4QSRA

Structure of the bromodomain of human atpase family aaa domain-containing protein 2 (atad2) with bound mpd
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Structure-based approaches towards identification of fragments for the low-druggability ATAD2 bromodomain
doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4qsrA00
1ZS5A 4QEVA 4MENA 5CTLA 5EM3A 4KV4A 4QR3A 5I40A 4IORA 5CS8A 2KTBB 5CUBA 5ETBA 4TT2A 3QZTA 1N72A 5ACYA 5I7YA 5DBMA 5LKUA 3MULA 5F2PA 3NXBA 4NR8A 5EWWA 4YABA 4KCXA 5LJ1A 5LKTA 3P1DA 1EQFA 4UIUA 5IGLA 5FE0A 5I29A 4HXPA 4NR9A 5FG4A 4F3IA 5CRMA 5HCLA 5FB1A 2DVVA 5FFWA 4YC9A 2R10A 5EWCA 5C8GA 4WHUA 4YADA 4MR5A 4MEOA 4QSQA 5CUAA 4IOOA 5E9LA 4Z6HA 3MQMA 5FE4A 5D3TA 4QR5A 5F62A 2YDWA 4HXNA 4A9JA 5HRVA 4A9FA 4OUFA 4ZC9A 4UYFA 5CQ5A 5A5QA 2OSSA 4BJXA 4NQNA 5D26A 4FLPA 3D7CA 3LXJA 4CUPA 4J1PA 2R0VA 2YELA 5H1VA 5CQ8A 5EWVA 2MJVB 4TYLA 5HJCA 3QZSA 3MB4A 5FE1A 4NXJA 1JSPB 5LKXA 3U5KA 5EA1A 5IBNA 5I89A 4O7AA 5LKZA 2I8NA 5L96A 5LJ0A 5FFYA 5FE5A 2F6NA 2DVRA 5CUCA 4QR4A 4QSPA 5DYXA 5KTUA 2NXBA 4HXSA 2YEMA 4TZ2A 4DONA 4YY4A 5DKHA 2OO1A 3UW9A 2E3KA 4QSSA 4PTBA 5D7XA 4CUTA 4A9NA 4PCIA 5EVAA 5LJ2A 5TCMA 5FE6A 4N4GA 1E6IA 2N9GA 5KU3A 3LJWA 3MXFA 4NQMA 3O34A 3JVMA 5CUEA 4HBWA 5FH6A 4PS5A 4A9OA 2R0YA 5DW1A 5E73A 4YAXA 4UIYA 4QC3A 4LR6A 5ENCA 3U5LA 5DY7A 4QEWA 4QZSA 5CPEA 5ENBA 1WUMA 4YYHA 5C87A 1JM4B 5HFQA 5A82A 2DVQA 5HFRA 4J0SA 5A5OA 5ETDA 4UITA 5F1HA 5II2A 4HXKA 5HEMA 4LRGA 5HLSA 5FFVA 4QSVA 5BT3A 5EICA 5ENEA 5C7NA 4HBXA 5CU8A 5TB6A 3UVYA 5HQ5A 4UIWA 2FSAA 4AKNA 5ENFA 4QSWA 2DVSA 3LQIA 5A83A 4O72A 5F61A 4LZSA 4NRAA 4HXRA 3ONIA 4QYLA 3ZYUA 4N4FA 3P1FA 5A7CA 5ENGA 4TT4A 4MR3A 4Q0NA 4UYHA 3UVDA 4MEQA 5IG6A 5G4RA 5AMFA 5COIA 3LQHA 4C66A 5I7XA 5CRZA 4NRCA 3JVJA 4YATA 4IR4A 5D3LA 5FBXA 5HRXA 5DFCA 5D3SA 4UYFB 3O37A 3AADA 4O7EA 4ALHA 4Z1SA 4TT6A 5EWHA 5A5RA 3U5MA 3U5PA 4OGIA 4Z93A 5KO4A 3AQAA 3HMHA 3UV5A 4TS8A 3Q2FA 3SVHA 2WP1A 5FDZA 2L5EA 2DWWA 2LSPB 5ENHA 4Y03A 5E74A 5EPBA 5HRWA 5J0DA 2D9EA 4Q0OA 4O71A 1WUGA 4CURA 2YQDA 3QZVA 5DYUA 4IOQA 3IU6A 4NR4A 5FE8A 5D3PA 4NYWA 4NR5A 3HMFA 2RFJA 5IGKA 5H85A 5F60A 4YYDA 4QC1A 5D25A 2DATA 4CUQA 4LYIA 4ZQLA 5I86A 5ENJA 5C85A 4KV1A 2E7NA 5BT5A 4NUEA 4YYMA 5CQ7A 4CLBA 5CGPA 3SVFA 4O7CA 5KHMA 5DKDA 5I1QA 5K29A 4A9HA 5F25A 5EI4A 4E96A 4MR6A 4O76A 4QNSA 5DLZA 5DLXA 3UV2A 5L99A 3P5OA 2L85A 5IGMA 5E9KA 4X2IA 5BT4A 4QY4A 5E0RA 5A81A 2R0SA 4NUCA 5DX4A 4YYKA 5EGUA 3O33A 3U5JA 4LC2A 5LVQA 3GG3A 4NYVA 2L84A 4Z1QA 4O70A 4IR5A 3K2JA 4LYSA 4WIVA 4TQNA 3DAIA 5FH7A 5L8TA 5IIDA 4UIXA 5DYAA 5E3DA 5II1A 5G4SA 4O7BA 4ALGA 5HM0A 4UYDA 4XY8A 4HXLA 4YYGA 3U5OA 4N4IA 5H1TA 5EU1A 2RS9B 3IU5A 5FG6A 4O78A 2RI7A 3FKMX 4CUSA 5HQ6A 2RNWA 4PCEA 5EPRA 5F63A 3G0JA 3I3JA 5I83A 5A5PA 5D3HA 4TTEA 2G4AA 4NUDA 4A9MA 5H1UA 4QSXA 4XUAA 2H60A 3P1EA 4MR4A 4O75A 4CFKA 5LUUA 4N4HA 5FE7A 4QSUA 4YYIA 4QUUA 4YBMA 5CQ6A 3JVKA 4HBYA 4YH4A 2YW5A 5FE9A 4QYDA 5F3AA 4YY6A 4O7FA 3Q2EA 5AD2A 4BW4A 5I80A 4ZW1A 5F1LA 4OGJA 5ENIA 5CP5A 3P1CA 5CUGA 3G0LA 2GRCA 5EWDA 4CFLA 4IR6A 3HMEA 4LYWA 4YK0A 4YYNA 5DFDA 5CQTA 4WHWA 4QB3A 2YEKA 4XUBA 5D3JA 3S91A 4LZRA 3TLPA 5CFWA 5F5ZA 1F68A 4O77A 1X0JA 5E3GA 5D0CA 4BW2A 3U5NA 4QUTA 4PY6A 5EV9A 5D24A 5EPSA 5DW2A 4A9EA 3UVXA 5LVRA 4CUUA 4IR3A 4MEPA 5HELA 3MB3A 5EISA 4UIVA 5EQ1A 5A85A 5E9VA 4A9LA 3JVLA 3SVGA 4J3IA 4GPJA 4YBSA 4BHWA 4NR7A 2WP2A 2RNXA 4BW3A 5C4QA 4PKLA 2E7OA 4CL9A 4NR6A 5FB0A 5JWMA 4NS5A 4A9KA 2D82A 4YH3A 4YYJA 5F36A 2DKWA 5FG5A 4UIZA 4XY9A 5D3RA 5L97A 5C89A 5A5NA 3UVWA 5AMEA 4Z6IA 4QSRA 2RNYA 4UYEA 5FE3A 3O35A 4TZ8A 4J0RA 4HXOA 4LZ2A 4YBTA 5DYCA 3S92A 5D3NA 4LDFA 5E9MA 4N3WA 3MUKA 4XYAA 4UYGA 5DFBA 5EK9A 2I7KA 4A9IA 5FH8A 4TU4A 4QBMA 4TU6A 5DKCA 5FE2A 5A5SA 5E9YA 5CQ4A 5JI8A 2YYNA 4QSTA 4RVRA 5L98A 4HXMA 5HQ7A 5I88A 5HENA 5E7DA 2F6JA 3DWYA 2RO1A 5L8UA 3UV4A 4NRBA 5CQAA 4C67A 3LQJA 3RCWA 5E9IA 5IGNA 2OUOA 4HBVA 5KTXA 4O74A 5CZGA 5CQ3A 5EP7A 5CY9A 5CUDA 5KTWA 4NYXA 3O36A 4QEUA 4BW1A 5AD3A
