4NYXA

Crystal structure of the bromodomain of human crebbp in complex with a dihydroquinoxalinone ligand
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
116
structure length
116
Chain Sequence
KKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Crystal Structure of the Bromodomain of human CREBBP in complex with a dihydroquinoxalinone ligand
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 116
sequence length 116
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4nyxA00
5II1A 5H1UA 4QSRA 5CGPA 5I88A 4YATA 5AMFA 4NYWA 3RCWA 5E73A 3U5JA 2F6JA 4IR4A 4A9KA 4A9IA 2LSPB 4BHWA 5CQTA 4BJXA 3LXJA 4YBTA 5CQ7A 4QSPA 5HEMA 1X0JA 5LVQA 1WUGA 4NUCA 4A9JA 5EI4A 4NR7A 5KHMA 5E0RA 5EPSA 5FE0A 4YYNA 4BW3A 2DWWA 5E9KA 5KTXA 5H85A 1E6IA 5EICA 4LDFA 4NR5A 4NRCA 4CUQA 3G0JA 2R0VA 5A81A 4O7BA 4QUTA 5C4QA 4N4IA 5D3JA 5A85A 4Z1QA 5HJCA 5C89A 2RFJA 3FKMX 4O74A 2H60A 4O70A 4O77A 5CS8A 4A9HA 3U5MA 4O7FA 4PCIA 5DX4A 4XY9A 4HBYA 2MJVB 4HXSA 5ACYA 3UV5A 5F2PA 5LKTA 5HQ7A 4NUEA 4LZSA 4WHWA 5DFDA 2DKWA 4O76A 5E3DA 3MUKA 4QR5A 3MULA 5DYXA 4QEUA 4YYMA 4YYGA 4QYLA 5AD2A 5DFCA 3LQIA 4QEWA 2R0SA 2R10A 3QZTA 3P1CA 5A5NA 2YYNA 4MEPA 5EVAA 3P1DA 4IOOA 5F1LA 4NXJA 4TS8A 3K2JA 5CP5A 5CU8A 3UW9A 2L85A 4A9EA 4UYEA 4O78A 4F3IA 5JI8A 4J0SA 2L84A 4CUPA 5ENCA 5TCMA 4LYWA 5DLZA 3UV2A 4NQMA 4UIUA 4XUBA 5EWWA 5CRMA 4CL9A 5DFBA 5EP7A 4C66A 3U5OA 4CFLA 4YK0A 4O71A 5EA1A 5FE6A 3UVWA 5HLSA 5FDZA 2WP1A 4QNSA 4LZ2A 3I3JA 4ALHA 5A82A 2YW5A 3SVGA 5FE1A 4N4FA 4MEQA 3UVXA 4Z1SA 5BT4A 5DW2A 4UIZA 2DVVA 4FLPA 5FE7A 3AQAA 5FB0A 5EGUA 5EWVA 5HFQA 5FBXA 4Z6IA 5LJ1A 4QSWA 2OUOA 4NR8A 5CPEA 5CRZA 4TZ8A 5L99A 5COIA 5CUEA 4NR4A 5E9IA 4TT2A 3JVLA 4NS5A 5KTUA 4QEVA 5D0CA 2YQDA 5A5PA 4RVRA 4BW2A 2NXBA 5DY7A 4YYHA 5A5QA 5I83A 5H1VA 4IORA 5DYUA 5C87A 5F1HA 2WP2A 1WUMA 4LZRA 5II2A 3DAIA 5E3GA 5IBNA 4HXPA 5LKXA 