4NYXA

Crystal structure of the bromodomain of human crebbp in complex with a dihydroquinoxalinone ligand
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
116
structure length
116
Chain Sequence
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords CREB-binding protein
publication title Crystal Structure of the Bromodomain of human CREBBP in complex with a dihydroquinoxalinone ligand
rcsb
source organism Homo sapiens
total genus 42
structure length 116
sequence length 116
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4nyxA00
4TS8A 5I7YA 5A5NA 4MEPA 5HQ5A 3DWYA 5ENEA 5FG6A 3UVYA 3P5OA 4QNSA 4O77A 5KHMA 4C66A 3JVLA 5G4SA 4QZSA 3U5LA 4YYMA 5ACYA 5AMEA 5KTWA 4PTBA 5HFQA 4MR5A 1ZS5A 4LRGA 4MR6A 4N4IA 4QR5A 5EV9A 4YYIA 5II1A 5HCLA 4HBXA 3MQMA 5A5OA 4NYVA 4NR9A 5E9LA 2NXBA 4A9OA 5I29A 2L84A 4ALGA 4A9LA 4QYDA 5DLZA 3IU5A 2R0SA 4CUQA 3MUKA 3P1CA 5CQ7A 5FH6A 5II2A 5DW2A 4WHWA 5EU1A 5FE9A 4TU6A 5LJ2A 5FE5A 3U5NA 3UV4A 5LJ1A 5HRVA 5FFWA 4QEVA 5EQ1A 3RCWA 2E7NA 4O70A 4UYFA 5COIA 4CFKA 5FE6A 5DY7A 5HELA 4Y03A 4O75A 5E3GA 4BW3A 2WP1A 5F2PA 5A5SA 5CQ3A 5CS8A 4O7AA 5ENHA 5LKUA 4N4FA 5ENJA 5E73A 5CQ6A 4A9HA 5EWCA 5LVQA 2L5EA 5F1LA 4X2IA 5I1QA 3IU6A 5E9MA 5JI8A 4YBTA 5CY9A 5CUAA 5A7CA 4PCEA 1JSPB 5A5RA 5LKZA 4NS5A 4UIUA 3I3JA 5EWHA 5F1HA 2DVQA 4QR3A 4TU4A 5E74A 5HM0A 4IR5A 5DFDA 5D3JA 3UV2A 4QC1A 5C7NA 3U5OA 3P1FA 4LDFA 5CGPA 4WIVA 3UV5A 4LYWA 5AD3A 5D7XA 4IOOA 4QUTA 4HXKA 2RFJA 4KV4A 2YYNA 4YY6A 5EGUA 4Z93A 2RS9B 5EPSA 2R0YA 4YC9A 5D26A 5F3AA 5DKCA 2D9EA 4NR7A 5ENIA 5KU3A 3UW9A 5IG6A 4E96A 4Z1QA 4CUPA 4YBMA 4HXSA 5IGLA 5I83A 5DKDA 5FH8A 4NR4A 5FFVA 4NQMA 4HXPA 3QZTA 5E3DA 5LJ0A 4QSUA 3NXBA 3P1DA 5TB6A 4TQNA 5EI4A 5EVAA 5C87A 4MEQA 5IGKA 3O34A 2RI7A 5ENCA 5L8TA 4IR6A 3O36A 5DW1A 5DYUA 5IGNA 4QYLA 3ONIA 4YADA 5IGMA 2DVVA 5CTLA 5EM3A 2L85A 4MR4A 4ZC9A 5DX4A 2E3KA 5I88A 2F6NA 2RO1A 4TYLA 5D24A 4A9MA 4YY4A 4BW1A 5CUGA 3HMFA 4UYFB 5I86A 4UITA 3LQJA 4MEOA 4BW2A 4O72A 2H60A 1WUMA 5L96A 5EA1A 2R0VA 5I40A 4HBVA 4YYJA 3MB3A 5CQ4A 5ENFA 3MB4A 4YK0A 5EPBA 5F63A 4O7EA 5EPRA 3AADA 4YYNA 5HQ7A 3O37A 4UYGA 4BW4A 5ENBA 4BHWA 2I8NA 4LZRA 4QSRA 4UIZA 4UYDA 3U5PA 4QC3A 5C4QA 5E9KA 5KO4A 4RVRA 4LZSA 4FLPA 4UIYA 5E9VA 3GG3A 5I89A 4HXRA 4NRAA 4F3IA 5EWDA 4NXJA 2OO1A 4OUFA 5L98A 4QSSA 4PS5A 5CUDA 5FE3A 5EWVA 3O33A 5FH7A 3SVFA 5L99A 4A9FA 5TCMA 5FFYA 4UIWA 4QUUA 4YYDA 4HBWA 2LSPB 2DVSA 4Q0NA 5H1VA 4YYHA 4IR4A 5FE0A 4YYKA 4XYAA 5CUCA 4TT4A 4CLBA 5F5ZA 4NRCA 4YH4A 4HXOA 5CUBA 4ALHA 3UVWA 4GPJA 5E9IA 5DYAA 4TTEA 3HMEA 5E7DA 5ETBA 3TLPA 4O74A 5F36A 4HXLA 3HMHA 5CZGA 4N4HA 4LC2A 3LQHA 3MULA 4PCIA 5E9YA 5A81A 1WUGA 4TZ2A 5IBNA 5HJCA 5A5PA 1E6IA 4TT6A 4DONA 4LR6A 4C67A 4YBSA 2YDWA 3UVDA 4CUUA 4XUAA 2D82A 4QSVA 4WHUA 5AMFA 5EISA 4Z1SA 4LYSA 5HRXA 4A9EA 4PKLA 1EQFA 5FG5A 5HRWA 2YELA 5DYXA 5FE8A 5CRZA 5K29A 3U5JA 4NRBA 5D3RA 5HLSA 4NUEA 3D7CA 4CUSA 3FKMX 4CUTA 4IOQA 4QR4A 2R10A 5CPEA 4A9JA 4XY8A 3LXJA 5FDZA 4XUBA 2N9GA 5C89A 4A9KA 5HEMA 5AD2A 5CQAA 3JVMA 4O71A 4TZ8A 5DKHA 4ZW1A 3Q2EA 4Z6IA 1JM4B 4OGJA 4NR6A 5EICA 4YYGA 4MR3A 2YQDA 3UVXA 4QEWA 5L97A 5FG4A 4O78A 4A9IA 4NR5A 5HFRA 5C8GA 5JWMA 5DFBA 4BJXA 4LZ2A 2DWWA 3MXFA 2OSSA 5CP5A 4O7BA 5LKTA 5CFWA 4OGIA 4NUDA 5E0RA 5FE2A 4YH3A 5HQ6A 5KTUA 2DKWA 4HXMA 5D3LA 5FE7A 4UIXA 4Q0OA 5F25A 5ENGA 2RNWA 2YEMA 4O7FA 2KTBB 5FB1A 5A85A 4J1PA 5D3SA 5A83A 4YAXA 5F62A 4NR8A 4NYXA 5CRMA 5DYCA 5CQ8A 3ZYUA 3G0JA 3DAIA 4HXNA 4Z6HA 5C85A 3S91A 4N4GA 5HENA 3U5MA 5I80A 4IORA 5D25A 2DVRA 4CL9A 2YEKA 3JVKA 3S92A 5CQTA 