chains in the Genus database with same CATH superfamily
1ZS5A 4QEVA 4MENA 5CTLA 5EM3A 4KV4A 4QR3A 5I40A 4IORA 5CS8A 2KTBB 5CUBA 5ETBA 4TT2A 3QZTA 1N72A 5ACYA 5I7YA 5DBMA 5LKUA 3MULA 5F2PA 3NXBA 4NR8A 5EWWA 4YABA 4KCXA 5LJ1A 5LKTA 3P1DA 1EQFA 4UIUA 3D1DA 5IGLA 5FE0A 5I29A 4HXPA 4NR9A 5FG4A 4F3IA 5CRMA 5HCLA 5FB1A 2DVVA 5FFWA 4YC9A 4AKIA 2R10A 5EWCA 5C8GA 4WHUA 4YADA 4MR5A 4MEOA 4QSQA 5CUAA 4IOOA 5E9LA 4Z6HA 3MQMA 5FE4A 5D3TA 4QR5A 5F62A 2YDWA 4HXNA 4A9JA 5HRVA 4A9FA 4OUFA 4ZC9A 4UYFA 5CQ5A 5A5QA 2OSSA 4BJXA 4NQNA 5D26A 4FLPA 3D7CA 3LXJA 4CUPA 4J1PA 2R0VA 2YELA 5H1VA 5CQ8A 5EWVA 2MJVB 4TYLA 5HJCA 3QZSA 3MB4A 5FE1A 4NXJA 1JSPB 5LKXA 3U5KA 5EA1A 5IBNA 5I89A 4O7AA 5LKZA 2I8NA 5L96A 5LJ0A 5FFYA 5FE5A 2F6NA 2DVRA 5CUCA 4QR4A 4QSPA 5DYXA 5KTUA 2NXBA 4HXSA 2YEMA 4TZ2A 4DONA 4YY4A 5DKHA 2OO1A 3UW9A 1PUOA 2E3KA 4QSSA 4PTBA 5D7XA 4CUTA 4A9NA 4PCIA 5EVAA 5LJ2A 5TCMA 5FE6A 4N4GA 1E6IA 2N9GA 5KU3A 3LJWA 3MXFA 4NQMA 3O34A 3JVMA 5CUEA 4HBWA 5FH6A 4PS5A 4A9OA 2R0YA 5DW1A 5E73A 4YAXA 4UIYA 4QC3A 4LR6A 5ENCA 3U5LA 5DY7A 4QEWA 4QZSA 5CPEA 5ENBA 1WUMA 4YYHA 5C87A 1JM4B 5HFQA 5A82A 2DVQA 5HFRA 4J0SA 5A5OA 5ETDA 4UITA 5F1HA 5II2A 4HXKA 5HEMA 4LRGA 5HLSA 5FFVA 4QSVA 5BT3A 5EICA 5ENEA 5C7NA 4HBXA 5CU8A 5TB6A 3UVYA 5HQ5A 4UIWA 2FSAA 4AKNA 3ERRA 5ENFA 4QSWA 2DVSA 3LQIA 5A83A 4O72A 5F61A 4LZSA 4NRAA 4HXRA 3ONIA 4QYLA 3ZYUA 3VKHA 4N4FA 3P1FA 5A7CA 5ENGA 4TT4A 4MR3A 4Q0NA 4UYHA 3UVDA 4MEQA 5IG6A 5G4RA 5AMFA 5COIA 3LQHA 4C66A 5I7XA 5CRZA 4NRCA 3JVJA 4YATA 4IR4A 5D3LA 5FBXA 5HRXA 5DFCA 5D3SA 4UYFB 3O37A 3AADA 4O7EA 4ALHA 4Z1SA 4TT6A 5EWHA 5A5RA 4AI6A 3U5MA 3U5PA 4OGIA 4Z93A 5KO4A 3AQAA 3HMHA 3UV5A 4TS8A 3Q2FA 3SVHA 2WP1A 5FDZA 2L5EA 2DWWA 2LSPB 5ENHA 4Y03A 5E74A 5EPBA 5HRWA 5J0DA 2D9EA 4Q0OA 4O71A 1WUGA 4CURA 2YQDA 3QZVA 5DYUA 4IOQA 3IU6A 4NR4A 5FE8A 5D3PA 4NYWA 4NR5A 3HMFA 2RFJA 5IGKA 5H85A 3VKGA 5F60A 4YYDA 4QC1A 5D25A 2DATA 4CUQA 4LYIA 4ZQLA 5I86A 5ENJA 5C85A 4KV1A 2E7NA 5BT5A 4NUEA 4YYMA 5CQ7A 4CLBA 5CGPA 3SVFA 4O7CA 5KHMA 5DKDA 5I1QA 5K29A 4A9HA 5F25A 5EI4A 4E96A 1ZKRA 4MR6A 4O76A 4AKGA 4QNSA 5DLZA 5DLXA 3UV2A 5L99A 3P5OA 2EJNA 2L85A 5IGMA 5E9KA 4X2IA 3D1BA 5BT4A 4QY4A 5E0RA 5A81A 2R0SA 4NUCA 5DX4A 4YYKA 5EGUA 3O33A 3U5JA 4LC2A 5LVQA 3GG3A 4NYVA 2L84A 4Z1QA 4O70A 4IR5A 3K2JA 4LYSA 4WIVA 4TQNA 3DAIA 5FH7A 5L8TA 5IIDA 4UIXA 5DYAA 5E3DA 5II1A 5G4SA 4O7BA 4ALGA 5HM0A 4UYDA 4XY8A 4HXLA 4YYGA 3U5OA 4N4IA 5H1TA 5EU1A 2RS9B 3IU5A 5FG6A 4O78A 2RI7A 3FKMX 4CUSA 5HQ6A 2RNWA 4PCEA 5EPRA 5F63A 3G0JA 3I3JA 5I83A 5A5PA 5D3HA 4TTEA 2G4AA 4NUDA 4A9MA 5H1UA 4QSXA 4XUAA 2H60A 3P1EA 4MR4A 4O75A 4CFKA 5LUUA 4N4HA 5FE7A 4QSUA 4YYIA 4QUUA 4YBMA 5CQ6A 3JVKA 4HBYA 4YH4A 2YW5A 5FE9A 4QYDA 5F3AA 4YY6A 4O7FA 3Q2EA 5AD2A 4BW4A 5I80A 4ZW1A 5F1LA 4OGJA 5ENIA 5CP5A 3P1CA 5CUGA 3G0LA 2GRCA 5EWDA 4CFLA 4IR6A 3HMEA 4LYWA 4YK0A 4YYNA 5DFDA 5CQTA 4WHWA 4QB3A 2YEKA 4XUBA 5D3JA 3S91A 4LZRA 3TLPA 5CFWA 5F5ZA 1F68A 4O77A 1X0JA 5E3GA 5D0CA 4BW2A 3U5NA 4QUTA 4PY6A 5EV9A 5D24A 5EPSA 5DW2A 4A9EA 3UVXA 5LVRA 4CUUA 