5A5R A;  4LZS A;  5F5Z A;  5CS8 A;  4GPJ A;  4O76 A;  5ENG A;  5EV9 A;  2WP2 A;  4MR5 A;  5D3L A;  4J0R A;  5DW2 A;  4BW1 A;  5A83 A;  5FE3 A;  4CUP A;  5FE1 A;  5EIS A;  5H1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...