4KCXA 4UYEA 3JVJA 2RNXA 5BT4A 3K2JA 4MENA 5D3NA 2GRCA 3QZSA 4TT2A 5F60A 4QSWA 5DBMA 5H85A 5EP7A 4LYIA 5FB0A 4A9NA 3U5KA 4YATA 1F68A 2DATA 5DLXA 1X0JA 5F61A 5J0DA 4QB3A 4QSTA 4O76A 5IIDA 3QZVA 2F6JA 4J0SA 5H1TA 3SVHA 4QSXA 3O35A 4J3IA 4QSQA 5FE4A 4QBMA 2G4AA 3Q2FA 1N72A 4UYHA 5CQ5A 5LVRA 3LJWA 5D3TA 5BT5A 5A82A 4XY9A 2WP2A 5G4RA 5KTXA 4CFLA 3SVGA 5EK9A 4J0RA 4NQNA 4PY6A 4QSPA 4YABA 5ETDA 4QY4A 2YW5A 4UIVA 4KV1A 3AQAA 2E7OA 5L8UA 5FBXA 5BT3A 3G0LA 2MJVB 5DFCA 5CU8A 5FE1A 2OUOA 4QEUA 2RNYA 5LKXA 4IR3A 4ZQLA 4NYWA 4O7CA 5I7XA 4N3WA 5H1UA 5CUEA 5EWWA 3P1EA 5A5QA 2FSAA 2I7KA 3LQIA 5D3HA 5D0CA 5LUUA 4HBYA 5D3PA 4AKNA 4NUCA 4CURA
chains in the Genus database with same CATH superfamily
4TS8A 5I7YA 3VKGA 5A5NA 4MEPA 5HQ5A 3DWYA 5ENEA 5FG6A 3UVYA 3P5OA 4QNSA 4O77A 5KHMA 4C66A 3JVLA 5G4SA 4QZSA 3U5LA 4YYMA 5ACYA 5AMEA 5KTWA 4PTBA 5HFQA 4MR5A 1ZS5A 4LRGA 4MR6A 4N4IA 4QR5A 5EV9A 4YYIA 5II1A 5HCLA 4HBXA 3MQMA 5A5OA 4NYVA 4AI6A 4NR9A 5E9LA 2NXBA 4A9OA 5I29A 2L84A 4ALGA 4A9LA 4QYDA 5DLZA 3IU5A 2R0SA 4CUQA 3MUKA 3P1CA 5CQ7A 5FH6A 5II2A 5DW2A 4WHWA 5EU1A 5FE9A 4TU6A 5LJ2A 5FE5A 3U5NA 3UV4A 5LJ1A 5HRVA 5FFWA 4QEVA 5EQ1A 3RCWA 2E7NA 4O70A 4UYFA 5COIA 4CFKA 5FE6A 5DY7A 5HELA 4Y03A 4O75A 5E3GA 4BW3A 2WP1A 5F2PA 5A5SA 5CQ3A 5CS8A 4O7AA 5ENHA 5LKUA 4N4FA 5ENJA 5E73A 5CQ6A 4A9HA 5EWCA 5LVQA 2L5EA 5F1LA 4X2IA 5I1QA 3IU6A 5E9MA 5JI8A 4YBTA 5CY9A 5CUAA 5A7CA 4PCEA 1JSPB 5A5RA 5LKZA 4NS5A 4UIUA 3I3JA 5EWHA 5F1HA 2DVQA 4QR3A 4TU4A 5E74A 5HM0A 4IR5A 5DFDA 5D3JA 3UV2A 4QC1A 5C7NA 3U5OA 3P1FA 4LDFA 5CGPA 4AKGA 4WIVA 3UV5A 4LYWA 5AD3A 5D7XA 4IOOA 4QUTA 4HXKA 2RFJA 4KV4A 2YYNA 1ZKRA 4YY6A 5EGUA 4Z93A 2RS9B 5EPSA 2R0YA 4YC9A 5D26A 5F3AA 5DKCA 2D9EA 4NR7A 5ENIA 5KU3A 3UW9A 5IG6A 4E96A 4Z1QA 4CUPA 4YBMA 4HXSA 5IGLA 5I83A 5DKDA 5FH8A 4NR4A 5FFVA 4NQMA 4HXPA 3QZTA 5E3DA 5LJ0A 4QSUA 3NXBA 3P1DA 5TB6A 4TQNA 5EI4A 5EVAA 5C87A 4MEQA 5IGKA 3O34A 2RI7A 5ENCA 5L8TA 4IR6A 3O36A 5DW1A 5DYUA 5IGNA 4QYLA 3VKHA 3ONIA 4YADA 5IGMA 2DVVA 5CTLA 5EM3A 2L85A 4MR4A 4ZC9A 4AKHA 5DX4A 2E3KA 5I88A 2F6NA 2RO1A 4TYLA 5D24A 4A9MA 4YY4A 4BW1A 5CUGA 3HMFA 4UYFB 5I86A 4UITA 3LQJA 4MEOA 4BW2A 4O72A 2H60A 1WUMA 5L96A 5EA1A 2R0VA 5I40A 4HBVA 4YYJA 3MB3A 5CQ4A 5ENFA 3MB4A 4YK0A 5EPBA 5F63A 4O7EA 5EPRA 3AADA 4YYNA 5HQ7A 3O37A 4UYGA 4BW4A 5ENBA 4BHWA 2I8NA 4LZRA 4QSRA 4UIZA 4UYDA 3U5PA 4QC3A 5C4QA 5E9KA 5KO4A 4RVRA 4LZSA 4FLPA 4UIYA 5E9VA 3GG3A 5I89A 4HXRA 4NRAA 4F3IA 5EWDA 4NXJA 2OO1A 4OUFA 5L98A 4QSSA 4PS5A 5CUDA 5FE3A 5EWVA 3O33A 5FH7A 3SVFA 5L99A 4A9FA 5TCMA 5FFYA 4UIWA 4QUUA 4YYDA 4HBWA 2LSPB 2DVSA 4Q0NA 5H1VA 4YYHA 4IR4A 5FE0A 4YYKA 4XYAA 5CUCA 4TT4A 4CLBA 5F5ZA 4NRCA 4YH4A 4HXOA 5CUBA 4ALHA 3UVWA 4GPJA 5E9IA 5DYAA 4TTEA 3HMEA 5E7DA 5ETBA 3TLPA 4O74A 5F36A 4HXLA 3HMHA 5CZGA 4N4HA 4LC2A 3LQHA 3MULA 4PCIA 5E9YA 5A81A 1WUGA 4TZ2A 5IBNA 5HJCA 5A5PA 1PUOA 1E6IA 4TT6A 4DONA 4LR6A 4C67A 4YBSA 2YDWA 3UVDA 4CUUA 4XUAA 2D82A 4QSVA 4WHUA 5AMFA 5EISA 4Z1SA 4LYSA 5HRXA 4A9EA 4PKLA 1EQFA 5FG5A 5HRWA 2YELA 5DYXA 5FE8A 5CRZA 5K29A 3U5JA 4NRBA 5D3RA 5HLSA 4NUEA 3D7CA 4CUSA 3FKMX 4CUTA 4IOQA 4QR4A 2R10A 5CPEA 4A9JA 4XY8A 3LXJA 5FDZA 4XUBA 2N9GA 5C89A 4A9KA 5HEMA 5AD2A 5CQAA 3JVMA 4O71A 4TZ8A 5DKHA 4ZW1A 3Q2EA 4Z6IA 1JM4B 4OGJA 4NR6A 5EICA 4YYGA 4MR3A 2YQDA 3UVXA 4QEWA 5L97A 5FG4A 4O78A 4A9IA 4NR5A 5HFRA 5C8GA 5JWMA 5DFBA 4BJXA 4LZ2A 2DWWA 3MXFA 2OSSA 5CP5A 4O7BA 3D1DA 5LKTA 5CFWA 4OGIA 4NUDA 5E0RA 5FE2A 4YH3A 5HQ6A 5KTUA 2DKWA 4HXMA 5D3LA 5FE7A 4UIXA 4Q0OA 5F25A 5ENGA 2RNWA 2YEMA 4O7FA 