4AKHA 4IR3A 4MEPA 5HELA 3MB3A 5EISA 4UIVA 5EQ1A 5A85A 5E9VA 4A9LA 3JVLA 3SVGA 4J3IA 4GPJA 4YBSA 4BHWA 4NR7A 2WP2A 2RNXA 4BW3A 5C4QA 4PKLA 2E7OA 4CL9A 4NR6A 5FB0A 5JWMA 4NS5A 4A9KA 2D82A 4YH3A 4YYJA 5F36A 2DKWA 5FG5A 4UIZA 4XY9A 5D3RA 5L97A 5C89A 5A5NA 3UVWA 5AMEA 4Z6IA 4QSRA 2RNYA 4UYEA 5FE3A 3O35A 4TZ8A 4J0RA 4HXOA 4LZ2A 4YBTA 5DYCA 3S92A 5D3NA 4LDFA 5E9MA 4N3WA 3MUKA 4XYAA 4UYGA 5DFBA 5EK9A 2I7KA 4A9IA 5FH8A 4TU4A 4QBMA 4TU6A 5DKCA 5FE2A 5A5SA 5E9YA 5CQ4A 5JI8A 2YYNA 4QSTA 4RVRA 5L98A 4HXMA 5HQ7A 5I88A 5HENA 5E7DA 2F6JA 3DWYA 2RO1A 5L8UA 3UV4A 4NRBA 5CQAA 4C67A 3LQJA 3RCWA 5E9IA 5IGNA 2OUOA 4HBVA 5KTXA 4O74A 5CZGA 5CQ3A 5EP7A 5CY9A 5CUDA 5KTWA 4NYXA 3O36A 4QEUA 4BW1A 5AD3A
chains in the Genus database with same CATH topology
1ZS5A 4QEVA 4MENA 5CTLA 5EM3A 4KV4A 4QR3A 5I40A 4IORA 5CS8A 2KTBB 5CUBA 5ETBA 4TT2A 3QZTA 1N72A 5ACYA 5I7YA 5DBMA 5LKUA 3MULA 5F2PA 3NXBA 4NR8A 5EWWA 4YABA 4KCXA 5LJ1A 5LKTA 3P1DA 1EQFA 4UIUA 5IGLA 5FE0A 5I29A 4HXPA 4NR9A 5FG4A 4F3IA 5CRMA 5HCLA 5FB1A 2DVVA 5FFWA 4YC9A 2R10A 5EWCA 5C8GA 4WHUA 4YADA 4MR5A 4MEOA 4QSQA 5CUAA 4IOOA 5E9LA 4Z6HA 3MQMA 5FE4A 5D3TA 4QR5A 5F62A 2YDWA 4HXNA 4A9JA 5HRVA 4A9FA 4OUFA 4ZC9A 4UYFA 5CQ5A 5A5QA 2OSSA 4BJXA 4NQNA 5D26A 4FLPA 3D7CA 3LXJA 4CUPA 4J1PA 2R0VA 2YELA 5H1VA 5CQ8A 5EWVA 2MJVB 4TYLA 5HJCA 3QZSA 3MB4A 5FE1A 4NXJA 1JSPB 5LKXA 3U5KA 5EA1A 5IBNA 5I89A 4O7AA 5LKZA 2I8NA 5L96A 5LJ0A 5FFYA 5FE5A 2F6NA 2DVRA 5CUCA 4QR4A 4QSPA 5DYXA 5KTUA 2NXBA 4HXSA 2YEMA 4TZ2A 4DONA 4YY4A 5DKHA 2OO1A 3UW9A 2E3KA 4QSSA 4PTBA 5D7XA 4CUTA 4A9NA 4PCIA 5EVAA 5LJ2A 5TCMA 5FE6A 4N4GA 1E6IA 2N9GA 5KU3A 3LJWA 3MXFA 4NQMA 3O34A 3JVMA 5CUEA 4HBWA 5FH6A 4PS5A 4A9OA 2R0YA 5DW1A 5E73A 4YAXA 4UIYA 4QC3A 4LR6A 5ENCA 3U5LA 5DY7A 4QEWA 4QZSA 5CPEA 5ENBA 1WUMA 4YYHA 5C87A 1JM4B 5HFQA 5A82A 2DVQA 5HFRA 4J0SA 5A5OA 5ETDA 4UITA 5F1HA 5II2A 4HXKA 5HEMA 4LRGA 5HLSA 5FFVA 4QSVA 5BT3A 5EICA 5ENEA 5C7NA 4HBXA 5CU8A 5TB6A 3UVYA 5HQ5A 4UIWA 2FSAA 4AKNA 5ENFA 4QSWA 2DVSA 3LQIA 5A83A 4O72A 5F61A 4LZSA 4NRAA 4HXRA 3ONIA 4QYLA 3ZYUA 4N4FA 3P1FA 5A7CA 5ENGA 4TT4A 4MR3A 4Q0NA 4UYHA 3UVDA 4MEQA 5IG6A 5G4RA 5AMFA 5COIA 3LQHA 4C66A 5I7XA 5CRZA 4NRCA 3JVJA 4YATA 4IR4A 5D3LA 5FBXA 5HRXA 5DFCA 5D3SA 4UYFB 3O37A 3AADA 4O7EA 4ALHA 4Z1SA 4TT6A 5EWHA 5A5RA 3U5MA 3U5PA 4OGIA 4Z93A 5KO4A 3AQAA 3HMHA 3UV5A 4TS8A 3Q2FA 3SVHA 2WP1A 5FDZA 2L5EA 2DWWA 2LSPB 5ENHA 4Y03A 5E74A 5EPBA 5HRWA 5J0DA 2D9EA 4Q0OA 4O71A 1WUGA 4CURA 2YQDA 3QZVA 5DYUA 4IOQA 3IU6A 4NR4A 5FE8A 5D3PA 4NYWA 4NR5A 3HMFA 2RFJA 5IGKA 5H85A 5F60A 4YYDA 4QC1A 5D25A 2DATA 4CUQA 4LYIA 4ZQLA 5I86A 5ENJA 5C85A 4KV1A 2E7NA 5BT5A 4NUEA 4YYMA 5CQ7A 4CLBA 5CGPA 3SVFA 4O7CA 5KHMA 5DKDA 5I1QA 5K29A 4A9HA 5F25A 5EI4A 4E96A 4MR6A 4O76A 4QNSA 5DLZA 5DLXA 3UV2A 5L99A 3P5OA 2L85A 5IGMA 5E9KA 4X2IA 5BT4A 4QY4A 5E0RA 5A81A 2R0SA 4NUCA 5DX4A 4YYKA 5EGUA 3O33A 3U5JA 4LC2A 5LVQA 3GG3A 4NYVA 2L84A 4Z1QA 4O70A 4IR5A 3K2JA 4LYSA 4WIVA 4TQNA 3DAIA 5FH7A 5L8TA 5IIDA 4UIXA 5DYAA 5E3DA 5II1A 5G4SA 4O7BA 4ALGA 5HM0A 4UYDA 4XY8A 4HXLA 4YYGA 3U5OA 4N4IA 5H1TA 5EU1A 2RS9B 3IU5A 5FG6A 4O78A 2RI7A 3FKMX 4CUSA 5HQ6A 2RNWA 4PCEA 5EPRA 5F63A 3G0JA 3I3JA 5I83A 5A5PA 5D3HA 4TTEA 2G4AA 4NUDA 4A9MA 5H1UA 4QSXA 4XUAA 2H60A 3P1EA 4MR4A 4O75A 4CFKA 5LUUA 4N4HA 5FE7A 4QSUA 4YYIA 4QUUA 4YBMA 5CQ6A 3JVKA 4HBYA 4YH4A 2YW5A 5FE9A 4QYDA 5F3AA 4YY6A 4O7FA 3Q2EA 5AD2A 4BW4A 5I80A 4ZW1A 5F1LA 4OGJA 5ENIA 5CP5A 3P1CA 5CUGA 3G0LA 2GRCA 5EWDA 4CFLA 4IR6A 3HMEA 4LYWA 4YK0A 4YYNA 