4YH3A 5D3PA 4CFKA 5LKZA 2E7OA 4WHUA 4HXNA 3MB4A 4N4HA 4NYXA 4QSXA 5CUAA 4UYFB 4QSQA 5EPBA 5A5OA 5HENA 4YYJA 5IGLA 5I1QA 4HXOA 5L98A 5A83A 5LUUA 4OGIA 3UVYA 4WIVA 5D3TA 4YY4A 2E7NA 4IR6A 5CUDA 4NRBA 4YBMA 5J0DA 4Q0NA 4TZ2A 4PCEA 3O37A 5E9YA 2OSSA 4TU4A 3U5PA 5IIDA 4LC2A 5CUCA 4PKLA 4IOQA 4MR4A 5DKDA 5LJ0A 4TT4A 5JWMA 5E7DA 3P1FA 4QC1A 4UYHA 5E9LA 5FFYA 5FE8A 4Q0OA 5IGMA 3O33A 3ZYUA 3HMEA 3UV4A 4NQNA 5C7NA 5CQ4A 5DLXA 5DKHA 5EK9A 4TTEA 3O36A 3GG3A 4HXLA 2N9GA 2D82A 5F62A 4YYKA 4PS5A 5CQAA 4CLBA 4PY6A 4HXKA 4QC3A 5E74A 5I7XA 4X2IA 4J3IA 2YEMA 3S91A 2GRCA 4YH4A 4NR6A 2RNXA 5A5SA 4TQNA 4QYDA 5FE5A 5FB1A 4LYIA 5H1TA 4A9NA 2D9EA 4XY8A 5EQ1A 5EWCA 5G4SA 4C67A 5FFWA 2RNWA 4QSVA 5F63A 5L8UA 5HRVA 5I29A 5F60A 5EWDA 2FSAA 2YDWA 4HBXA 3JVKA 4UIYA 3NXBA 5FH8A 5ENEA 3DWYA 4UYGA 5EM3A 1JSPB 4ALGA 4YADA 4CURA 5CZGA 5DW1A 4MR6A 2I8NA 2G4AA 4E96A 2RO1A 4J0RA 5KU3A 4BW1A 5FG4A 5EPRA 5I40A 2L5EA 3QZVA 4QR4A 4O7AA 5F36A 4KCXA 4ZC9A 5ENFA 2RS9B 4LR6A 4XUAA 4ZW1A 4GPJA 5F61A 5FE9A 5LJ2A 3U5KA 4KV4A 5BT5A 5D3SA 4A9MA 4YY6A 2KTBB 5CUGA 2YEKA 4QY4A 2DVSA 3IU6A 5D3RA 4ZQLA 4UYFA 5EU1A 5E9MA 5LVRA 4HBVA 5F5ZA 2RNYA 5FH6A 4QZSA 5HELA 5I89A 5DKCA 5HM0A 3SVFA 5DBMA 4QSSA 4HBWA 5ENGA 4YABA 3JVJA 5HQ6A 4QUUA 5D25A 3TLPA 1F68A 5C8GA 3O34A 3MB3A 4YC9A 5ENHA 5L96A 4CUSA 3JVMA 5CQ3A 4KV1A 5E9VA 5CUBA 5L97A 3P5OA 2DATA 3MQMA 3O35A 5FFVA 4TT6A 4MR5A 4UITA 5D24A 5D26A 5G4RA 5CTLA 4MR3A 4Y03A 2RI7A 2E3KA 4J1PA 4IR5A 5CY9A 3SVHA 4MENA 2YELA 4QSTA 5HFRA 2OO1A 5AD3A 3ONIA 4YAXA 4A9OA 2DVRA 4LRGA 1ZS5A 4XYAA 3D7CA 4OUFA 5AMEA 5HCLA 5I80A 1N72A 4CUUA 5EV9A 5KO4A 4UYDA 5CQ8A 4NR9A 3P1EA 4Z6HA 3Q2FA 4QB3A 4AKNA 5K29A 4A9FA 5FG6A 4NUDA 4YBSA 5IG6A 4N3WA 2I7KA 5HQ5A 5IGKA 3HMHA 5FE4A 4YYIA 5FE2A 4Z93A 5I86A 5DYCA 5ENJA 5FE3A 5CFWA 2F6NA 5HRXA 1JM4B 5ETBA 1EQFA 4O75A 4LYSA 5BT3A 4OGJA 4A9LA 4DONA 5HRWA 5D3NA 