2KTBB 5FB1A 5A85A 4J1PA 5D3SA 5A83A 4YAXA 5F62A 4NR8A 4NYXA 5CRMA 5DYCA 5CQ8A 3ZYUA 3G0JA 3DAIA 4HXNA 4Z6HA 5C85A 3S91A 4N4GA 5HENA 3U5MA 5I80A 4IORA 5D25A 2DVRA 4CL9A 2YEKA 3JVKA 3S92A 5CQTA 4KCXA 4UYEA 3JVJA 2RNXA 5BT4A 3K2JA 4MENA 5D3NA 2GRCA 3QZSA 4TT2A 5F60A 4QSWA 5DBMA 5H85A 5EP7A 4LYIA 5FB0A 4A9NA 3U5KA 4YATA 1F68A 2DATA 5DLXA 1X0JA 5F61A 5J0DA 4QB3A 4QSTA 4O76A 5IIDA 3QZVA 2F6JA 4J0SA 5H1TA 3SVHA 4QSXA 3O35A 4J3IA 4QSQA 5FE4A 4QBMA 2G4AA 3Q2FA 1N72A 4UYHA 5CQ5A 5LVRA 3LJWA 5D3TA 5BT5A 5A82A 3D1BA 4XY9A 2WP2A 5G4RA 5KTXA 4CFLA 3SVGA 5EK9A 3ERRA 4J0RA 4NQNA 4PY6A 4QSPA 4YABA 5ETDA 4QY4A 2YW5A 4UIVA 4KV1A 3AQAA 2E7OA 5L8UA 5FBXA 5BT3A 3G0LA 2MJVB 5DFCA 5CU8A 5FE1A 2OUOA 4QEUA 2RNYA 5LKXA 4IR3A 4ZQLA 4NYWA 4O7CA 5I7XA 4N3WA 5H1UA 5CUEA 5EWWA 3P1EA 5A5QA 2FSAA 2I7KA 3LQIA 5D3HA 5D0CA 5LUUA 4HBYA 5D3PA 4AKNA 4AKIA 4NUCA 4CURA 2EJNA
chains in the Genus database with same CATH topology
4TS8A 5I7YA 5A5NA 4MEPA 5HQ5A 3DWYA 5ENEA 5FG6A 3UVYA 3P5OA 4QNSA 4O77A 5KHMA 4C66A 3JVLA 5G4SA 4QZSA 3U5LA 4YYMA 5ACYA 5AMEA 5KTWA 4PTBA 5HFQA 4MR5A 1ZS5A 4LRGA 4MR6A 4N4IA 4QR5A 5EV9A 4YYIA 5II1A 5HCLA 4HBXA 3MQMA 5A5OA 4NYVA 4NR9A 5E9LA 2NXBA 4A9OA 5I29A 2L84A 4ALGA 4A9LA 4QYDA 5DLZA 3IU5A 2R0SA 4CUQA 3MUKA 3P1CA 5CQ7A 5FH6A 5II2A 5DW2A 4WHWA 5EU1A 5FE9A 4TU6A 5LJ2A 5FE5A 3U5NA 3UV4A 5LJ1A 5HRVA 5FFWA 4QEVA 5EQ1A 3RCWA 2E7NA 4O70A 4UYFA 5COIA 4CFKA 5FE6A 5DY7A 5HELA 4Y03A 4O75A 5E3GA 4BW3A 2WP1A 5F2PA 5A5SA 5CQ3A 5CS8A 4O7AA 5ENHA 5LKUA 4N4FA 5ENJA 5E73A 5CQ6A 4A9HA 5EWCA 5LVQA 2L5EA 5F1LA 4X2IA 5I1QA 3IU6A 5E9MA 5JI8A 4YBTA 5CY9A 5CUAA 5A7CA 4PCEA 1JSPB 5A5RA 5LKZA 4NS5A 4UIUA 3I3JA 5EWHA 5F1HA 2DVQA 4QR3A 4TU4A 5E74A 5HM0A 4IR5A 5DFDA 5D3JA 3UV2A 4QC1A 5C7NA 3U5OA 3P1FA 4LDFA 5CGPA 4WIVA 3UV5A 4LYWA 5AD3A 5D7XA 4IOOA 4QUTA 4HXKA 2RFJA 4KV4A 2YYNA 4YY6A 5EGUA 4Z93A 2RS9B 5EPSA 2R0YA 4YC9A 5D26A 5F3AA 5DKCA 2D9EA 4NR7A 5ENIA 5KU3A 3UW9A 5IG6A 4E96A 4Z1QA 4CUPA 4YBMA 4HXSA 5IGLA 5I83A 5DKDA 5FH8A 4NR4A 5FFVA 4NQMA 4HXPA 3QZTA 5E3DA 5LJ0A 4QSUA 3NXBA 3P1DA 5TB6A 4TQNA 5EI4A 5EVAA 5C87A 4MEQA 5IGKA 3O34A 2RI7A 5ENCA 5L8TA 4IR6A 3O36A 5DW1A 5DYUA 5IGNA 4QYLA 3ONIA 4YADA 5IGMA 2DVVA 5CTLA 5EM3A 2L85A 4MR4A 4ZC9A 5DX4A 2E3KA 5I88A 2F6NA 2RO1A 4TYLA 5D24A 4A9MA 4YY4A 4BW1A 5CUGA 3HMFA 4UYFB 5I86A 4UITA 3LQJA 4MEOA 4BW2A 4O72A 2H60A 1WUMA 5L96A 5EA1A 2R0VA 5I40A 4HBVA 4YYJA 3MB3A 5CQ4A 5ENFA 3MB4A 4YK0A 5EPBA 5F63A 4O7EA 5EPRA 3AADA 4YYNA 5HQ7A 3O37A 4UYGA 4BW4A 5ENBA 4BHWA 2I8NA 4LZRA 4QSRA 4UIZA 4UYDA 3U5PA 4QC3A 5C4QA 5E9KA 5KO4A 4RVRA 4LZSA 4FLPA 4UIYA 5E9VA 3GG3A 5I89A 4HXRA 4NRAA 4F3IA 5EWDA 4NXJA 2OO1A 4OUFA 5L98A 4QSSA 4PS5A 5CUDA 5FE3A 5EWVA 3O33A 5FH7A 3SVFA 5L99A 4A9FA 5TCMA 5FFYA 4UIWA 4QUUA 4YYDA 4HBWA 2LSPB 2DVSA 4Q0NA 5H1VA 4YYHA 4IR4A 5FE0A 4YYKA 4XYAA 5CUCA 4TT4A 4CLBA 5F5ZA 4NRCA 4YH4A 4HXOA 5CUBA 4ALHA 3UVWA 4GPJA 5E9IA 5DYAA 4TTEA 3HMEA 5E7DA 5ETBA 3TLPA 4O74A 5F36A 4HXLA 3HMHA 5CZGA 4N4HA 4LC2A 3LQHA 3MULA 4PCIA 5E9YA 5A81A 1WUGA 4TZ2A 5IBNA 5HJCA 5A5PA 1E6IA 4TT6A 4DONA 4LR6A 4C67A 4YBSA 2YDWA 3UVDA 4CUUA 4XUAA 2D82A 4QSVA 4WHUA 5AMFA 5EISA 4Z1SA 4LYSA 5HRXA 4A9EA 4PKLA 1EQFA 5FG5A 5HRWA 2YELA 5DYXA 5FE8A 5CRZA 5K29A 3U5JA 4NRBA 5D3RA 5HLSA 4NUEA 3D7CA 4CUSA 3FKMX 4CUTA 4IOQA 4QR4A 2R10A 5CPEA 4A9JA 4XY8A 3LXJA 5FDZA 4XUBA 2N9GA 5C89A 4A9KA 5HEMA 5AD2A 5CQAA 3JVMA 4O71A 4TZ8A 5DKHA 4ZW1A 3Q2EA 4Z6IA 1JM4B 4OGJA 4NR6A 5EICA 4YYGA 4MR3A 2YQDA 3UVXA 4QEWA 5L97A 5FG4A 4O78A 4A9IA 4NR5A 5HFRA 5C8GA 5JWMA 5DFBA 