4QSRA

Structure of the bromodomain of human atpase family aaa domain-containing protein 2 (atad2) with bound mpd
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Structure-based approaches towards identification of fragments for the low-druggability ATAD2 bromodomain
doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qsrA00
4NUDA 4UYFB 2D9EA 4NR8A 2DVQA 4UIVA 3LQJA 5K29A 2F6JA 4IOQA 3JVJA 4BW1A 4C67A 5FE6A 5HQ5A 3AQAA 5C4QA 4QR3A 4TTEA 4O74A 5FE0A 4Z93A 4O7CA 5LUUA 2NXBA 4QSQA 4YH4A 5LKXA 5CPEA 2H60A 4HBYA 5A81A 5FG6A 4ZW1A 3IU6A 5CQAA 1N72A 4QSXA 5CUGA 5F1HA 3QZTA 5D25A 4HXNA 5CU8A 5F61A 5E9VA 5D3HA 5DFCA 5L98A 5ENBA 4NRAA 5E7DA 4QEVA 5A83A 2DVSA 3O34A 5BT5A 4YH3A 4YBMA 5ENCA 5TB6A 5DYUA 2N9GA 4NR6A 4E96A 3LXJA 4Z6IA 4PY6A 1EQFA 2YEKA 2FSAA 5KU3A 4O78A 5EPBA 2L5EA 3MQMA 2RNXA 4YK0A 4HXMA 5F3AA 2YELA 5HELA 5CQ3A 4NXJA 5FFWA 4YYMA 3SVGA 4BW3A 4CUPA 3S91A 5H1VA 4NS5A 4LZSA 5EM3A 5A5SA 4QBMA 3MB4A 5EPRA 5D3JA 4UIWA 5DKDA 4YAXA 3I3JA 2YEMA 4CUTA 4QC3A 4YY4A 3AADA 4NUCA 4LZRA 5LJ2A 5ENIA 4HXSA 5E3GA 5FH7A 3ONIA 4O71A 5CZGA 4YADA 5D24A 5DFDA 4LR6A 5EWCA 3TLPA 3Q2FA 4UYFA 4LYSA 5E9KA 5EK9A 4BHWA 4IOOA 5FE8A 5FH8A 5CQTA 4NRCA 5LKTA 5A85A 4O72A 5I86A 4TT4A 5FDZA 5FE7A 3NXBA 5DW1A 4LC2A 2YW5A 5D0CA 5CGPA 5HCLA 5L8UA 5C7NA 4QSUA 5HM0A 4MR5A 4UIZA 4QR5A 5LVQA 4QZSA 5F2PA 5HFRA 3JVLA 5CQ4A 3S92A 4QC1A 4N3WA 4LZ2A 4YYGA 4QY4A 4QSWA 5CS8A 4O76A 5FB0A 5HQ7A 4DONA 5FE5A 4ALGA 4O7FA 1X0JA 5E9LA 5DW2A 2RFJA 5F62A 4XY8A 4HXLA 4O7EA 5ENHA 5BT4A 1JM4B 5D3PA 2F6NA 5E9MA 3UVDA 5AMEA 5E74A 5CTLA 3QZSA 4IR6A 5FE4A 5D3NA 5ENEA 3P5OA 4LYWA 4YC9A 5FFYA 3O35A 5LKZA 3UV4A 3GG3A 5D7XA 5F25A 4GPJA 4QSVA 4A9OA 5EWHA 4QUUA 4CFLA 4PCEA 3LJWA 4CURA 3UVYA 4MEPA 4QSTA 3UV5A 4YYNA 4XUAA 5FB1A 4HXRA 4YY6A 5EWDA 5I83A 3O37A 4BW4A 3UW9A 5DBMA 4TQNA 1ZS5A 3MULA 4N4HA 4YYKA 5LJ1A 3U5JA 5D3SA 5A7CA 4TT2A 3MUKA 3IU5A 4UYDA 2E3KA 4YBTA 4NQNA 4YYDA 4QEWA 5DYCA 5F63A 5C87A 5C8GA 5DY7A 5II1A 5ENGA 5C89A 2KTBB 4C66A 5JI8A 4NUEA 5CP5A 5HEMA 2R10A 3QZVA 4O77A 4TZ8A 5EU1A 3U5PA 5FG5A 3SVFA 5LJ0A 2WP1A 5FH6A 2RNYA 5E73A 3P1EA 4QNSA 3D7CA 4KV1A 4MENA 5DKHA 5HRWA 5L96A 5A5PA 3P1DA 5F5ZA 4NRBA 5H1UA 5HRXA 2DKWA 4NYVA 5A82A 4N4GA 3DAIA 5FG4A 4NR4A 5IGNA 5CUAA 3UV2A 4WHUA 3O36A 4TS8A 5EGUA 5A5OA 4FLPA 5L97A 5D3TA 5HFQA 2DWWA 2I8NA 4O7BA 4CLBA 5LVRA 5COIA 5KO4A 4ZQLA 2RNWA 4QSSA 5C85A 5DYXA 5CQ6A 4XYAA 2YQDA 3JVKA 4HBXA 5CUBA 5EICA 4UYHA 5CRZA 5LKUA 4PS5A 3MB3A 4NYXA 4N4FA 4QYLA 4IR5A 4O70A 4Q0NA 4YATA 4XY9A 4TU6A 4CFKA 2RI7A 4TT6A 5EQ1A 2OO1A 5BT3A 4IR3A 4A9IA 5IGMA 5FFVA 5IIDA 2RO1A 4BW2A 5I7XA 5EWVA 3P1CA 5HRVA 3U5OA 2OUOA 2I7KA 5D3LA 4KV4A 4OGIA 4QSPA 5I80A 4MEQA 4NYWA 4UIYA 5I29A 4WIVA 5DLZA 4O75A 5EA1A 4IORA 5H85A 2DVRA 5DKCA 5FE1A 5L99A 3LQHA 5IGKA 3G0JA 5F36A 4QEUA 5G4RA 5E3DA 4NR5A 4O7AA 5F60A 5J0DA 3JVMA 4TU4A 5H1TA 1WUGA 5ETDA 5AMFA 3LQIA 4HXPA 5KTWA 4Z1QA 3HMEA 5IGLA 4WHWA 4IR4A 4RVRA 4CUQA 5HQ6A 5IBNA 3UVXA 4HXOA 4X2IA 5HJCA 3RCWA 5ENFA 3FKMX 3UVWA 5E0RA 3U5LA 4KCXA 4MEOA 4MR3A 2E7OA 5I7YA 5EV9A 5CUCA 4QUTA 2G4AA 5CY9A 4PTBA 5FE9A 4J0RA 4ALHA 2R0SA 2WP2A 2LSPB 4J3IA 4NR7A 4OUFA 4TYLA 5EVAA 4A9EA 4Z6HA 2D82A 3O33A 5D3RA 5A5RA 2YYNA 5CRMA 3U5NA 4MR6A 3HMFA 5CQ5A 4LRGA 5A5NA 2OSSA 4NR9A 4J1PA 4UIXA 3U5MA 3ZYUA 4CUUA 4UIUA 5E9IA 5L8TA 3SVHA 5HENA 3Q2EA 4UYGA 2R0VA 4N4IA 4NQMA 5I89A 2DATA 4Z1SA 4BJXA 5JWMA 5CQ8A 5ENJA 5EWWA 1JSPB 4A9FA 3G0LA 4Q0OA 4ZC9A 5EISA 5KTXA 3U5KA 5FE2A 4XUBA 4AKNA 2L85A 2MJVB 4A9HA 5FE3A 5DLXA 4F3IA 5A5QA 4PCIA 5IG6A 5I1QA 3HMHA 5I88A 4HXKA 4YYHA 5EPSA 3DWYA 5CFWA 4OGJA 4PKLA 5KTUA 5DX4A 2E7NA 1WUMA 4HBVA 5CUEA 5DYAA 4A9KA 4A9NA 4J0SA 5EP7A 5F1LA 4HBWA 5ACYA 1F68A 5FBXA 3P1FA 4QYDA 4A9JA 5DFBA 5II2A 5KHMA 2GRCA 4MR4A 4TZ2A 4YBSA 4CL9A 2YDWA 4QR4A 2R0YA 3MXFA 4QSRA 4YABA 4UYEA 5CUDA 4CUSA 5D26A 5EI4A 2RS9B 4QB3A 2L84A 5AD3A 3K2JA 5G4SA 4LDFA 4LYIA 4YYJA 1E6IA 5E9YA 4A9LA 4YYIA 4A9MA 5ETBA 5TCMA 4UITA 2DVVA 5I40A 4Y03A 5AD2A 5CQ7A 5HLSA