5DFDA 5CQTA 4WHWA 4QB3A 2YEKA 4XUBA 5D3JA 3S91A 4LZRA 3TLPA 5CFWA 5F5ZA 1F68A 4O77A 1X0JA 5E3GA 5D0CA 4BW2A 3U5NA 4QUTA 4PY6A 5EV9A 5D24A 5EPSA 5DW2A 4A9EA 3UVXA 5LVRA 4CUUA 4IR3A 4MEPA 5HELA 3MB3A 5EISA 4UIVA 5EQ1A 5A85A 5E9VA 4A9LA 3JVLA 3SVGA 4J3IA 4GPJA 4YBSA 4BHWA 4NR7A 2WP2A 2RNXA 4BW3A 5C4QA 4PKLA 2E7OA 4CL9A 4NR6A 5FB0A 5JWMA 4NS5A 4A9KA 2D82A 4YH3A 4YYJA 5F36A 2DKWA 5FG5A 4UIZA 4XY9A 5D3RA 5L97A 5C89A 5A5NA 3UVWA 5AMEA 4Z6IA 4QSRA 2RNYA 4UYEA 5FE3A 3O35A 4TZ8A 4J0RA 4HXOA 4LZ2A 4YBTA 5DYCA 3S92A 5D3NA 4LDFA 5E9MA 4N3WA 3MUKA 4XYAA 4UYGA 5DFBA 5EK9A 2I7KA 4A9IA 5FH8A 4TU4A 4QBMA 4TU6A 5DKCA 5FE2A 5A5SA 5E9YA 5CQ4A 5JI8A 2YYNA 4QSTA 4RVRA 5L98A 4HXMA 5HQ7A 5I88A 5HENA 5E7DA 2F6JA 3DWYA 2RO1A 5L8UA 3UV4A 4NRBA 5CQAA 4C67A 3LQJA 3RCWA 5E9IA 5IGNA 2OUOA 4HBVA 5KTXA 4O74A 5CZGA 5CQ3A 5EP7A 5CY9A 5CUDA 5KTWA 4NYXA 3O36A 4QEUA 4BW1A 5AD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZS5 A;  4QEV A;  4MEN A;  5CTL A;  5EM3 A;  4KV4 A;  4QR3 A;  5I40 A;  4IOR A;  5CS8 A;  2KTB B;  5CUB A;  5ETB A;  4TT2 A;  3QZT A;  1N72 A;  5ACY A;  5I7Y A;  5DBM A;  5LKU A;  3MUL A;  5F2P A;  3NXB A;  4NR8 A;  5EWW A;  4YAB A;  4KCX A;  5LJ1 A;  5LKT A;  3P1D A;  1EQF A;  4UIU A;  5IGL A;  5FE0 A;  5I29 A;  4HXP A;  4NR9 A;  5FG4 A;  4F3I A;  5CRM A;  5HCL A;  5FB1 A;  2DVV A;  5FFW A;  4YC9 A;  2R10 A;  5EWC A;  5C8G A;  4WHU A;  4YAD A;  4MR5 A;  4MEO A;  4QSQ A;  5CUA A;  4IOO A;  5E9L A;  4Z6H A;  3MQM A;  5FE4 A;  5D3T A;  4QR5 A;  5F62 A;  2YDW A;  4HXN A;  4A9J A;  5HRV A;  4A9F A;  4OUF A;  4ZC9 A;  4UYF A;  5CQ5 A;  5A5Q A;  2OSS A;  4BJX A;  4NQN A;  5D26 A;  4FLP A;  3D7C A;  3LXJ A;  4CUP A;  4J1P A;  2R0V A;  2YEL A;  5H1V A;  5CQ8 A;  5EWV A;  2MJV B;  4TYL A;  5HJC A;  3QZS A;  3MB4 A;  5FE1 A;  4NXJ A;  1JSP B;  5LKX A;  3U5K A;  5EA1 A;  5IBN A;  5I89 A;  4O7A A;  5LKZ A;  2I8N A;  5L96 A;  5LJ0 A;  5FFY A;  5FE5 A;  2F6N A;  2DVR A;  5CUC A;  4QR4 A;  4QSP A;  5DYX A;  5KTU A;  2NXB A;  4HXS A;  2YEM A;  4TZ2 A;  4DON A;  4YY4 A;  5DKH A;  2OO1 A;  3UW9 A;  2E3K A;  4QSS A;  4PTB A;  5D7X A;  4CUT A;  4A9N A;  4PCI A;  5EVA A;  5LJ2 A;  5TCM A;  5FE6 A;  4N4G A;  1E6I A;  2N9G A;  5KU3 A;  3LJW A;  3MXF A;  4NQM A;  3O34 A;  3JVM A;  5CUE A;  4HBW A;  5FH6 A;  4PS5 A;  4A9O A;  2R0Y A;  5DW1 A;  5E73 A;  4YAX A;  4UIY A;  4QC3 A;  4LR6 A;  5ENC A;  3U5L A;  5DY7 A;  4QEW A;  4QZS A;  5CPE A;  5ENB A;  1WUM A;  4YYH A;  5C87 A;  1JM4 B;  5HFQ A;  5A82 A;  2DVQ A;  5HFR A;  4J0S A;  5A5O A;  5ETD A;  4UIT A;  5F1H A;  5II2 A;  4HXK A;  5HEM A;  4LRG A;  5HLS A;  5FFV A;  4QSV A;  5BT3 A;  5EIC A;  5ENE A;  5C7N A;  4HBX A;  5CU8 A;  5TB6 A;  3UVY A;  5HQ5 A;  4UIW A;  2FSA A;  4AKN A;  5ENF A;  4QSW A;  2DVS A;  3LQI A;  5A83 A;  4O72 A;  5F61 A;  4LZS A;  4NRA A;  4HXR A;  3ONI A;  4QYL A;  3ZYU A;  4N4F A;  3P1F A;  5A7C A;  5ENG A;  4TT4 A;  4MR3 A;  4Q0N A;  4UYH A;  3UVD A;  4MEQ A;  5IG6 A;  5G4R A;  5AMF A;  5COI A;  3LQH A;  4C66 A;  5I7X A;  5CRZ A;  4NRC A;  3JVJ A;  4YAT A;  4IR4 A;  5D3L A;  5FBX A;  5HRX A;  5DFC A;  5D3S A;  4UYF B;  3O37 A;  3AAD A;  4O7E A;  4ALH A;  4Z1S A;  4TT6 A;  5EWH A;  5A5R A;  3U5M A;  3U5P A;  4OGI A;  4Z93 A;  5KO4 A;  3AQA A;  3HMH A;  3UV5 A;  4TS8 A;  3Q2F A;  3SVH A;  2WP1 A;  5FDZ A;  2L5E A;  2DWW A;  2LSP B;  5ENH A;  4Y03 A;  5E74 A;  5EPB A;  5HRW A;  5J0D A;  2D9E A;  4Q0O A;  4O71 A;  1WUG A;  4CUR A;  2YQD A;  3QZV A;  