4BJXA 4LZ2A 2DWWA 3MXFA 2OSSA 5CP5A 4O7BA 5LKTA 5CFWA 4OGIA 4NUDA 5E0RA 5FE2A 4YH3A 5HQ6A 5KTUA 2DKWA 4HXMA 5D3LA 5FE7A 4UIXA 4Q0OA 5F25A 5ENGA 2RNWA 2YEMA 4O7FA 2KTBB 5FB1A 5A85A 4J1PA 5D3SA 5A83A 4YAXA 5F62A 4NR8A 4NYXA 5CRMA 5DYCA 5CQ8A 3ZYUA 3G0JA 3DAIA 4HXNA 4Z6HA 5C85A 3S91A 4N4GA 5HENA 3U5MA 5I80A 4IORA 5D25A 2DVRA 4CL9A 2YEKA 3JVKA 3S92A 5CQTA 4KCXA 4UYEA 3JVJA 2RNXA 5BT4A 3K2JA 4MENA 5D3NA 2GRCA 3QZSA 4TT2A 5F60A 4QSWA 5DBMA 5H85A 5EP7A 4LYIA 5FB0A 4A9NA 3U5KA 4YATA 1F68A 2DATA 5DLXA 1X0JA 5F61A 5J0DA 4QB3A 4QSTA 4O76A 5IIDA 3QZVA 2F6JA 4J0SA 5H1TA 3SVHA 4QSXA 3O35A 4J3IA 4QSQA 5FE4A 4QBMA 2G4AA 3Q2FA 1N72A 4UYHA 5CQ5A 5LVRA 3LJWA 5D3TA 5BT5A 5A82A 4XY9A 2WP2A 5G4RA 5KTXA 4CFLA 3SVGA 5EK9A 4J0RA 4NQNA 4PY6A 4QSPA 4YABA 5ETDA 4QY4A 2YW5A 4UIVA 4KV1A 3AQAA 2E7OA 5L8UA 5FBXA 5BT3A 3G0LA 2MJVB 5DFCA 5CU8A 5FE1A 2OUOA 4QEUA 2RNYA 5LKXA 4IR3A 4ZQLA 4NYWA 4O7CA 5I7XA 4N3WA 5H1UA 5CUEA 5EWWA 3P1EA 5A5QA 2FSAA 2I7KA 3LQIA 5D3HA 5D0CA 5LUUA 4HBYA 5D3PA 4AKNA 4NUCA 4CURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TS8 A;  5I7Y A;  5A5N A;  4MEP A;  5HQ5 A;  3DWY A;  5ENE A;  5FG6 A;  3UVY A;  3P5O A;  4QNS A;  4O77 A;  5KHM A;  4C66 A;  3JVL A;  5G4S A;  4QZS A;  3U5L A;  4YYM A;  5ACY A;  5AME A;  5KTW A;  4PTB A;  5HFQ A;  4MR5 A;  1ZS5 A;  4LRG A;  4MR6 A;  4N4I A;  4QR5 A;  5EV9 A;  4YYI A;  5II1 A;  5HCL A;  4HBX A;  3MQM A;  5A5O A;  4NYV A;  4NR9 A;  5E9L A;  2NXB A;  4A9O A;  5I29 A;  2L84 A;  4ALG A;  4A9L A;  4QYD A;  5DLZ A;  3IU5 A;  2R0S A;  4CUQ A;  3MUK A;  3P1C A;  5CQ7 A;  5FH6 A;  5II2 A;  5DW2 A;  4WHW A;  5EU1 A;  5FE9 A;  4TU6 A;  5LJ2 A;  5FE5 A;  3U5N A;  3UV4 A;  5LJ1 A;  5HRV A;  5FFW A;  4QEV A;  5EQ1 A;  3RCW A;  2E7N A;  4O70 A;  4UYF A;  5COI A;  4CFK A;  5FE6 A;  5DY7 A;  5HEL A;  4Y03 A;  4O75 A;  5E3G A;  4BW3 A;  2WP1 A;  5F2P A;  5A5S A;  5CQ3 A;  5CS8 A;  4O7A A;  5ENH A;  5LKU A;  4N4F A;  5ENJ A;  5E73 A;  5CQ6 A;  4A9H A;  5EWC A;  5LVQ A;  2L5E A;  5F1L A;  4X2I A;  5I1Q A;  3IU6 A;  5E9M A;  5JI8 A;  4YBT A;  5CY9 A;  5CUA A;  5A7C A;  4PCE A;  1JSP B;  5A5R A;  5LKZ A;  4NS5 A;  4UIU A;  3I3J A;  5EWH A;  5F1H A;  2DVQ A;  4QR3 A;  4TU4 A;  5E74 A;  5HM0 A;  4IR5 A;  5DFD A;  5D3J A;  3UV2 A;  4QC1 A;  5C7N A;  3U5O A;  3P1F A;  4LDF A;  5CGP A;  4WIV A;  3UV5 A;  4LYW A;  5AD3 A;  5D7X A;  4IOO A;  4QUT A;  4HXK A;  2RFJ A;  4KV4 A;  2YYN A;  4YY6 A;  5EGU A;  4Z93 A;  2RS9 B;  5EPS A;  2R0Y A;  4YC9 A;  5D26 A;  5F3A A;  5DKC A;  2D9E A;  4NR7 A;  5ENI A;  5KU3 A;  3UW9 A;  5IG6 A;  4E96 A;  4Z1Q A;  4CUP A;  4YBM A;  4HXS A;  5IGL A;  5I83 A;  5DKD A;  5FH8 A;  4NR4 A;  5FFV A;  4NQM A;  4HXP A;  3QZT A;  5E3D A;  5LJ0 A;  4QSU A;  3NXB A;  3P1D A;  5TB6 A;  4TQN A;  5EI4 A;  5EVA A;  5C87 A;  4MEQ A;  5IGK A;  3O34 A;  2RI7 A;  5ENC A;  5L8T A;  4IR6 A;  3O36 A;  5DW1 A;  5DYU A;  5IGN A;  4QYL A;  3ONI A;  4YAD A;  5IGM A;  2DVV A;  5CTL A;  5EM3 A;  2L85 A;  4MR4 A;  4ZC9 A;  5DX4 A;  2E3K A;  5I88 A;  2F6N A;  2RO1 A;  4TYL A;  5D24 A;  4A9M A;  4YY4 A;  4BW1 A;  5CUG A;  3HMF A;  4UYF B;  5I86 A;  4UIT A;  3LQJ A;  4MEO A;  4BW2 A;  4O72 A;  2H60 A;  1WUM A;  5L96 A;  5EA1 A;  2R0V A;  5I40 A;  4HBV A;  4YYJ A;  3MB3 A;  5CQ4 A;  5ENF A;  3MB4 A;  4YK0 A;  5EPB A;  5F63 A;  4O7E A;  5EPR A;  3AAD A;  4YYN A;  5HQ7 A;  3O37 A;  4UYG A;  4BW4 A;  5ENB A;  4BHW A;  2I8N A;  4LZR A;  4QSR A;  4UIZ A;  4UYD A;  3U5P A;  4QC3 A;  5C4Q A;  5E9K A;  5KO4 A;  