chains in the Genus database with same CATH superfamily
4NUDA 4UYFB 2D9EA 4NR8A 2DVQA 4UIVA 3D1BA 3LQJA 5K29A 2F6JA 4IOQA 3JVJA 4BW1A 4C67A 5FE6A 5HQ5A 3AQAA 5C4QA 4QR3A 4TTEA 4O74A 5FE0A 4Z93A 4O7CA 5LUUA 2NXBA 4QSQA 4YH4A 5LKXA 5CPEA 2H60A 4HBYA 5A81A 5FG6A 4ZW1A 3IU6A 5CQAA 1N72A 4QSXA 5CUGA 5F1HA 3QZTA 5D25A 4HXNA 5CU8A 5F61A 5E9VA 5D3HA 5DFCA 5L98A 4AKGA 5ENBA 4NRAA 5E7DA 4QEVA 5A83A 2DVSA 3O34A 5BT5A 4YH3A 4YBMA 5ENCA 5TB6A 5DYUA 2N9GA 4NR6A 4E96A 3LXJA 4Z6IA 4PY6A 1EQFA 2YEKA 2FSAA 5KU3A 4O78A 5EPBA 2L5EA 3MQMA 2RNXA 4YK0A 4HXMA 5F3AA 2YELA 5HELA 5CQ3A 4NXJA 5FFWA 4YYMA 3SVGA 4BW3A 4CUPA 3S91A 5H1VA 4NS5A 4LZSA 5EM3A 5A5SA 4QBMA 3MB4A 5EPRA 5D3JA 4UIWA 5DKDA 4YAXA 3I3JA 2YEMA 4CUTA 4QC3A 4YY4A 3AADA 4NUCA 4LZRA 5LJ2A 5ENIA 4HXSA 5E3GA 5FH7A 3ONIA 4O71A 5CZGA 4YADA 5D24A 5DFDA 4LR6A 5EWCA 3TLPA 3Q2FA 4UYFA 4LYSA 5E9KA 5EK9A 4BHWA 4IOOA 5FE8A 5FH8A 5CQTA 4NRCA 5LKTA 5A85A 4O72A 5I86A 4TT4A 5FDZA 5FE7A 3NXBA 5DW1A 4LC2A 2YW5A 5D0CA 5CGPA 5HCLA 5L8UA 5C7NA 4QSUA 5HM0A 4MR5A 4UIZA 4QR5A 5LVQA 4QZSA 5F2PA 5HFRA 3JVLA 5CQ4A 3S92A 4QC1A 4N3WA 4LZ2A 4YYGA 4QY4A 4QSWA 5CS8A 4O76A 5FB0A 5HQ7A 4DONA 5FE5A 4ALGA 4O7FA 1X0JA 5E9LA 5DW2A 2RFJA 5F62A 4XY8A 4HXLA 4O7EA 5ENHA 5BT4A 1JM4B 5D3PA 2F6NA 5E9MA 3UVDA 5AMEA 5E74A 5CTLA 3QZSA 4IR6A 5FE4A 5D3NA 5ENEA 3P5OA 4LYWA 4YC9A 5FFYA 3O35A 5LKZA 3UV4A 3GG3A 5D7XA 5F25A 4GPJA 4QSVA 4A9OA 5EWHA 4QUUA 4CFLA 4PCEA 3LJWA 4CURA 3UVYA 4MEPA 4QSTA 3UV5A 4YYNA 4XUAA 5FB1A 4HXRA 4AKHA 4YY6A 5EWDA 5I83A 3O37A 4BW4A 3UW9A 5DBMA 4TQNA 1ZS5A 3MULA 4N4HA 4YYKA 5LJ1A 3U5JA 5D3SA 4AKIA 5A7CA 4TT2A 3MUKA 3IU5A 4UYDA 2E3KA 4YBTA 4NQNA 4YYDA 2EJNA 4QEWA 5DYCA 3ERRA 5F63A 5C87A 5C8GA 5DY7A 5II1A 5ENGA 5C89A 2KTBB 4C66A 5JI8A 4NUEA 5CP5A 5HEMA 2R10A 3QZVA 4O77A 4TZ8A 5EU1A 3U5PA 5FG5A 3SVFA 5LJ0A 2WP1A 5FH6A 2RNYA 5E73A 3P1EA 4QNSA 3D7CA 4KV1A 4MENA 5DKHA 5HRWA 5L96A 5A5PA 3P1DA 5F5ZA 4NRBA 5H1UA 5HRXA 2DKWA 4NYVA 5A82A 4N4GA 3DAIA 5FG4A 4NR4A 5IGNA 5CUAA 3UV2A 4WHUA 3O36A 4TS8A 5EGUA 5A5OA 4FLPA 5L97A 3VKGA 5D3TA 5HFQA 2DWWA 2I8NA 4O7BA 4CLBA 5LVRA 5COIA 5KO4A 4ZQLA 2RNWA 1PUOA 4QSSA 5C85A 5DYXA 5CQ6A 4XYAA 2YQDA 3JVKA 4HBXA 5CUBA 5EICA 4UYHA 5CRZA 5LKUA 4PS5A 3MB3A 4NYXA 4N4FA 4QYLA 4IR5A 4O70A 4Q0NA 4YATA 4XY9A 4TU6A 4CFKA 2RI7A 4TT6A 5EQ1A 2OO1A 3D1DA 5BT3A 4IR3A 4A9IA 5IGMA 5FFVA 5IIDA 2RO1A 4BW2A 5I7XA 5EWVA 3P1CA 5HRVA 3U5OA 2OUOA 2I7KA 5D3LA 4KV4A 4OGIA 4QSPA 5I80A 4MEQA 4NYWA 4UIYA 5I29A 4WIVA 5DLZA 4O75A 5EA1A 4IORA 5H85A 2DVRA 5DKCA 5FE1A 5L99A 3LQHA 5IGKA 3G0JA 5F36A 4QEUA 5G4RA 5E3DA 4NR5A 4O7AA 5F60A 5J0DA 3JVMA 4TU4A 5H1TA 1WUGA 5ETDA 5AMFA 3LQIA 4HXPA 5KTWA 4Z1QA 3HMEA 5IGLA 4WHWA 4IR4A 4RVRA 4CUQA 5HQ6A 5IBNA 3UVXA 4HXOA 4X2IA 5HJCA 3RCWA 5ENFA 3FKMX 3UVWA 5E0RA 3U5LA 4KCXA 4MEOA 4MR3A 2E7OA 5I7YA 5EV9A 5CUCA 4QUTA 2G4AA 5CY9A 4PTBA 5FE9A 4J0RA 4ALHA 2R0SA 2WP2A 2LSPB 4J3IA 4NR7A 4OUFA 4TYLA 5EVAA 4A9EA 4Z6HA 2D82A 3O33A 5D3RA 5A5RA 2YYNA 5CRMA 3U5NA 4MR6A 3HMFA 5CQ5A 4LRGA 5A5NA 2OSSA 4NR9A 4J1PA 4UIXA 3U5MA 