5DYU A;  4IOQ A;  3IU6 A;  4NR4 A;  5FE8 A;  5D3P A;  4NYW A;  4NR5 A;  3HMF A;  2RFJ A;  5IGK A;  5H85 A;  5F60 A;  4YYD A;  4QC1 A;  5D25 A;  2DAT A;  4CUQ A;  4LYI A;  4ZQL A;  5I86 A;  5ENJ A;  5C85 A;  4KV1 A;  2E7N A;  5BT5 A;  4NUE A;  4YYM A;  5CQ7 A;  4CLB A;  5CGP A;  3SVF A;  4O7C A;  5KHM A;  5DKD A;  5I1Q A;  5K29 A;  4A9H A;  5F25 A;  5EI4 A;  4E96 A;  4MR6 A;  4O76 A;  4QNS A;  5DLZ A;  5DLX A;  3UV2 A;  5L99 A;  3P5O A;  2L85 A;  5IGM A;  5E9K A;  4X2I A;  5BT4 A;  4QY4 A;  5E0R A;  5A81 A;  2R0S A;  4NUC A;  5DX4 A;  4YYK A;  5EGU A;  3O33 A;  3U5J A;  4LC2 A;  5LVQ A;  3GG3 A;  4NYV A;  2L84 A;  4Z1Q A;  4O70 A;  4IR5 A;  3K2J A;  4LYS A;  4WIV A;  4TQN A;  3DAI A;  5FH7 A;  5L8T A;  5IID A;  4UIX A;  5DYA A;  5E3D A;  5II1 A;  5G4S A;  4O7B A;  4ALG A;  5HM0 A;  4UYD A;  4XY8 A;  4HXL A;  4YYG A;  3U5O A;  4N4I A;  5H1T A;  5EU1 A;  2RS9 B;  3IU5 A;  5FG6 A;  4O78 A;  2RI7 A;  3FKM X;  4CUS A;  5HQ6 A;  2RNW A;  4PCE A;  5EPR A;  5F63 A;  3G0J A;  3I3J A;  5I83 A;  5A5P A;  5D3H A;  4TTE A;  2G4A A;  4NUD A;  4A9M A;  5H1U A;  4QSX A;  4XUA A;  2H60 A;  3P1E A;  4MR4 A;  4O75 A;  4CFK A;  5LUU A;  4N4H A;  5FE7 A;  4QSU A;  4YYI A;  4QUU A;  4YBM A;  5CQ6 A;  3JVK A;  4HBY A;  4YH4 A;  2YW5 A;  5FE9 A;  4QYD A;  5F3A A;  4YY6 A;  4O7F A;  3Q2E A;  5AD2 A;  4BW4 A;  5I80 A;  4ZW1 A;  5F1L A;  4OGJ A;  5ENI A;  5CP5 A;  3P1C A;  5CUG A;  3G0L A;  2GRC A;  5EWD A;  4CFL A;  4IR6 A;  3HME A;  4LYW A;  4YK0 A;  4YYN A;  5DFD A;  5CQT A;  4WHW A;  4QB3 A;  2YEK A;  4XUB A;  5D3J A;  3S91 A;  4LZR A;  3TLP A;  5CFW A;  5F5Z A;  1F68 A;  4O77 A;  1X0J A;  5E3G A;  5D0C A;  4BW2 A;  3U5N A;  4QUT A;  4PY6 A;  5EV9 A;  5D24 A;  5EPS A;  5DW2 A;  4A9E A;  3UVX A;  5LVR A;  4CUU A;  4IR3 A;  4MEP A;  5HEL A;  3MB3 A;  5EIS A;  4UIV A;  5EQ1 A;  5A85 A;  5E9V A;  4A9L A;  3JVL A;  3SVG A;  4J3I A;  4GPJ A;  4YBS A;  4BHW A;  4NR7 A;  2WP2 A;  2RNX A;  4BW3 A;  5C4Q A;  4PKL A;  2E7O A;  4CL9 A;  4NR6 A;  5FB0 A;  5JWM A;  4NS5 A;  4A9K A;  2D82 A;  4YH3 A;  4YYJ A;  5F36 A;  2DKW A;  5FG5 A;  4UIZ A;  4XY9 A;  5D3R A;  5L97 A;  5C89 A;  5A5N A;  3UVW A;  5AME A;  4Z6I A;  4QSR A;  2RNY A;  4UYE A;  5FE3 A;  3O35 A;  4TZ8 A;  4J0R A;  4HXO A;  4LZ2 A;  4YBT A;  5DYC A;  3S92 A;  5D3N A;  4LDF A;  5E9M A;  4N3W A;  3MUK A;  4XYA A;  4UYG A;  5DFB A;  5EK9 A;  2I7K A;  4A9I A;  5FH8 A;  4TU4 A;  4QBM A;  4TU6 A;  5DKC A;  5FE2 A;  5A5S A;  5E9Y A;  5CQ4 A;  5JI8 A;  2YYN A;  4QST A;  4RVR A;  5L98 A;  4HXM A;  5HQ7 A;  5I88 A;  5HEN A;  5E7D A;  2F6J A;  3DWY A;  2RO1 A;  5L8U A;  3UV4 A;  4NRB A;  5CQA A;  4C67 A;  3LQJ A;  3RCW A;  5E9I A;  5IGN A;  2OUO A;  4HBV A;  5KTX A;  4O74 A;  5CZG A;  5CQ3 A;  5EP7 A;  5CY9 A;  5CUD A;  5KTW A;  4NYX A;  3O36 A;  4QEU A;  4BW1 A;  5AD3 A; 
#chains in the Genus database with same CATH topology
 1ZS5 A;  4QEV A;  4MEN A;  5CTL A;  5EM3 A;  4KV4 A;  4QR3 A;  5I40 A;  4IOR A;  5CS8 A;  2KTB B;  5CUB A;  5ETB A;  4TT2 A;  3QZT A;  1N72 A;  5ACY A;  5I7Y A;  5DBM A;  5LKU A;  3MUL A;  5F2P A;  3NXB A;  4NR8 A;  5EWW A;  4YAB A;  4KCX A;  5LJ1 A;  5LKT A;  3P1D A;  1EQF A;  4UIU A;  3D1D A;  5IGL A;  5FE0 A;  5I29 A;  4HXP A;  4NR9 A;  5FG4 A;  4F3I A;  5CRM A;  5HCL A;  5FB1 A;  2DVV A;  5FFW A;  4YC9 A;  4AKI A;  2R10 A;  5EWC A;  5C8G A;  4WHU A;  4YAD A;  4MR5 A;  4MEO A;  4QSQ A;  5CUA A;  4IOO A;  5E9L A;  4Z6H A;  3MQM A;  5FE4 A;  