4RVR A;  4LZS A;  4FLP A;  4UIY A;  5E9V A;  3GG3 A;  5I89 A;  4HXR A;  4NRA A;  4F3I A;  5EWD A;  4NXJ A;  2OO1 A;  4OUF A;  5L98 A;  4QSS A;  4PS5 A;  5CUD A;  5FE3 A;  5EWV A;  3O33 A;  5FH7 A;  3SVF A;  5L99 A;  4A9F A;  5TCM A;  5FFY A;  4UIW A;  4QUU A;  4YYD A;  4HBW A;  2LSP B;  2DVS A;  4Q0N A;  5H1V A;  4YYH A;  4IR4 A;  5FE0 A;  4YYK A;  4XYA A;  5CUC A;  4TT4 A;  4CLB A;  5F5Z A;  4NRC A;  4YH4 A;  4HXO A;  5CUB A;  4ALH A;  3UVW A;  4GPJ A;  5E9I A;  5DYA A;  4TTE A;  3HME A;  5E7D A;  5ETB A;  3TLP A;  4O74 A;  5F36 A;  4HXL A;  3HMH A;  5CZG A;  4N4H A;  4LC2 A;  3LQH A;  3MUL A;  4PCI A;  5E9Y A;  5A81 A;  1WUG A;  4TZ2 A;  5IBN A;  5HJC A;  5A5P A;  1E6I A;  4TT6 A;  4DON A;  4LR6 A;  4C67 A;  4YBS A;  2YDW A;  3UVD A;  4CUU A;  4XUA A;  2D82 A;  4QSV A;  4WHU A;  5AMF A;  5EIS A;  4Z1S A;  4LYS A;  5HRX A;  4A9E A;  4PKL A;  1EQF A;  5FG5 A;  5HRW A;  2YEL A;  5DYX A;  5FE8 A;  5CRZ A;  5K29 A;  3U5J A;  4NRB A;  5D3R A;  5HLS A;  4NUE A;  3D7C A;  4CUS A;  3FKM X;  4CUT A;  4IOQ A;  4QR4 A;  2R10 A;  5CPE A;  4A9J A;  4XY8 A;  3LXJ A;  5FDZ A;  4XUB A;  2N9G A;  5C89 A;  4A9K A;  5HEM A;  5AD2 A;  5CQA A;  3JVM A;  4O71 A;  4TZ8 A;  5DKH A;  4ZW1 A;  3Q2E A;  4Z6I A;  1JM4 B;  4OGJ A;  4NR6 A;  5EIC A;  4YYG A;  4MR3 A;  2YQD A;  3UVX A;  4QEW A;  5L97 A;  5FG4 A;  4O78 A;  4A9I A;  4NR5 A;  5HFR A;  5C8G A;  5JWM A;  5DFB A;  4BJX A;  4LZ2 A;  2DWW A;  3MXF A;  2OSS A;  5CP5 A;  4O7B A;  5LKT A;  5CFW A;  4OGI A;  4NUD A;  5E0R A;  5FE2 A;  4YH3 A;  5HQ6 A;  5KTU A;  2DKW A;  4HXM A;  5D3L A;  5FE7 A;  4UIX A;  4Q0O A;  5F25 A;  5ENG A;  2RNW A;  2YEM A;  4O7F A;  2KTB B;  5FB1 A;  5A85 A;  4J1P A;  5D3S A;  5A83 A;  4YAX A;  5F62 A;  4NR8 A;  4NYX A;  5CRM A;  5DYC A;  5CQ8 A;  3ZYU A;  3G0J A;  3DAI A;  4HXN A;  4Z6H A;  5C85 A;  3S91 A;  4N4G A;  5HEN A;  3U5M A;  5I80 A;  4IOR A;  5D25 A;  2DVR A;  4CL9 A;  2YEK A;  3JVK A;  3S92 A;  5CQT A;  4KCX A;  4UYE A;  3JVJ A;  2RNX A;  5BT4 A;  3K2J A;  4MEN A;  5D3N A;  2GRC A;  3QZS A;  4TT2 A;  5F60 A;  4QSW A;  5DBM A;  5H85 A;  5EP7 A;  4LYI A;  5FB0 A;  4A9N A;  3U5K A;  4YAT A;  1F68 A;  2DAT A;  5DLX A;  1X0J A;  5F61 A;  5J0D A;  4QB3 A;  4QST A;  4O76 A;  5IID A;  3QZV A;  2F6J A;  4J0S A;  5H1T A;  3SVH A;  4QSX A;  3O35 A;  4J3I A;  4QSQ A;  5FE4 A;  4QBM A;  2G4A A;  3Q2F A;  1N72 A;  4UYH A;  5CQ5 A;  5LVR A;  3LJW A;  5D3T A;  5BT5 A;  5A82 A;  4XY9 A;  2WP2 A;  5G4R A;  5KTX A;  4CFL A;  3SVG A;  5EK9 A;  4J0R A;  4NQN A;  4PY6 A;  4QSP A;  4YAB A;  5ETD A;  4QY4 A;  2YW5 A;  4UIV A;  4KV1 A;  3AQA A;  2E7O A;  5L8U A;  5FBX A;  5BT3 A;  3G0L A;  2MJV B;  5DFC A;  5CU8 A;  5FE1 A;  2OUO A;  4QEU A;  2RNY A;  5LKX A;  4IR3 A;  4ZQL A;  4NYW A;  4O7C A;  5I7X A;  4N3W A;  5H1U A;  5CUE A;  5EWW A;  3P1E A;  5A5Q A;  2FSA A;  2I7K A;  3LQI A;  5D3H A;  5D0C A;  5LUU A;  4HBY A;  5D3P A;  4AKN A;  4NUC A;  4CUR A; 
#chains in the Genus database with same CATH topology