3ZYUA 4CUUA 4UIUA 5E9IA 5L8TA 3SVHA 5HENA 3Q2EA 4UYGA 2R0VA 4N4IA 4NQMA 5I89A 2DATA 4Z1SA 4BJXA 5JWMA 5CQ8A 5ENJA 5EWWA 1JSPB 4A9FA 3G0LA 4Q0OA 4ZC9A 5EISA 5KTXA 3U5KA 5FE2A 4XUBA 4AKNA 2L85A 2MJVB 4A9HA 5FE3A 3VKHA 5DLXA 4F3IA 5A5QA 4PCIA 5IG6A 5I1QA 3HMHA 5I88A 4HXKA 4YYHA 5EPSA 3DWYA 5CFWA 4OGJA 4PKLA 5KTUA 5DX4A 2E7NA 1ZKRA 1WUMA 4HBVA 5CUEA 5DYAA 4A9KA 4A9NA 4J0SA 5EP7A 5F1LA 4HBWA 5ACYA 1F68A 5FBXA 3P1FA 4QYDA 4A9JA 5DFBA 5II2A 5KHMA 2GRCA 4MR4A 4TZ2A 4YBSA 4CL9A 2YDWA 4QR4A 2R0YA 3MXFA 4QSRA 4YABA 4UYEA 5CUDA 4CUSA 5D26A 5EI4A 2RS9B 4QB3A 2L84A 5AD3A 3K2JA 5G4SA 4LDFA 4LYIA 4YYJA 1E6IA 5E9YA 4A9LA 4YYIA 4AI6A 4A9MA 5ETBA 5TCMA 4UITA 2DVVA 5I40A 4Y03A 5AD2A 5CQ7A 5HLSA
chains in the Genus database with same CATH topology
4NUDA 4UYFB 2D9EA 4NR8A 2DVQA 4UIVA 3LQJA 5K29A 2F6JA 4IOQA 3JVJA 4BW1A 4C67A 5FE6A 5HQ5A 3AQAA 5C4QA 4QR3A 4TTEA 4O74A 5FE0A 4Z93A 4O7CA 5LUUA 2NXBA 4QSQA 4YH4A 5LKXA 5CPEA 2H60A 4HBYA 5A81A 5FG6A 4ZW1A 3IU6A 5CQAA 1N72A 4QSXA 5CUGA 5F1HA 3QZTA 5D25A 4HXNA 5CU8A 5F61A 5E9VA 5D3HA 5DFCA 5L98A 5ENBA 4NRAA 5E7DA 4QEVA 5A83A 2DVSA 3O34A 5BT5A 4YH3A 4YBMA 5ENCA 5TB6A 5DYUA 2N9GA 4NR6A 4E96A 3LXJA 4Z6IA 4PY6A 1EQFA 2YEKA 2FSAA 5KU3A 4O78A 5EPBA 2L5EA 3MQMA 2RNXA 4YK0A 4HXMA 5F3AA 2YELA 5HELA 5CQ3A 4NXJA 5FFWA 4YYMA 3SVGA 4BW3A 4CUPA 3S91A 5H1VA 4NS5A 4LZSA 5EM3A 5A5SA 4QBMA 3MB4A 5EPRA 5D3JA 4UIWA 5DKDA 4YAXA 3I3JA 2YEMA 4CUTA 4QC3A 4YY4A 3AADA 4NUCA 4LZRA 5LJ2A 5ENIA 4HXSA 5E3GA 5FH7A 3ONIA 4O71A 5CZGA 4YADA 5D24A 5DFDA 4LR6A 5EWCA 3TLPA 3Q2FA 4UYFA 4LYSA 5E9KA 5EK9A 4BHWA 4IOOA 5FE8A 5FH8A 5CQTA 4NRCA 5LKTA 5A85A 4O72A 5I86A 4TT4A 5FDZA 5FE7A 3NXBA 5DW1A 4LC2A 2YW5A 5D0CA 5CGPA 5HCLA 5L8UA 5C7NA 4QSUA 5HM0A 4MR5A 4UIZA 4QR5A 5LVQA 4QZSA 5F2PA 5HFRA 3JVLA 5CQ4A 3S92A 4QC1A 4N3WA 4LZ2A 4YYGA 4QY4A 4QSWA 5CS8A 4O76A 5FB0A 5HQ7A 4DONA 5FE5A 4ALGA 4O7FA 1X0JA 5E9LA 5DW2A 2RFJA 5F62A 4XY8A 4HXLA 4O7EA 5ENHA 5BT4A 1JM4B 5D3PA 2F6NA 5E9MA 3UVDA 5AMEA 5E74A 5CTLA 3QZSA 4IR6A 5FE4A 5D3NA 5ENEA 3P5OA 4LYWA 4YC9A 5FFYA 3O35A 5LKZA 3UV4A 3GG3A 5D7XA 5F25A 4GPJA 4QSVA 4A9OA 5EWHA 4QUUA 4CFLA 4PCEA 3LJWA 4CURA 3UVYA 4MEPA 4QSTA 3UV5A 4YYNA 4XUAA 5FB1A 4HXRA 4YY6A 5EWDA 5I83A 3O37A 4BW4A 3UW9A 5DBMA 4TQNA 1ZS5A 3MULA 4N4HA 4YYKA 5LJ1A 3U5JA 5D3SA 5A7CA 4TT2A 3MUKA 3IU5A 4UYDA 2E3KA 4YBTA 4NQNA 4YYDA 4QEWA 5DYCA 5F63A 5C87A 5C8GA 5DY7A 5II1A 5ENGA 5C89A 2KTBB 4C66A 5JI8A 4NUEA 5CP5A 5HEMA 2R10A 3QZVA 4O77A 4TZ8A 5EU1A 3U5PA 5FG5A 3SVFA 5LJ0A 2WP1A 5FH6A 2RNYA 5E73A 3P1EA 4QNSA 3D7CA 4KV1A 4MENA 5DKHA 5HRWA 5L96A 5A5PA 3P1DA 5F5ZA 4NRBA 5H1UA 5HRXA 2DKWA 4NYVA 5A82A 4N4GA 3DAIA 5FG4A 4NR4A 5IGNA 5CUAA 3UV2A 4WHUA 3O36A 4TS8A 5EGUA 5A5OA 4FLPA 5L97A 5D3TA 5HFQA 2DWWA 2I8NA 4O7BA 4CLBA 5LVRA 5COIA 5KO4A 4ZQLA 2RNWA 4QSSA 5C85A 5DYXA 5CQ6A 4XYAA 2YQDA 3JVKA 4HBXA 5CUBA 5EICA 4UYHA 5CRZA 5LKUA 4PS5A 3MB3A 4NYXA 4N4FA 4QYLA 4IR5A 4O70A 4Q0NA 4YATA 4XY9A 4TU6A 4CFKA 2RI7A 4TT6A 5EQ1A 2OO1A 5BT3A 4IR3A 4A9IA 5IGMA 5FFVA 5IIDA 2RO1A 4BW2A 5I7XA 5EWVA 3P1CA 5HRVA 3U5OA 2OUOA 2I7KA 5D3LA 4KV4A 4OGIA 4QSPA 5I80A 4MEQA 4NYWA 4UIYA 5I29A 4WIVA 5DLZA 4O75A 5EA1A 4IORA 5H85A 2DVRA 5DKCA 5FE1A 5L99A 3LQHA 5IGKA 3G0JA 5F36A 4QEUA 5G4RA 5E3DA 4NR5A 4O7AA 5F60A 5J0DA 3JVMA 4TU4A 5H1TA 1WUGA 5ETDA 5AMFA 3LQIA 4HXPA 5KTWA 4Z1QA 3HMEA 5IGLA 4WHWA 4IR4A 4RVRA 4CUQA 5HQ6A 5IBNA 3UVXA 4HXOA 4X2IA 5HJCA 3RCWA 5ENFA 3FKMX 3UVWA 5E0RA 3U5LA 4KCXA 4MEOA 4MR3A 2E7OA 5I7YA 5EV9A 5CUCA 4QUTA 2G4AA 5CY9A 