5D3T A;  4QR5 A;  5F62 A;  2YDW A;  4HXN A;  4A9J A;  5HRV A;  4A9F A;  4OUF A;  4ZC9 A;  4UYF A;  5CQ5 A;  5A5Q A;  2OSS A;  4BJX A;  4NQN A;  5D26 A;  4FLP A;  3D7C A;  3LXJ A;  4CUP A;  4J1P A;  2R0V A;  2YEL A;  5H1V A;  5CQ8 A;  5EWV A;  2MJV B;  4TYL A;  5HJC A;  3QZS A;  3MB4 A;  5FE1 A;  4NXJ A;  1JSP B;  5LKX A;  3U5K A;  5EA1 A;  5IBN A;  5I89 A;  4O7A A;  5LKZ A;  2I8N A;  5L96 A;  5LJ0 A;  5FFY A;  5FE5 A;  2F6N A;  2DVR A;  5CUC A;  4QR4 A;  4QSP A;  5DYX A;  5KTU A;  2NXB A;  4HXS A;  2YEM A;  4TZ2 A;  4DON A;  4YY4 A;  5DKH A;  2OO1 A;  3UW9 A;  1PUO A;  2E3K A;  4QSS A;  4PTB A;  5D7X A;  4CUT A;  4A9N A;  4PCI A;  5EVA A;  5LJ2 A;  5TCM A;  5FE6 A;  4N4G A;  1E6I A;  2N9G A;  5KU3 A;  3LJW A;  3MXF A;  4NQM A;  3O34 A;  3JVM A;  5CUE A;  4HBW A;  5FH6 A;  4PS5 A;  4A9O A;  2R0Y A;  5DW1 A;  5E73 A;  4YAX A;  4UIY A;  4QC3 A;  4LR6 A;  5ENC A;  3U5L A;  5DY7 A;  4QEW A;  4QZS A;  5CPE A;  5ENB A;  1WUM A;  4YYH A;  5C87 A;  1JM4 B;  5HFQ A;  5A82 A;  2DVQ A;  5HFR A;  4J0S A;  5A5O A;  5ETD A;  4UIT A;  5F1H A;  5II2 A;  4HXK A;  5HEM A;  4LRG A;  5HLS A;  5FFV A;  4QSV A;  5BT3 A;  5EIC A;  5ENE A;  5C7N A;  4HBX A;  5CU8 A;  5TB6 A;  3UVY A;  5HQ5 A;  4UIW A;  2FSA A;  4AKN A;  3ERR A;  5ENF A;  4QSW A;  2DVS A;  3LQI A;  5A83 A;  4O72 A;  5F61 A;  4LZS A;  4NRA A;  4HXR A;  3ONI A;  4QYL A;  3ZYU A;  3VKH A;  4N4F A;  3P1F A;  5A7C A;  5ENG A;  4TT4 A;  4MR3 A;  4Q0N A;  4UYH A;  3UVD A;  4MEQ A;  5IG6 A;  5G4R A;  5AMF A;  5COI A;  3LQH A;  4C66 A;  5I7X A;  5CRZ A;  4NRC A;  3JVJ A;  4YAT A;  4IR4 A;  5D3L A;  5FBX A;  5HRX A;  5DFC A;  5D3S A;  4UYF B;  3O37 A;  3AAD A;  4O7E A;  4ALH A;  4Z1S A;  4TT6 A;  5EWH A;  5A5R A;  4AI6 A;  3U5M A;  3U5P A;  4OGI A;  4Z93 A;  5KO4 A;  3AQA A;  3HMH A;  3UV5 A;  4TS8 A;  3Q2F A;  3SVH A;  2WP1 A;  5FDZ A;  2L5E A;  2DWW A;  2LSP B;  5ENH A;  4Y03 A;  5E74 A;  5EPB A;  5HRW A;  5J0D A;  2D9E A;  4Q0O A;  4O71 A;  1WUG A;  4CUR A;  2YQD A;  3QZV A;  5DYU A;  4IOQ A;  3IU6 A;  4NR4 A;  5FE8 A;  5D3P A;  4NYW A;  4NR5 A;  3HMF A;  2RFJ A;  5IGK A;  5H85 A;  3VKG A;  5F60 A;  4YYD A;  4QC1 A;  5D25 A;  2DAT A;  4CUQ A;  4LYI A;  4ZQL A;  5I86 A;  5ENJ A;  5C85 A;  4KV1 A;  2E7N A;  5BT5 A;  4NUE A;  4YYM A;  5CQ7 A;  4CLB A;  5CGP A;  3SVF A;  4O7C A;  5KHM A;  5DKD A;  5I1Q A;  5K29 A;  4A9H A;  5F25 A;  5EI4 A;  4E96 A;  1ZKR A;  4MR6 A;  4O76 A;  4AKG A;  4QNS A;  5DLZ A;  5DLX A;  3UV2 A;  5L99 A;  3P5O A;  2EJN A;  2L85 A;  5IGM A;  5E9K A;  4X2I A;  3D1B A;  5BT4 A;  4QY4 A;  5E0R A;  5A81 A;  2R0S A;  4NUC A;  5DX4 A;  4YYK A;  5EGU A;  3O33 A;  3U5J A;  4LC2 A;  5LVQ A;  3GG3 A;  4NYV A;  2L84 A;  4Z1Q A;  4O70 A;  4IR5 A;  3K2J A;  4LYS A;  4WIV A;  4TQN A;  3DAI A;  5FH7 A;  5L8T A;  5IID A;  4UIX A;  5DYA A;  5E3D A;  5II1 A;  5G4S A;  4O7B A;  4ALG A;  5HM0 A;  4UYD A;  4XY8 A;  4HXL A;  4YYG A;  3U5O A;  4N4I A;  5H1T A;  5EU1 A;  2RS9 B;  3IU5 A;  5FG6 A;  4O78 A;  2RI7 A;  3FKM X;  4CUS A;  5HQ6 A;  2RNW A;  4PCE A;  5EPR A;  5F63 A;  3G0J A;  3I3J A;  5I83 A;  5A5P A;  5D3H A;  4TTE A;  2G4A A;  4NUD A;  4A9M A;  5H1U A;  4QSX A;  4XUA A;  2H60 A;  3P1E A;  4MR4 A;  4O75 A;  4CFK A;  5LUU A;  4N4H A;  5FE7 A;  4QSU A;  4YYI A;  4QUU A;  4YBM A;  5CQ6 A;  3JVK A;  4HBY A;  4YH4 A;  2YW5 A;  5FE9 A;  4QYD A;  5F3A A;  4YY6 A;  4O7F A;  3Q2E A;  5AD2 A;  4BW4 A;  5I80 A;  4ZW1 A;  5F1L A;  4OGJ A;  5ENI