 4TS8 A;  5I7Y A;  3VKG A;  5A5N A;  4MEP A;  5HQ5 A;  3DWY A;  5ENE A;  5FG6 A;  3UVY A;  3P5O A;  4QNS A;  4O77 A;  5KHM A;  4C66 A;  3JVL A;  5G4S A;  4QZS A;  3U5L A;  4YYM A;  5ACY A;  5AME A;  5KTW A;  4PTB A;  5HFQ A;  4MR5 A;  1ZS5 A;  4LRG A;  4MR6 A;  4N4I A;  4QR5 A;  5EV9 A;  4YYI A;  5II1 A;  5HCL A;  4HBX A;  3MQM A;  5A5O A;  4NYV A;  4AI6 A;  4NR9 A;  5E9L A;  2NXB A;  4A9O A;  5I29 A;  2L84 A;  4ALG A;  4A9L A;  4QYD A;  5DLZ A;  3IU5 A;  2R0S A;  4CUQ A;  3MUK A;  3P1C A;  5CQ7 A;  5FH6 A;  5II2 A;  5DW2 A;  4WHW A;  5EU1 A;  5FE9 A;  4TU6 A;  5LJ2 A;  5FE5 A;  3U5N A;  3UV4 A;  5LJ1 A;  5HRV A;  5FFW A;  4QEV A;  5EQ1 A;  3RCW A;  2E7N A;  4O70 A;  4UYF A;  5COI A;  4CFK A;  5FE6 A;  5DY7 A;  5HEL A;  4Y03 A;  4O75 A;  5E3G A;  4BW3 A;  2WP1 A;  5F2P A;  5A5S A;  5CQ3 A;  5CS8 A;  4O7A A;  5ENH A;  5LKU A;  4N4F A;  5ENJ A;  5E73 A;  5CQ6 A;  4A9H A;  5EWC A;  5LVQ A;  2L5E A;  5F1L A;  4X2I A;  5I1Q A;  3IU6 A;  5E9M A;  5JI8 A;  4YBT A;  5CY9 A;  5CUA A;  5A7C A;  4PCE A;  1JSP B;  5A5R A;  5LKZ A;  4NS5 A;  4UIU A;  3I3J A;  5EWH A;  5F1H A;  2DVQ A;  4QR3 A;  4TU4 A;  5E74 A;  5HM0 A;  4IR5 A;  5DFD A;  5D3J A;  3UV2 A;  4QC1 A;  5C7N A;  3U5O A;  3P1F A;  4LDF A;  5CGP A;  4AKG A;  4WIV A;  3UV5 A;  4LYW A;  5AD3 A;  5D7X A;  4IOO A;  4QUT A;  4HXK A;  2RFJ A;  4KV4 A;  2YYN A;  1ZKR A;  4YY6 A;  5EGU A;  4Z93 A;  2RS9 B;  5EPS A;  2R0Y A;  4YC9 A;  5D26 A;  5F3A A;  5DKC A;  2D9E A;  4NR7 A;  5ENI A;  5KU3 A;  3UW9 A;  5IG6 A;  4E96 A;  4Z1Q A;  4CUP A;  4YBM A;  4HXS A;  5IGL A;  5I83 A;  5DKD A;  5FH8 A;  4NR4 A;  5FFV A;  4NQM A;  4HXP A;  3QZT A;  5E3D A;  5LJ0 A;  4QSU A;  3NXB A;  3P1D A;  5TB6 A;  4TQN A;  5EI4 A;  5EVA A;  5C87 A;  4MEQ A;  5IGK A;  3O34 A;  2RI7 A;  5ENC A;  5L8T A;  4IR6 A;  3O36 A;  5DW1 A;  5DYU A;  5IGN A;  4QYL A;  3VKH A;  3ONI A;  4YAD A;  5IGM A;  2DVV A;  5CTL A;  5EM3 A;  2L85 A;  4MR4 A;  4ZC9 A;  4AKH A;  5DX4 A;  2E3K A;  5I88 A;  2F6N A;  2RO1 A;  4TYL A;  5D24 A;  4A9M A;  4YY4 A;  4BW1 A;  5CUG A;  3HMF A;  4UYF B;  5I86 A;  4UIT A;  3LQJ A;  4MEO A;  4BW2 A;  4O72 A;  2H60 A;  1WUM A;  5L96 A;  5EA1 A;  2R0V A;  5I40 A;  4HBV A;  4YYJ A;  3MB3 A;  5CQ4 A;  5ENF A;  3MB4 A;  4YK0 A;  5EPB A;  5F63 A;  4O7E A;  5EPR A;  3AAD A;  4YYN A;  5HQ7 A;  3O37 A;  4UYG A;  4BW4 A;  5ENB A;  4BHW A;  2I8N A;  4LZR A;  4QSR A;  4UIZ A;  4UYD A;  3U5P A;  4QC3 A;  5C4Q A;  5E9K A;  5KO4 A;  4RVR A;  4LZS A;  4FLP A;  4UIY A;  5E9V A;  3GG3 A;  5I89 A;  4HXR A;  4NRA A;  4F3I A;  5EWD A;  4NXJ A;  2OO1 A;  4OUF A;  5L98 A;  4QSS A;  4PS5 A;  5CUD A;  5FE3 A;  5EWV A;  3O33 A;  5FH7 A;  3SVF A;  5L99 A;  4A9F A;  5TCM A;  5FFY A;  4UIW A;  4QUU A;  4YYD A;  4HBW A;  2LSP B;  2DVS A;  4Q0N A;  5H1V A;  4YYH A;  4IR4 A;  5FE0 A;  4YYK A;  4XYA A;  5CUC A;  4TT4 A;  4CLB A;  5F5Z A;  4NRC A;  4YH4 A;  4HXO A;  5CUB A;  4ALH A;  3UVW A;  4GPJ A;  5E9I A;  5DYA A;  4TTE A;  3HME A;  5E7D A;  5ETB A;  3TLP A;  4O74 A;  5F36 A;  4HXL A;  3HMH A;  5CZG A;  4N4H A;  4LC2 A;  3LQH A;  3MUL A;  4PCI A;  5E9Y A;  5A81 A;  1WUG A;  4TZ2 A;  5IBN A;  5HJC A;  5A5P A;  1PUO A;  1E6I A;  4TT6 A;  4DON A;  4LR6 A;  4C67 A;  4YBS A;  2YDW A;  3UVD A;  4CUU A;  4XUA A;  2D82 A;  4QSV A;  4WHU A;  5AMF A;  5EIS A;  4Z1S A;  4LYS A;  5HRX A;  4A9E A;  4PKL A;  1EQF A;  5FG5 A;  5HRW A;  2YEL A;  5DYX A;  5FE8 A;  5CRZ A;  5K29 A;  3U5J A;  4NRB A;  5D3R A;  5HLS A;  4NUE A;  3D7C A;  4CUS A;  3FKM X;  4CUT A;  4IOQ A;  4QR4 A;  2R10 A;  5CPE A;  4A9J A;  4XY8 A;  3LXJ A;  5FDZ A;  4XUB A;  2N9G A;  5C89 A;  4A9K A;  5HEM A;  5AD2 A;  5CQA A;  3JVM A;  4O71 A;  4TZ8 A;  5DKH A;  4ZW1 A;  3Q2E A;  4Z6I A;  1JM4 B;  4OGJ A;  4NR6 A;  5EIC A;  4YYG A;  4MR3 A;  2YQD A;  3UVX A;  4QEW A;  5L97 A;  5FG4 A;  4O78 A;  4A9I A;  4NR5 A;  5HFR A;  5C8G A;  5JWM A;  5DFB A;  4BJX A;  4LZ2 A;  2DWW A;  3MXF A;  2OSS A;  5CP5 A;  4O7B A;  3D1D A;  