4PTBA 5FE9A 4J0RA 4ALHA 2R0SA 2WP2A 2LSPB 4J3IA 4NR7A 4OUFA 4TYLA 5EVAA 4A9EA 4Z6HA 2D82A 3O33A 5D3RA 5A5RA 2YYNA 5CRMA 3U5NA 4MR6A 3HMFA 5CQ5A 4LRGA 5A5NA 2OSSA 4NR9A 4J1PA 4UIXA 3U5MA 3ZYUA 4CUUA 4UIUA 5E9IA 5L8TA 3SVHA 5HENA 3Q2EA 4UYGA 2R0VA 4N4IA 4NQMA 5I89A 2DATA 4Z1SA 4BJXA 5JWMA 5CQ8A 5ENJA 5EWWA 1JSPB 4A9FA 3G0LA 4Q0OA 4ZC9A 5EISA 5KTXA 3U5KA 5FE2A 4XUBA 4AKNA 2L85A 2MJVB 4A9HA 5FE3A 5DLXA 4F3IA 5A5QA 4PCIA 5IG6A 5I1QA 3HMHA 5I88A 4HXKA 4YYHA 5EPSA 3DWYA 5CFWA 4OGJA 4PKLA 5KTUA 5DX4A 2E7NA 1WUMA 4HBVA 5CUEA 5DYAA 4A9KA 4A9NA 4J0SA 5EP7A 5F1LA 4HBWA 5ACYA 1F68A 5FBXA 3P1FA 4QYDA 4A9JA 5DFBA 5II2A 5KHMA 2GRCA 4MR4A 4TZ2A 4YBSA 4CL9A 2YDWA 4QR4A 2R0YA 3MXFA 4QSRA 4YABA 4UYEA 5CUDA 4CUSA 5D26A 5EI4A 2RS9B 4QB3A 2L84A 5AD3A 3K2JA 5G4SA 4LDFA 4LYIA 4YYJA 1E6IA 5E9YA 4A9LA 4YYIA 4A9MA 5ETBA 5TCMA 4UITA 2DVVA 5I40A 4Y03A 5AD2A 5CQ7A 5HLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUD A;  4UYF B;  2D9E A;  4NR8 A;  2DVQ A;  4UIV A;  3LQJ A;  5K29 A;  2F6J A;  4IOQ A;  3JVJ A;  4BW1 A;  4C67 A;  5FE6 A;  5HQ5 A;  3AQA A;  5C4Q A;  4QR3 A;  4TTE A;  4O74 A;  5FE0 A;  4Z93 A;  4O7C A;  5LUU A;  2NXB A;  4QSQ A;  4YH4 A;  5LKX A;  5CPE A;  2H60 A;  4HBY A;  5A81 A;  5FG6 A;  4ZW1 A;  3IU6 A;  5CQA A;  1N72 A;  4QSX A;  5CUG A;  5F1H A;  3QZT A;  5D25 A;  4HXN A;  5CU8 A;  5F61 A;  5E9V A;  5D3H A;  5DFC A;  5L98 A;  5ENB A;  4NRA A;  5E7D A;  4QEV A;  5A83 A;  2DVS A;  3O34 A;  5BT5 A;  4YH3 A;  4YBM A;  5ENC A;  5TB6 A;  5DYU A;  2N9G A;  4NR6 A;  4E96 A;  3LXJ A;  4Z6I A;  4PY6 A;  1EQF A;  2YEK A;  2FSA A;  5KU3 A;  4O78 A;  5EPB A;  2L5E A;  3MQM A;  2RNX A;  4YK0 A;  4HXM A;  5F3A A;  2YEL A;  5HEL A;  5CQ3 A;  4NXJ A;  5FFW A;  4YYM A;  3SVG A;  4BW3 A;  4CUP A;  3S91 A;  5H1V A;  4NS5 A;  4LZS A;  5EM3 A;  5A5S A;  4QBM A;  3MB4 A;  5EPR A;  5D3J A;  4UIW A;  5DKD A;  4YAX A;  3I3J A;  2YEM A;  4CUT A;  4QC3 A;  4YY4 A;  3AAD A;  4NUC A;  4LZR A;  5LJ2 A;  5ENI A;  4HXS A;  5E3G A;  5FH7 A;  3ONI A;  4O71 A;  5CZG A;  4YAD A;  5D24 A;  5DFD A;  4LR6 A;  5EWC A;  3TLP A;  3Q2F A;  4UYF A;  4LYS A;  5E9K A;  5EK9 A;  4BHW A;  4IOO A;  5FE8 A;  5FH8 A;  5CQT A;  4NRC A;  5LKT A;  5A85 A;  4O72 A;  5I86 A;  4TT4 A;  5FDZ A;  5FE7 A;  3NXB A;  5DW1 A;  4LC2 A;  2YW5 A;  5D0C A;  5CGP A;  5HCL A;  5L8U A;  5C7N A;  4QSU A;  5HM0 A;  4MR5 A;  4UIZ A;  4QR5 A;  5LVQ A;  4QZS A;  5F2P A;  5HFR A;  3JVL A;  5CQ4 A;  3S92 A;  4QC1 A;  4N3W A;  4LZ2 A;  4YYG A;  4QY4 A;  4QSW A;  5CS8 A;  4O76 A;  5FB0 A;  5HQ7 A;  4DON A;  5FE5 A;  4ALG A;  4O7F A;  1X0J A;  5E9L A;  5DW2 A;  2RFJ A;  5F62 A;  4XY8 A;  4HXL A;  4O7E A;  5ENH A;  5BT4 A;  1JM4 B;  5D3P A;  2F6N A;  5E9M A;  3UVD A;  5AME A;  5E74 A;  5CTL A;  3QZS A;  4IR6 A;  5FE4 A;  5D3N A;  5ENE A;  3P5O A;  4LYW A;  4YC9 A;  5FFY A;  3O35 A;  5LKZ A;  3UV4 A;  3GG3 A;  5D7X A;  5F25 A;  4GPJ A;  4QSV A;  4A9O A;  5EWH A;  4QUU A;  4CFL A;  4PCE A;  3LJW A;  4CUR A;  3UVY A;  4MEP A;  4QST A;  3UV5 A;  4YYN A;  4XUA A;  5FB1 A;  4HXR A;  4YY6 A;  5EWD A;  5I83 A;  3O37 A;  4BW4 A;  3UW9 A;  5DBM A;  4TQN A;  1ZS5 A;  3MUL A;  4N4H A;  4YYK A;  5LJ1 A;  3U5J A;  5D3S A;  5A7C A;  4TT2 A;  3MUK A;  3IU5 A;  4UYD A;  2E3K A;  4YBT A;  4NQN A;  4YYD A;  4QEW A;  5DYC A;  5F63 A;  5C87 A;  5C8G A;  5DY7 A;  5II1 A;  5ENG A;  5C89 A;  2KTB B;  4C66 A;  5JI8 A;  4NUE A;  5CP5 A;  5HEM A;  2R10 A;  3QZV A;  4O77 A;  4TZ8 A;  5EU1 A;  