A;  5CP5 A;  3P1C A;  5CUG A;  3G0L A;  2GRC A;  5EWD A;  4CFL A;  4IR6 A;  3HME A;  4LYW A;  4YK0 A;  4YYN A;  5DFD A;  5CQT A;  4WHW A;  4QB3 A;  2YEK A;  4XUB A;  5D3J A;  3S91 A;  4LZR A;  3TLP A;  5CFW A;  5F5Z A;  1F68 A;  4O77 A;  1X0J A;  5E3G A;  5D0C A;  4BW2 A;  3U5N A;  4QUT A;  4PY6 A;  5EV9 A;  5D24 A;  5EPS A;  5DW2 A;  4A9E A;  3UVX A;  5LVR A;  4CUU A;  4AKH A;  4IR3 A;  4MEP A;  5HEL A;  3MB3 A;  5EIS A;  4UIV A;  5EQ1 A;  5A85 A;  5E9V A;  4A9L A;  3JVL A;  3SVG A;  4J3I A;  4GPJ A;  4YBS A;  4BHW A;  4NR7 A;  2WP2 A;  2RNX A;  4BW3 A;  5C4Q A;  4PKL A;  2E7O A;  4CL9 A;  4NR6 A;  5FB0 A;  5JWM A;  4NS5 A;  4A9K A;  2D82 A;  4YH3 A;  4YYJ A;  5F36 A;  2DKW A;  5FG5 A;  4UIZ A;  4XY9 A;  5D3R A;  5L97 A;  5C89 A;  5A5N A;  3UVW A;  5AME A;  4Z6I A;  4QSR A;  2RNY A;  4UYE A;  5FE3 A;  3O35 A;  4TZ8 A;  4J0R A;  4HXO A;  4LZ2 A;  4YBT A;  5DYC A;  3S92 A;  5D3N A;  4LDF A;  5E9M A;  4N3W A;  3MUK A;  4XYA A;  4UYG A;  5DFB A;  5EK9 A;  2I7K A;  4A9I A;  5FH8 A;  4TU4 A;  4QBM A;  4TU6 A;  5DKC A;  5FE2 A;  5A5S A;  5E9Y A;  5CQ4 A;  5JI8 A;  2YYN A;  4QST A;  4RVR A;  5L98 A;  4HXM A;  5HQ7 A;  5I88 A;  5HEN A;  5E7D A;  2F6J A;  3DWY A;  2RO1 A;  5L8U A;  3UV4 A;  4NRB A;  5CQA A;  4C67 A;  3LQJ A;  3RCW A;  5E9I A;  5IGN A;  2OUO A;  4HBV A;  5KTX A;  4O74 A;  5CZG A;  5CQ3 A;  5EP7 A;  5CY9 A;  5CUD A;  5KTW A;  4NYX A;  3O36 A;  4QEU A;  4BW1 A;  5AD3 A; 
#chains in the Genus database with same CATH homology
 1ZS5 A;  4QEV A;  4MEN A;  5CTL A;  5EM3 A;  4KV4 A;  4QR3 A;  5I40 A;  4IOR A;  5CS8 A;  2KTB B;  5CUB A;  5ETB A;  4TT2 A;  3QZT A;  1N72 A;  5ACY A;  5I7Y A;  5DBM A;  5LKU A;  3MUL A;  5F2P A;  3NXB A;  4NR8 A;  5EWW A;  4YAB A;  4KCX A;  5LJ1 A;  5LKT A;  3P1D A;  1EQF A;  4UIU A;  5IGL A;  5FE0 A;  5I29 A;  4HXP A;  4NR9 A;  5FG4 A;  4F3I A;  5CRM A;  5HCL A;  5FB1 A;  2DVV A;  5FFW A;  4YC9 A;  2R10 A;  5EWC A;  5C8G A;  4WHU A;  4YAD A;  4MR5 A;  4MEO A;  4QSQ A;  5CUA A;  4IOO A;  5E9L A;  4Z6H A;  3MQM A;  5FE4 A;  5D3T A;  4QR5 A;  5F62 A;  2YDW A;  4HXN A;  4A9J A;  5HRV A;  4A9F A;  4OUF A;  4ZC9 A;  4UYF A;  5CQ5 A;  5A5Q A;  2OSS A;  4BJX A;  4NQN A;  5D26 A;  4FLP A;  3D7C A;  3LXJ A;  4CUP A;  4J1P A;  2R0V A;  2YEL A;  5H1V A;  5CQ8 A;  5EWV A;  2MJV B;  4TYL A;  5HJC A;  3QZS A;  3MB4 A;  5FE1 A;  4NXJ A;  1JSP B;  5LKX A;  3U5K A;  5EA1 A;  5IBN A;  5I89 A;  4O7A A;  5LKZ A;  2I8N A;  5L96 A;  5LJ0 A;  5FFY A;  5FE5 A;  2F6N A;  2DVR A;  5CUC A;  4QR4 A;  4QSP A;  5DYX A;  5KTU A;  2NXB A;  4HXS A;  2YEM A;  4TZ2 A;  4DON A;  4YY4 A;  5DKH A;  2OO1 A;  3UW9 A;  2E3K A;  4QSS A;  4PTB A;  5D7X A;  4CUT A;  4A9N A;  4PCI A;  5EVA A;  5LJ2 A;  5TCM A;  5FE6 A;  4N4G A;  1E6I A;  2N9G A;  5KU3 A;  3LJW A;  3MXF A;  4NQM A;  3O34 A;  3JVM A;  5CUE A;  4HBW A;  5FH6 A;  4PS5 A;  4A9O A;  2R0Y A;  5DW1 A;  5E73 A;  4YAX A;  4UIY A;  4QC3 A;  4LR6 A;  5ENC A;  3U5L A;  5DY7 A;  4QEW A;  4QZS A;  5CPE A;  5ENB A;  1WUM A;  4YYH A;  5C87 A;  1JM4 B;  5HFQ A;  5A82 A;  2DVQ A;  5HFR A;  4J0S A;  5A5O A;  5ETD A;  4UIT A;  5F1H A;  5II2 A;  4HXK A;  5HEM A;  4LRG A;  5HLS A;  5FFV A;  4QSV A;  5BT3 A;  5EIC A;  5ENE A;  5C7N A;  4HBX A;  5CU8 A;  5TB6 A;  3UVY A;  5HQ5 A;  4UIW A;  2FSA A;  4AKN A;  5ENF A;  4QSW A;  2DVS A;  3LQI A;  5A83 A;  4O72 A;  5F61 A;  4LZS A;  4NRA A;  4HXR A;  3ONI A;  4QYL A;  3ZYU A;  4N4F A;  3P1F A;  5A7C A;  5ENG