5LKT A;  5CFW A;  4OGI A;  4NUD A;  5E0R A;  5FE2 A;  4YH3 A;  5HQ6 A;  5KTU A;  2DKW A;  4HXM A;  5D3L A;  5FE7 A;  4UIX A;  4Q0O A;  5F25 A;  5ENG A;  2RNW A;  2YEM A;  4O7F A;  2KTB B;  5FB1 A;  5A85 A;  4J1P A;  5D3S A;  5A83 A;  4YAX A;  5F62 A;  4NR8 A;  4NYX A;  5CRM A;  5DYC A;  5CQ8 A;  3ZYU A;  3G0J A;  3DAI A;  4HXN A;  4Z6H A;  5C85 A;  3S91 A;  4N4G A;  5HEN A;  3U5M A;  5I80 A;  4IOR A;  5D25 A;  2DVR A;  4CL9 A;  2YEK A;  3JVK A;  3S92 A;  5CQT A;  4KCX A;  4UYE A;  3JVJ A;  2RNX A;  5BT4 A;  3K2J A;  4MEN A;  5D3N A;  2GRC A;  3QZS A;  4TT2 A;  5F60 A;  4QSW A;  5DBM A;  5H85 A;  5EP7 A;  4LYI A;  5FB0 A;  4A9N A;  3U5K A;  4YAT A;  1F68 A;  2DAT A;  5DLX A;  1X0J A;  5F61 A;  5J0D A;  4QB3 A;  4QST A;  4O76 A;  5IID A;  3QZV A;  2F6J A;  4J0S A;  5H1T A;  3SVH A;  4QSX A;  3O35 A;  4J3I A;  4QSQ A;  5FE4 A;  4QBM A;  2G4A A;  3Q2F A;  1N72 A;  4UYH A;  5CQ5 A;  5LVR A;  3LJW A;  5D3T A;  5BT5 A;  5A82 A;  3D1B A;  4XY9 A;  2WP2 A;  5G4R A;  5KTX A;  4CFL A;  3SVG A;  5EK9 A;  3ERR A;  4J0R A;  4NQN A;  4PY6 A;  4QSP A;  4YAB A;  5ETD A;  4QY4 A;  2YW5 A;  4UIV A;  4KV1 A;  3AQA A;  2E7O A;  5L8U A;  5FBX A;  5BT3 A;  3G0L A;  2MJV B;  5DFC A;  5CU8 A;  5FE1 A;  2OUO A;  4QEU A;  2RNY A;  5LKX A;  4IR3 A;  4ZQL A;  4NYW A;  4O7C A;  5I7X A;  4N3W A;  5H1U A;  5CUE A;  5EWW A;  3P1E A;  5A5Q A;  2FSA A;  2I7K A;  3LQI A;  5D3H A;  5D0C A;  5LUU A;  4HBY A;  5D3P A;  4AKN A;  4AKI A;  4NUC A;  4CUR A;  2EJN A; 
#chains in the Genus database with same CATH homology
 4TS8 A;  5I7Y A;  5A5N A;  4MEP A;  5HQ5 A;  3DWY A;  5ENE A;  5FG6 A;  3UVY A;  3P5O A;  4QNS A;  4O77 A;  5KHM A;  4C66 A;  3JVL A;  5G4S A;  4QZS A;  3U5L A;  4YYM A;  5ACY A;  5AME A;  5KTW A;  4PTB A;  5HFQ A;  4MR5 A;  1ZS5 A;  4LRG A;  4MR6 A;  4N4I A;  4QR5 A;  5EV9 A;  4YYI A;  5II1 A;  5HCL A;  4HBX A;  3MQM A;  5A5O A;  4NYV A;  4NR9 A;  5E9L A;  2NXB A;  4A9O A;  5I29 A;  2L84 A;  4ALG A;  4A9L A;  4QYD A;  5DLZ A;  3IU5 A;  2R0S A;  4CUQ A;  3MUK A;  3P1C A;  5CQ7 A;  5FH6 A;  5II2 A;  5DW2 A;  4WHW A;  5EU1 A;  5FE9 A;  4TU6 A;  5LJ2 A;  5FE5 A;  3U5N A;  3UV4 A;  5LJ1 A;  5HRV A;  5FFW A;  4QEV A;  5EQ1 A;  3RCW A;  2E7N A;  4O70 A;  4UYF A;  5COI A;  4CFK A;  5FE6 A;  5DY7 A;  5HEL A;  4Y03 A;  4O75 A;  5E3G A;  4BW3 A;  2WP1 A;  5F2P A;  5A5S A;  5CQ3 A;  5CS8 A;  4O7A A;  5ENH A;  5LKU A;  4N4F A;  5ENJ A;  5E73 A;  5CQ6 A;  4A9H A;  5EWC A;  5LVQ A;  2L5E A;  5F1L A;  4X2I A;  5I1Q A;  3IU6 A;  5E9M A;  5JI8 A;  4YBT A;  5CY9 A;  5CUA A;  5A7C A;  4PCE A;  1JSP B;  5A5R A;  5LKZ A;  4NS5 A;  4UIU A;  3I3J A;  5EWH A;  5F1H A;  2DVQ A;  4QR3 A;  4TU4 A;  5E74 A;  5HM0 A;  4IR5 A;  5DFD A;  5D3J A;  3UV2 A;  4QC1 A;  5C7N A;  3U5O A;  3P1F A;  4LDF A;  5CGP A;  4WIV A;  3UV5 A;  4LYW A;  5AD3 A;  5D7X A;  4IOO A;  4QUT A;  4HXK A;  2RFJ A;  4KV4 A;  2YYN A;  4YY6 A;  5EGU A;  4Z93 A;  2RS9 B;  5EPS A;  2R0Y A;  4YC9 A;  5D26 A;  5F3A A;  5DKC A;  2D9E A;  4NR7 A;  5ENI A;  5KU3 A;  3UW9 A;  5IG6 A;  4E96 A;  4Z1Q A;  4CUP A;  4YBM A;  4HXS A;  5IGL A;  5I83 A;  5DKD A;  5FH8 A;  4NR4 A;  5FFV A;  4NQM A;  4HXP A;  3QZT A;  5E3D A;  5LJ0 A;  4QSU A;  3NXB A;  3P1D A;  5TB6 A;  4TQN A;  5EI4 A;  5EVA A;  5C87 A;  4MEQ A;  5IGK A;  3O34 A;  2RI7 A;  5ENC A;  5L8T A;  4IR6 A;  3O36 A;  5DW1 A;  5DYU A;  5IGN A;  4QYL A;  3ONI A;  4YAD A;  5IGM A;  2DVV A;  5CTL A;  5EM3 A;  2L85 A;  4MR4 A;  4ZC9 A;  5DX4 A;  2E3K