3U5P A;  5FG5 A;  3SVF A;  5LJ0 A;  2WP1 A;  5FH6 A;  2RNY A;  5E73 A;  3P1E A;  4QNS A;  3D7C A;  4KV1 A;  4MEN A;  5DKH A;  5HRW A;  5L96 A;  5A5P A;  3P1D A;  5F5Z A;  4NRB A;  5H1U A;  5HRX A;  2DKW A;  4NYV A;  5A82 A;  4N4G A;  3DAI A;  5FG4 A;  4NR4 A;  5IGN A;  5CUA A;  3UV2 A;  4WHU A;  3O36 A;  4TS8 A;  5EGU A;  5A5O A;  4FLP A;  5L97 A;  5D3T A;  5HFQ A;  2DWW A;  2I8N A;  4O7B A;  4CLB A;  5LVR A;  5COI A;  5KO4 A;  4ZQL A;  2RNW A;  4QSS A;  5C85 A;  5DYX A;  5CQ6 A;  4XYA A;  2YQD A;  3JVK A;  4HBX A;  5CUB A;  5EIC A;  4UYH A;  5CRZ A;  5LKU A;  4PS5 A;  3MB3 A;  4NYX A;  4N4F A;  4QYL A;  4IR5 A;  4O70 A;  4Q0N A;  4YAT A;  4XY9 A;  4TU6 A;  4CFK A;  2RI7 A;  4TT6 A;  5EQ1 A;  2OO1 A;  5BT3 A;  4IR3 A;  4A9I A;  5IGM A;  5FFV A;  5IID A;  2RO1 A;  4BW2 A;  5I7X A;  5EWV A;  3P1C A;  5HRV A;  3U5O A;  2OUO A;  2I7K A;  5D3L A;  4KV4 A;  4OGI A;  4QSP A;  5I80 A;  4MEQ A;  4NYW A;  4UIY A;  5I29 A;  4WIV A;  5DLZ A;  4O75 A;  5EA1 A;  4IOR A;  5H85 A;  2DVR A;  5DKC A;  5FE1 A;  5L99 A;  3LQH A;  5IGK A;  3G0J A;  5F36 A;  4QEU A;  5G4R A;  5E3D A;  4NR5 A;  4O7A A;  5F60 A;  5J0D A;  3JVM A;  4TU4 A;  5H1T A;  1WUG A;  5ETD A;  5AMF A;  3LQI A;  4HXP A;  5KTW A;  4Z1Q A;  3HME A;  5IGL A;  4WHW A;  4IR4 A;  4RVR A;  4CUQ A;  5HQ6 A;  5IBN A;  3UVX A;  4HXO A;  4X2I A;  5HJC A;  3RCW A;  5ENF A;  3FKM X;  3UVW A;  5E0R A;  3U5L A;  4KCX A;  4MEO A;  4MR3 A;  2E7O A;  5I7Y A;  5EV9 A;  5CUC A;  4QUT A;  2G4A A;  5CY9 A;  4PTB A;  5FE9 A;  4J0R A;  4ALH A;  2R0S A;  2WP2 A;  2LSP B;  4J3I A;  4NR7 A;  4OUF A;  4TYL A;  5EVA A;  4A9E A;  4Z6H A;  2D82 A;  3O33 A;  5D3R A;  5A5R A;  2YYN A;  5CRM A;  3U5N A;  4MR6 A;  3HMF A;  5CQ5 A;  4LRG A;  5A5N A;  2OSS A;  4NR9 A;  4J1P A;  4UIX A;  3U5M A;  3ZYU A;  4CUU A;  4UIU A;  5E9I A;  5L8T A;  3SVH A;  5HEN A;  3Q2E A;  4UYG A;  2R0V A;  4N4I A;  4NQM A;  5I89 A;  2DAT A;  4Z1S A;  4BJX A;  5JWM A;  5CQ8 A;  5ENJ A;  5EWW A;  1JSP B;  4A9F A;  3G0L A;  4Q0O A;  4ZC9 A;  5EIS A;  5KTX A;  3U5K A;  5FE2 A;  4XUB A;  4AKN A;  2L85 A;  2MJV B;  4A9H A;  5FE3 A;  5DLX A;  4F3I A;  5A5Q A;  4PCI A;  5IG6 A;  5I1Q A;  3HMH A;  5I88 A;  4HXK A;  4YYH A;  5EPS A;  3DWY A;  5CFW A;  4OGJ A;  4PKL A;  5KTU A;  5DX4 A;  2E7N A;  1WUM A;  4HBV A;  5CUE A;  5DYA A;  4A9K A;  4A9N A;  4J0S A;  5EP7 A;  5F1L A;  4HBW A;  5ACY A;  1F68 A;  5FBX A;  3P1F A;  4QYD A;  4A9J A;  5DFB A;  5II2 A;  5KHM A;  2GRC A;  4MR4 A;  4TZ2 A;  4YBS A;  4CL9 A;  2YDW A;  4QR4 A;  2R0Y A;  3MXF A;  4QSR A;  4YAB A;  4UYE A;  5CUD A;  4CUS A;  5D26 A;  5EI4 A;  2RS9 B;  4QB3 A;  2L84 A;  5AD3 A;  3K2J A;  5G4S A;  4LDF A;  4LYI A;  4YYJ A;  1E6I A;  5E9Y A;  4A9L A;  4YYI A;  4A9M A;  5ETB A;  5TCM A;  4UIT A;  2DVV A;  5I40 A;  4Y03 A;  5AD2 A;  5CQ7 A;  5HLS A; 
#chains in the Genus database with same CATH topology
 4NUD A;  4UYF B;  2D9E A;  4NR8 A;  2DVQ A;  4UIV A;  3D1B A;  3LQJ A;  5K29 A;  2F6J A;  4IOQ A;  3JVJ A;  4BW1 A;  4C67 A;  5FE6 A;  5HQ5 A;  3AQA A;  5C4Q A;  4QR3 A;  4TTE A;  4O74 A;  5FE0 A;  4Z93 A;  4O7C A;  5LUU A;  2NXB A;  4QSQ A;  4YH4 A;  5LKX A;  5CPE A;  2H60 A;  4HBY A;  5A81 A;  5FG6 A;  4ZW1 A;  3IU6 A;  5CQA A;  1N72 A;  4QSX A;  5CUG A;  5F1H A;  3QZT A;  5D25 A;  4HXN A;  5CU8 A;  5F61 A;  5E9V A;  5D3H A;  5DFC A;  5L98 A;  4AKG A;  5ENB A;  4NRA A;  5E7D A;  4QEV A;  5A83 A;  2DVS A;  3O34 A;  5BT5 A;  4YH3 A;  4YBM A;  