A;  4TT4 A;  4MR3 A;  4Q0N A;  4UYH A;  3UVD A;  4MEQ A;  5IG6 A;  5G4R A;  5AMF A;  5COI A;  3LQH A;  4C66 A;  5I7X A;  5CRZ A;  4NRC A;  3JVJ A;  4YAT A;  4IR4 A;  5D3L A;  5FBX A;  5HRX A;  5DFC A;  5D3S A;  4UYF B;  3O37 A;  3AAD A;  4O7E A;  4ALH A;  4Z1S A;  4TT6 A;  5EWH A;  5A5R A;  3U5M A;  3U5P A;  4OGI A;  4Z93 A;  5KO4 A;  3AQA A;  3HMH A;  3UV5 A;  4TS8 A;  3Q2F A;  3SVH A;  2WP1 A;  5FDZ A;  2L5E A;  2DWW A;  2LSP B;  5ENH A;  4Y03 A;  5E74 A;  5EPB A;  5HRW A;  5J0D A;  2D9E A;  4Q0O A;  4O71 A;  1WUG A;  4CUR A;  2YQD A;  3QZV A;  5DYU A;  4IOQ A;  3IU6 A;  4NR4 A;  5FE8 A;  5D3P A;  4NYW A;  4NR5 A;  3HMF A;  2RFJ A;  5IGK A;  5H85 A;  5F60 A;  4YYD A;  4QC1 A;  5D25 A;  2DAT A;  4CUQ A;  4LYI A;  4ZQL A;  5I86 A;  5ENJ A;  5C85 A;  4KV1 A;  2E7N A;  5BT5 A;  4NUE A;  4YYM A;  5CQ7 A;  4CLB A;  5CGP A;  3SVF A;  4O7C A;  5KHM A;  5DKD A;  5I1Q A;  5K29 A;  4A9H A;  5F25 A;  5EI4 A;  4E96 A;  4MR6 A;  4O76 A;  4QNS A;  5DLZ A;  5DLX A;  3UV2 A;  5L99 A;  3P5O A;  2L85 A;  5IGM A;  5E9K A;  4X2I A;  5BT4 A;  4QY4 A;  5E0R A;  5A81 A;  2R0S A;  4NUC A;  5DX4 A;  4YYK A;  5EGU A;  3O33 A;  3U5J A;  4LC2 A;  5LVQ A;  3GG3 A;  4NYV A;  2L84 A;  4Z1Q A;  4O70 A;  4IR5 A;  3K2J A;  4LYS A;  4WIV A;  4TQN A;  3DAI A;  5FH7 A;  5L8T A;  5IID A;  4UIX A;  5DYA A;  5E3D A;  5II1 A;  5G4S A;  4O7B A;  4ALG A;  5HM0 A;  4UYD A;  4XY8 A;  4HXL A;  4YYG A;  3U5O A;  4N4I A;  5H1T A;  5EU1 A;  2RS9 B;  3IU5 A;  5FG6 A;  4O78 A;  2RI7 A;  3FKM X;  4CUS A;  5HQ6 A;  2RNW A;  4PCE A;  5EPR A;  5F63 A;  3G0J A;  3I3J A;  5I83 A;  5A5P A;  5D3H A;  4TTE A;  2G4A A;  4NUD A;  4A9M A;  5H1U A;  4QSX A;  4XUA A;  2H60 A;  3P1E A;  4MR4 A;  4O75 A;  4CFK A;  5LUU A;  4N4H A;  5FE7 A;  4QSU A;  4YYI A;  4QUU A;  4YBM A;  5CQ6 A;  3JVK A;  4HBY A;  4YH4 A;  2YW5 A;  5FE9 A;  4QYD A;  5F3A A;  4YY6 A;  4O7F A;  3Q2E A;  5AD2 A;  4BW4 A;  5I80 A;  4ZW1 A;  5F1L A;  4OGJ A;  5ENI A;  5CP5 A;  3P1C A;  5CUG A;  3G0L A;  2GRC A;  5EWD A;  4CFL A;  4IR6 A;  3HME A;  4LYW A;  4YK0 A;  4YYN A;  5DFD A;  5CQT A;  4WHW A;  4QB3 A;  2YEK A;  4XUB A;  5D3J A;  3S91 A;  4LZR A;  3TLP A;  5CFW A;  5F5Z A;  1F68 A;  4O77 A;  1X0J A;  5E3G A;  5D0C A;  4BW2 A;  3U5N A;  4QUT A;  4PY6 A;  5EV9 A;  5D24 A;  5EPS A;  5DW2 A;  4A9E A;  3UVX A;  5LVR A;  4CUU A;  4IR3 A;  4MEP A;  5HEL A;  3MB3 A;  5EIS A;  4UIV A;  5EQ1 A;  5A85 A;  5E9V A;  4A9L A;  3JVL A;  3SVG A;  4J3I A;  4GPJ A;  4YBS A;  4BHW A;  4NR7 A;  2WP2 A;  2RNX A;  4BW3 A;  5C4Q A;  4PKL A;  2E7O A;  4CL9 A;  4NR6 A;  5FB0 A;  5JWM A;  4NS5 A;  4A9K A;  2D82 A;  4YH3 A;  4YYJ A;  5F36 A;  2DKW A;  5FG5 A;  4UIZ A;  4XY9 A;  5D3R A;  5L97 A;  5C89 A;  5A5N A;  3UVW A;  5AME A;  4Z6I A;  4QSR A;  2RNY A;  4UYE A;  5FE3 A;  3O35 A;  4TZ8 A;  4J0R A;  4HXO A;  4LZ2 A;  4YBT A;  5DYC A;  3S92 A;  5D3N A;  4LDF A;  5E9M A;  4N3W A;  3MUK A;  4XYA A;  4UYG A;  5DFB A;  5EK9 A;  2I7K A;  4A9I A;  5FH8 A;  4TU4 A;  4QBM A;  4TU6 A;  5DKC A;  5FE2 A;  5A5S A;  5E9Y A;  5CQ4 A;  5JI8 A;  2YYN A;  4QST A;  4RVR A;  5L98 A;  4HXM A;  5HQ7 A;  5I88 A;  5HEN A;  5E7D A;  2F6J A;  3DWY A;  2RO1 A;  5L8U A;  3UV4 A;  4NRB A;  5CQA A;  4C67 A;  3LQJ A;  3RCW A;  5E9I A;  5IGN A;  2OUO A;  4HBV A;  5KTX A;  4O74 A;  5CZG A;  5CQ3 A;  5EP7 A;  5CY9 A;  5CUD A;  5KTW A;  4NYX A;  3O36 A;  4QEU A;  4BW1 A;  5AD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...