A;  5I88 A;  2F6N A;  2RO1 A;  4TYL A;  5D24 A;  4A9M A;  4YY4 A;  4BW1 A;  5CUG A;  3HMF A;  4UYF B;  5I86 A;  4UIT A;  3LQJ A;  4MEO A;  4BW2 A;  4O72 A;  2H60 A;  1WUM A;  5L96 A;  5EA1 A;  2R0V A;  5I40 A;  4HBV A;  4YYJ A;  3MB3 A;  5CQ4 A;  5ENF A;  3MB4 A;  4YK0 A;  5EPB A;  5F63 A;  4O7E A;  5EPR A;  3AAD A;  4YYN A;  5HQ7 A;  3O37 A;  4UYG A;  4BW4 A;  5ENB A;  4BHW A;  2I8N A;  4LZR A;  4QSR A;  4UIZ A;  4UYD A;  3U5P A;  4QC3 A;  5C4Q A;  5E9K A;  5KO4 A;  4RVR A;  4LZS A;  4FLP A;  4UIY A;  5E9V A;  3GG3 A;  5I89 A;  4HXR A;  4NRA A;  4F3I A;  5EWD A;  4NXJ A;  2OO1 A;  4OUF A;  5L98 A;  4QSS A;  4PS5 A;  5CUD A;  5FE3 A;  5EWV A;  3O33 A;  5FH7 A;  3SVF A;  5L99 A;  4A9F A;  5TCM A;  5FFY A;  4UIW A;  4QUU A;  4YYD A;  4HBW A;  2LSP B;  2DVS A;  4Q0N A;  5H1V A;  4YYH A;  4IR4 A;  5FE0 A;  4YYK A;  4XYA A;  5CUC A;  4TT4 A;  4CLB A;  5F5Z A;  4NRC A;  4YH4 A;  4HXO A;  5CUB A;  4ALH A;  3UVW A;  4GPJ A;  5E9I A;  5DYA A;  4TTE A;  3HME A;  5E7D A;  5ETB A;  3TLP A;  4O74 A;  5F36 A;  4HXL A;  3HMH A;  5CZG A;  4N4H A;  4LC2 A;  3LQH A;  3MUL A;  4PCI A;  5E9Y A;  5A81 A;  1WUG A;  4TZ2 A;  5IBN A;  5HJC A;  5A5P A;  1E6I A;  4TT6 A;  4DON A;  4LR6 A;  4C67 A;  4YBS A;  2YDW A;  3UVD A;  4CUU A;  4XUA A;  2D82 A;  4QSV A;  4WHU A;  5AMF A;  5EIS A;  4Z1S A;  4LYS A;  5HRX A;  4A9E A;  4PKL A;  1EQF A;  5FG5 A;  5HRW A;  2YEL A;  5DYX A;  5FE8 A;  5CRZ A;  5K29 A;  3U5J A;  4NRB A;  5D3R A;  5HLS A;  4NUE A;  3D7C A;  4CUS A;  3FKM X;  4CUT A;  4IOQ A;  4QR4 A;  2R10 A;  5CPE A;  4A9J A;  4XY8 A;  3LXJ A;  5FDZ A;  4XUB A;  2N9G A;  5C89 A;  4A9K A;  5HEM A;  5AD2 A;  5CQA A;  3JVM A;  4O71 A;  4TZ8 A;  5DKH A;  4ZW1 A;  3Q2E A;  4Z6I A;  1JM4 B;  4OGJ A;  4NR6 A;  5EIC A;  4YYG A;  4MR3 A;  2YQD A;  3UVX A;  4QEW A;  5L97 A;  5FG4 A;  4O78 A;  4A9I A;  4NR5 A;  5HFR A;  5C8G A;  5JWM A;  5DFB A;  4BJX A;  4LZ2 A;  2DWW A;  3MXF A;  2OSS A;  5CP5 A;  4O7B A;  5LKT A;  5CFW A;  4OGI A;  4NUD A;  5E0R A;  5FE2 A;  4YH3 A;  5HQ6 A;  5KTU A;  2DKW A;  4HXM A;  5D3L A;  5FE7 A;  4UIX A;  4Q0O A;  5F25 A;  5ENG A;  2RNW A;  2YEM A;  4O7F A;  2KTB B;  5FB1 A;  5A85 A;  4J1P A;  5D3S A;  5A83 A;  4YAX A;  5F62 A;  4NR8 A;  4NYX A;  5CRM A;  5DYC A;  5CQ8 A;  3ZYU A;  3G0J A;  3DAI A;  4HXN A;  4Z6H A;  5C85 A;  3S91 A;  4N4G A;  5HEN A;  3U5M A;  5I80 A;  4IOR A;  5D25 A;  2DVR A;  4CL9 A;  2YEK A;  3JVK A;  3S92 A;  5CQT A;  4KCX A;  4UYE A;  3JVJ A;  2RNX A;  5BT4 A;  3K2J A;  4MEN A;  5D3N A;  2GRC A;  3QZS A;  4TT2 A;  5F60 A;  4QSW A;  5DBM A;  5H85 A;  5EP7 A;  4LYI A;  5FB0 A;  4A9N A;  3U5K A;  4YAT A;  1F68 A;  2DAT A;  5DLX A;  1X0J A;  5F61 A;  5J0D A;  4QB3 A;  4QST A;  4O76 A;  5IID A;  3QZV A;  2F6J A;  4J0S A;  5H1T A;  3SVH A;  4QSX A;  3O35 A;  4J3I A;  4QSQ A;  5FE4 A;  4QBM A;  2G4A A;  3Q2F A;  1N72 A;  4UYH A;  5CQ5 A;  5LVR A;  3LJW A;  5D3T A;  5BT5 A;  5A82 A;  4XY9 A;  2WP2 A;  5G4R A;  5KTX A;  4CFL A;  3SVG A;  5EK9 A;  4J0R A;  4NQN A;  4PY6 A;  4QSP A;  4YAB A;  5ETD A;  4QY4 A;  2YW5 A;  4UIV A;  4KV1 A;  3AQA A;  2E7O A;  5L8U A;  5FBX A;  5BT3 A;  3G0L A;  2MJV B;  5DFC A;  5CU8 A;  5FE1 A;  2OUO A;  4QEU A;  2RNY A;  5LKX A;  4IR3 A;  4ZQL A;  4NYW A;  4O7C A;  5I7X A;  4N3W A;  5H1U A;  5CUE A;  5EWW A;  3P1E A;  5A5Q A;  2FSA A;  2I7K A;  3LQI A;  5D3H A;  5D0C A;  5LUU A;  4HBY A;  5D3P A;  4AKN A;  4NUC A;  4CUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...