5ENC A;  5TB6 A;  5DYU A;  2N9G A;  4NR6 A;  4E96 A;  3LXJ A;  4Z6I A;  4PY6 A;  1EQF A;  2YEK A;  2FSA A;  5KU3 A;  4O78 A;  5EPB A;  2L5E A;  3MQM A;  2RNX A;  4YK0 A;  4HXM A;  5F3A A;  2YEL A;  5HEL A;  5CQ3 A;  4NXJ A;  5FFW A;  4YYM A;  3SVG A;  4BW3 A;  4CUP A;  3S91 A;  5H1V A;  4NS5 A;  4LZS A;  5EM3 A;  5A5S A;  4QBM A;  3MB4 A;  5EPR A;  5D3J A;  4UIW A;  5DKD A;  4YAX A;  3I3J A;  2YEM A;  4CUT A;  4QC3 A;  4YY4 A;  3AAD A;  4NUC A;  4LZR A;  5LJ2 A;  5ENI A;  4HXS A;  5E3G A;  5FH7 A;  3ONI A;  4O71 A;  5CZG A;  4YAD A;  5D24 A;  5DFD A;  4LR6 A;  5EWC A;  3TLP A;  3Q2F A;  4UYF A;  4LYS A;  5E9K A;  5EK9 A;  4BHW A;  4IOO A;  5FE8 A;  5FH8 A;  5CQT A;  4NRC A;  5LKT A;  5A85 A;  4O72 A;  5I86 A;  4TT4 A;  5FDZ A;  5FE7 A;  3NXB A;  5DW1 A;  4LC2 A;  2YW5 A;  5D0C A;  5CGP A;  5HCL A;  5L8U A;  5C7N A;  4QSU A;  5HM0 A;  4MR5 A;  4UIZ A;  4QR5 A;  5LVQ A;  4QZS A;  5F2P A;  5HFR A;  3JVL A;  5CQ4 A;  3S92 A;  4QC1 A;  4N3W A;  4LZ2 A;  4YYG A;  4QY4 A;  4QSW A;  5CS8 A;  4O76 A;  5FB0 A;  5HQ7 A;  4DON A;  5FE5 A;  4ALG A;  4O7F A;  1X0J A;  5E9L A;  5DW2 A;  2RFJ A;  5F62 A;  4XY8 A;  4HXL A;  4O7E A;  5ENH A;  5BT4 A;  1JM4 B;  5D3P A;  2F6N A;  5E9M A;  3UVD A;  5AME A;  5E74 A;  5CTL A;  3QZS A;  4IR6 A;  5FE4 A;  5D3N A;  5ENE A;  3P5O A;  4LYW A;  4YC9 A;  5FFY A;  3O35 A;  5LKZ A;  3UV4 A;  3GG3 A;  5D7X A;  5F25 A;  4GPJ A;  4QSV A;  4A9O A;  5EWH A;  4QUU A;  4CFL A;  4PCE A;  3LJW A;  4CUR A;  3UVY A;  4MEP A;  4QST A;  3UV5 A;  4YYN A;  4XUA A;  5FB1 A;  4HXR A;  4AKH A;  4YY6 A;  5EWD A;  5I83 A;  3O37 A;  4BW4 A;  3UW9 A;  5DBM A;  4TQN A;  1ZS5 A;  3MUL A;  4N4H A;  4YYK A;  5LJ1 A;  3U5J A;  5D3S A;  4AKI A;  5A7C A;  4TT2 A;  3MUK A;  3IU5 A;  4UYD A;  2E3K A;  4YBT A;  4NQN A;  4YYD A;  2EJN A;  4QEW A;  5DYC A;  3ERR A;  5F63 A;  5C87 A;  5C8G A;  5DY7 A;  5II1 A;  5ENG A;  5C89 A;  2KTB B;  4C66 A;  5JI8 A;  4NUE A;  5CP5 A;  5HEM A;  2R10 A;  3QZV A;  4O77 A;  4TZ8 A;  5EU1 A;  3U5P A;  5FG5 A;  3SVF A;  5LJ0 A;  2WP1 A;  5FH6 A;  2RNY A;  5E73 A;  3P1E A;  4QNS A;  3D7C A;  4KV1 A;  4MEN A;  5DKH A;  5HRW A;  5L96 A;  5A5P A;  3P1D A;  5F5Z A;  4NRB A;  5H1U A;  5HRX A;  2DKW A;  4NYV A;  5A82 A;  4N4G A;  3DAI A;  5FG4 A;  4NR4 A;  5IGN A;  5CUA A;  3UV2 A;  4WHU A;  3O36 A;  4TS8 A;  5EGU A;  5A5O A;  4FLP A;  5L97 A;  3VKG A;  5D3T A;  5HFQ A;  2DWW A;  2I8N A;  4O7B A;  4CLB A;  5LVR A;  5COI A;  5KO4 A;  4ZQL A;  2RNW A;  1PUO A;  4QSS A;  5C85 A;  5DYX A;  5CQ6 A;  4XYA A;  2YQD A;  3JVK A;  4HBX A;  5CUB A;  5EIC A;  4UYH A;  5CRZ A;  5LKU A;  4PS5 A;  3MB3 A;  4NYX A;  4N4F A;  4QYL A;  4IR5 A;  4O70 A;  4Q0N A;  4YAT A;  4XY9 A;  4TU6 A;  4CFK A;  2RI7 A;  4TT6 A;  5EQ1 A;  2OO1 A;  3D1D A;  5BT3 A;  4IR3 A;  4A9I A;  5IGM A;  5FFV A;  5IID A;  2RO1 A;  4BW2 A;  5I7X A;  5EWV A;  3P1C A;  5HRV A;  3U5O A;  2OUO A;  2I7K A;  5D3L A;  4KV4 A;  4OGI A;  4QSP A;  5I80 A;  4MEQ A;  4NYW A;  4UIY A;  5I29 A;  4WIV A;  5DLZ A;  4O75 A;  5EA1 A;  4IOR A;  5H85 A;  2DVR A;  5DKC A;  5FE1 A;  5L99 A;  3LQH A;  5IGK A;  3G0J A;  5F36 A;  4QEU A;  5G4R A;  5E3D A;  4NR5 A;  4O7A A;  5F60 A;  5J0D A;  3JVM A;  4TU4 A;  5H1T A;  1WUG A;  5ETD A;  5AMF A;  3LQI A;  4HXP A;  5KTW A;  4Z1Q A;  3HME A;  5IGL A;  4WHW A;  4IR4 A;  4RVR A;  4CUQ A;  5HQ6 A;  5IBN A;  3UVX A;  4HXO A;  4X2I A;  5HJC A;  3RCW A;  5ENF A;  3FKM X;  3UVW A;  5E0R A;  3U5L A;  4KCX A;  4MEO A;  4MR3 A;  2E7O A;  5I7Y A;  5EV9 A;  5CUC A;  4QUT A;  2G4A A;  5CY9 A;  4PTB A;  5FE9 A;  4J0R A;  4ALH A;  2R0S A;  2WP2 A;  2LSP B;  4J3I A;  4NR7 A;  4OUF A;  4TYL A;  5EVA A;  4A9E A;  4Z6H A;  2D82 A;  3O33 A;  5D3R A;  5A5R A;  2YYN A;  5CRM A;  3U5N A;  4MR6 A;  3HMF A;  5CQ5 A;  4LRG A;  5A5N A;  2OSS A;  4NR9 A;  4J1P A;  4UIX A;  3U5M A;  3ZYU A;  4CUU A;  4UIU A;  5E9I A;  5L8T A;  3SVH A;  5HEN A;  3Q2E A;  4UYG A;  2R0V A;  4N4I A;  4NQM A;  5I89 A;  2DAT A;  4Z1S A;  4BJX A;  5JWM A;  5CQ8 A;  5ENJ A;  5EWW A;  1JSP B;  4A9F A;  3G0L A;  4Q0O A;  4ZC9 A;  5EIS A;  5KTX A;  3U5K A;  5FE2 A;  4XUB A;  4AKN A;  2L85 A;  2MJV B;  4A9H A;  5FE3 A;  3VKH A;  5DLX A;  4F3I A;  5A5Q A;  4PCI A;  5IG6 A;  5I1Q A;  3HMH A;  5I88 A;  4HXK A;  4YYH A;  5EPS A;  3DWY A;  5CFW A;  4OGJ A;  4PKL A;  5KTU A;  5DX4 A;  2E7N A;  1ZKR A;  1WUM A;  4HBV A;  5CUE A;  5DYA A;  4A9K A;  4A9N A;  4J0S A;  5EP7 A;  5F1L A;  4HBW A;  5ACY A;  1F68 A;  5FBX A;  3P1F A;  4QYD A;  4A9J A;  5DFB A;  5II2 A;  5KHM A;  2GRC A;  4MR4 A;  4TZ2 A;  4YBS A;  4CL9 A;  2YDW A;  4QR4 A;  2R0Y A;  3MXF A;  4QSR A;  4YAB A;  4UYE A;  5CUD A;  4CUS A;  5D26 A;  5EI4 A;  2RS9 B;  4QB3 A;  2L84 A;  5AD3 A;  3K2J A;  5G4S A;  4LDF A;  4LYI A;  4YYJ A;  1E6I A;  5E9Y A;  4A9L A;  4YYI A;  4AI6 A;  4A9M A;  5ETB A;  5TCM A;  4UIT A;  2DVV A;  5I40 A;  4Y03 A;  5AD2 A;  5CQ7 A;  5HLS A; 
#chains in the Genus database with same CATH homology
 4NUD A;  4UYF B;  2D9E A;  4NR8 A;  2DVQ A;  4UIV A;  3LQJ A;  5K29 A;  2F6J A;  4IOQ A;  3JVJ A;  4BW1 A;  4C67 A;  5FE6 A;  5HQ5 A;  3AQA A;  5C4Q A;  4QR3 A;  4TTE A;  4O74 A;  5FE0 A;  4Z93 A;  4O7C A;  5LUU A;  2NXB A;  4QSQ A;  4YH4 A;  5LKX A;  5CPE A;  2H60 A;  4HBY A;  5A81 A;  5FG6 A;  4ZW1 A;  3IU6 A;  5CQA A;  1N72 A;  4QSX A;  5CUG A;  5F1H A;  3QZT A;  5D25 A;  4HXN A;  5CU8 A;  5F61 A;  5E9V A;  5D3H A;  5DFC A;  5L98 A;  5ENB A;  4NRA A;  5E7D A;  4QEV A;  5A83 A;  2DVS A;  3O34 A;  5BT5 A;  4YH3 A;  4YBM A;  5ENC A;  5TB6 A;  5DYU A;  2N9G A;  4NR6 A;  4E96 A;  3LXJ A;  4Z6I A;  4PY6 A;  1EQF A;  2YEK A;  2FSA A;  5KU3 A;  4O78 A;  5EPB A;  2L5E A;  3MQM A;  2RNX A;  4YK0 A;  4HXM A;  5F3A A;  2YEL A;  5HEL A;  5CQ3 A;  4NXJ A;  5FFW A;  4YYM A;  3SVG A;  4BW3 A;  4CUP A;  3S91 A;  5H1V A;  4NS5 A;  4LZS A;  5EM3 A;  5A5S A;  4QBM A;  3MB4 A;  5EPR A;  5D3J A;  4UIW A;  5DKD A;  4YAX A;  3I3J A;  2YEM A;  4CUT A;  4QC3 A;  4YY4 A;  3AAD A;  4NUC A;  4LZR A;  5LJ2 A;  5ENI A;  4HXS A;  5E3G A;  5FH7 A;  3ONI A;  4O71 A;  5CZG A;  4YAD A;  5D24 A;  5DFD A;  4LR6 A;  5EWC A;  3TLP A;  3Q2F A;  4UYF A;  4LYS A;  5E9K A;  5EK9 A;  4BHW A;  4IOO A;  5FE8 A;  5FH8 A;  5CQT A;  4NRC A;  5LKT A;  5A85 A;  4O72 A;  5I86 A;  4TT4 A;  5FDZ A;  5FE7 A;  3NXB A;  5DW1 A;  4LC2 A;  2YW5 A;  5D0C A;  5CGP A;  5HCL A;  5L8U A;  5C7N A;  4QSU A;  5HM0 A;  4MR5 A;  4UIZ A;  4QR5 A;  5LVQ A;  4QZS A;  5F2P A;  5HFR A;  3JVL A;  5CQ4 A;  3S92 A;  4QC1 A;  4N3W A;  4LZ2 A;  4YYG A;  4QY4 A;  4QSW A;  5CS8 A;  4O76 A;  5FB0 A;  5HQ7 A;  4DON A;  5FE5 A;  4ALG A;  4O7F A;  1X0J A;  5E9L A;  5DW2 A;  2RFJ A;  5F62 A;  4XY8 A;  4HXL A;  4O7E A;  5ENH A;  5BT4 A;  1JM4 B;  5D3P A;  2F6N A;  5E9M A;  3UVD A;  5AME A;  5E74 A;  5CTL A;  3QZS A;  4IR6 A;  5FE4 A;  5D3N A;  5ENE A;  3P5O A;  4LYW A;  4YC9 A;  5FFY A;  3O35 A;  5LKZ A;  3UV4 A;  3GG3 A;  5D7X A;  5F25 A;  4GPJ A;  4QSV A;  4A9O A;  5EWH A;  4QUU A;  4CFL A;  4PCE A;  3LJW A;  4CUR A;  3UVY A;  4MEP A;  4QST A;  3UV5 A;  4YYN A;  4XUA A;  5FB1 A;  4HXR A;  4YY6 A;  5EWD A;  5I83 A;  3O37 A;  4BW4 A;  3UW9 A;  5DBM A;  4TQN A;  1ZS5 A;  3MUL A;  4N4H A;  4YYK A;  5LJ1 A;  3U5J A;  5D3S A;  5A7C A;  4TT2 A;  3MUK A;  3IU5 A;  4UYD A;  2E3K A;  4YBT A;  4NQN A;  4YYD A;  4QEW A;  5DYC A;  5F63 A;  5C87 A;  5C8G A;  5DY7 A;  5II1 A;  5ENG A;  5C89 A;  2KTB B;  4C66 A;  5JI8 A;  4NUE A;  5CP5 A;  5HEM A;  2R10 A;  3QZV A;  4O77 A;  4TZ8 A;  5EU1 A;  3U5P A;  5FG5 A;  3SVF A;  5LJ0 A;  2WP1 A;  5FH6 A;  2RNY A;  5E73 A;  3P1E A;  4QNS A;  3D7C A;  4KV1 A;  4MEN A;  5DKH A;  5HRW A;  5L96 A;  5A5P A;  3P1D A;  5F5Z A;  4NRB A;  5H1U A;  5HRX A;  2DKW A;  4NYV A;  5A82 A;  4N4G A;  3DAI A;  5FG4 A;  4NR4 A;  5IGN A;  5CUA A;  3UV2 A;  4WHU A;  3O36 A;  4TS8 A;  5EGU A;  5A5O A;  4FLP A;  5L97 A;  5D3T A;  5HFQ A;  2DWW A;  2I8N A;  4O7B A;  4CLB A;  5LVR A;  5COI A;  5KO4 A;  4ZQL A;  2RNW A;  4QSS A;  5C85 A;  5DYX A;  5CQ6 A;  4XYA A;  2YQD A;  3JVK A;  4HBX A;  5CUB A;  5EIC A;  4UYH A;  5CRZ A;  5LKU A;  4PS5 A;  3MB3 A;  4NYX A;  4N4F A;  4QYL A;  4IR5 A;  4O70 A;  4Q0N A;  4YAT A;  4XY9 A;  4TU6 A;  4CFK A;  2RI7 A;  4TT6 A;  5EQ1 A;  2OO1 A;  5BT3 A;  4IR3 A;  4A9I A;  5IGM A;  5FFV A;  5IID A;  2RO1 A;  4BW2 A;  5I7X A;  5EWV A;  3P1C A;  5HRV A;  3U5O A;  2OUO A;  2I7K A;  5D3L A;  4KV4 A;  4OGI A;  4QSP A;  5I80 A;  4MEQ A;  4NYW A;  4UIY A;  5I29 A;  4WIV A;  5DLZ A;  4O75 A;  5EA1 A;  4IOR A;  5H85 A;  2DVR A;  5DKC A;  5FE1 A;  5L99 A;  3LQH A;  5IGK A;  3G0J A;  5F36 A;  4QEU A;  5G4R A;  5E3D A;  4NR5 A;  4O7A A;  5F60 A;  5J0D A;  3JVM A;  4TU4 A;  5H1T A;  1WUG A;  5ETD A;  5AMF A;  3LQI A;  4HXP A;  5KTW A;  4Z1Q A;  3HME A;  5IGL A;  4WHW A;  4IR4 A;  4RVR A;  4CUQ A;  5HQ6 A;  5IBN A;  3UVX A;  4HXO A;  4X2I A;  5HJC A;  3RCW A;  5ENF A;  3FKM X;  3UVW A;  5E0R A;  3U5L A;  4KCX A;  4MEO A;  4MR3 A;  2E7O A;  5I7Y A;  5EV9 A;  5CUC A;  4QUT A;  2G4A A;  5CY9 A;  4PTB A;  5FE9 A;  4J0R A;  4ALH A;  2R0S A;  2WP2 A;  2LSP B;  4J3I A;  4NR7 A;  4OUF A;  4TYL A;  5EVA A;  4A9E A;  4Z6H A;  2D82 A;  3O33 A;  5D3R A;  5A5R A;  2YYN A;  5CRM A;  3U5N A;  4MR6 A;  3HMF A;  5CQ5 A;  4LRG A;  5A5N A;  2OSS A;  4NR9 A;  4J1P A;  4UIX A;  3U5M A;  3ZYU A;  4CUU A;  4UIU A;  5E9I A;  5L8T A;  3SVH A;  5HEN A;  3Q2E A;  4UYG A;  2R0V A;  4N4I A;  4NQM A;  5I89 A;  2DAT A;  4Z1S A;  4BJX A;  5JWM A;  5CQ8 A;  5ENJ A;  5EWW A;  1JSP B;  4A9F A;  3G0L A;  4Q0O A;  4ZC9 A;  5EIS A;  5KTX A;  3U5K A;  5FE2 A;  4XUB A;  4AKN A;  2L85 A;  2MJV B;  4A9H A;  5FE3 A;  5DLX A;  4F3I A;  5A5Q A;  4PCI A;  5IG6 A;  5I1Q A;  3HMH A;  5I88 A;  4HXK A;  4YYH A;  5EPS A;  3DWY A;  5CFW A;  4OGJ A;  4PKL A;  5KTU A;  5DX4 A;  2E7N A;  1WUM A;  4HBV A;  5CUE A;  5DYA A;  4A9K A;  4A9N A;  4J0S A;  5EP7 A;  5F1L A;  4HBW A;  5ACY A;  1F68 A;  5FBX A;  3P1F A;  4QYD A;  4A9J A;  5DFB A;  5II2 A;  5KHM A;  2GRC A;  4MR4 A;  4TZ2 A;  4YBS A;  4CL9 A;  2YDW A;  4QR4 A;  2R0Y A;  3MXF A;  4QSR A;  4YAB A;  4UYE A;  5CUD A;  4CUS A;  5D26 A;  5EI4 A;  2RS9 B;  4QB3 A;  2L84 A;  5AD3 A;  3K2J A;  5G4S A;  4LDF A;  4LYI A;  4YYJ A;  1E6I A;  5E9Y A;  4A9L A;  4YYI A;  4A9M A;  5ETB A;  5TCM A;  4UIT A;  2DVV A;  5I40 A;  4Y03 A;  5AD2 A;  5CQ7 A;  5HLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...