5LKUA 3LJWA 5CQ5A 5EISA 5F3AA 5TB6A 4YYDA 4O7CA 5CQ6A 3QZSA 3LQHA 4QBMA 3AADA 3IU5A 5FH7A 4UIVA 2R0YA 5D3HA 4QSUA 4HXRA 3U5NA 4NRAA 4MEOA 4HXMA 4PTBA 4UIXA 5A5RA 4QR3A 5ENBA 5EWHA 5FG5A 5IGNA 3HMFA 3S92A 4UIWA 5ENIA 3MXFA 5A7CA 5KTWA 4TYLA 3LQJA 3Q2EA 3U5LA 5DYAA 5D3LA 5C85A 5L8TA 4O7EA 3UVDA 2DVQA 4N4GA 4IR3A 4CUTA 5ETDA 4BW4A 3G0LA 4TU6A 5I7YA 4O72A 4NYVA 5F25A 5D7XA
chains in the Genus database with same CATH superfamily
5II1A 5H1UA 4QSRA 5CGPA 5I88A 4YATA 5AMFA 4NYWA 3RCWA 5E73A 3U5JA 2F6JA 4IR4A 4A9KA 4A9IA 2LSPB 4BHWA 5CQTA 4BJXA 3LXJA 4YBTA 5CQ7A 4QSPA 5HEMA 1X0JA 5LVQA 1WUGA 4NUCA 4A9JA 5EI4A 4NR7A 5KHMA 5E0RA 5EPSA 5FE0A 4YYNA 4BW3A 2DWWA 5E9KA 5KTXA 5H85A 1E6IA 5EICA 4LDFA 4NR5A 4NRCA 4CUQA 3G0JA 2R0VA 5A81A 4O7BA 4QUTA 5C4QA 4N4IA 5D3JA 5A85A 4Z1QA 5HJCA 5C89A 2RFJA 3FKMX 4O74A 2H60A 4O70A 4O77A 5CS8A 4A9HA 3U5MA 4O7FA 4PCIA 5DX4A 4XY9A 4HBYA 2MJVB 4HXSA 5ACYA 3UV5A 5F2PA 5LKTA 5HQ7A 4NUEA 4LZSA 4WHWA 5DFDA 2DKWA 4O76A 5E3DA 3MUKA 4QR5A 3MULA 5DYXA 4QEUA 4YYMA 4YYGA 4QYLA 5AD2A 5DFCA 3LQIA 4QEWA 2R0SA 2R10A 3QZTA 3P1CA 5A5NA 2YYNA 4MEPA 5EVAA 3P1DA 4IOOA 5F1LA 4NXJA 4TS8A 3K2JA 5CP5A 5CU8A 3UW9A 2L85A 4A9EA 4UYEA 4O78A 4F3IA 5JI8A 4J0SA 2L84A 4CUPA 5ENCA 5TCMA 4LYWA 5DLZA 3UV2A 4NQMA 4UIUA 4XUBA 5EWWA 5CRMA 4CL9A 5DFBA 5EP7A 4C66A 3U5OA 4CFLA 4YK0A 4O71A 5EA1A 5FE6A 3UVWA 5HLSA 5FDZA 2WP1A 4QNSA 4LZ2A 3I3JA 4ALHA 5A82A 2YW5A 3SVGA 5FE1A 4N4FA 4MEQA 3UVXA 4Z1SA 5BT4A 5DW2A 4UIZA 2DVVA 4FLPA 5FE7A 3AQAA 5FB0A 5EGUA 5EWVA 5HFQA 5FBXA 4Z6IA 5LJ1A 4QSWA 2OUOA 4AKHA 4NR8A 5CPEA 5CRZA 4TZ8A 5L99A 5COIA 5CUEA 4NR4A 5E9IA 4TT2A 3JVLA 4NS5A 5KTUA 4QEVA 5D0CA 2YQDA 5A5PA 4RVRA 4BW2A 2NXBA 5DY7A 4YYHA 3D1DA 5A5QA 5I83A 5H1VA 4IORA 5DYUA 5C87A 5F1HA 2WP2A 1WUMA 4LZRA 5II2A 3DAIA 5E3GA 5IBNA 4HXPA 5LKXA 4YH3A 5D3PA 4CFKA 5LKZA 2E7OA 4WHUA 4HXNA 3MB4A 4N4HA 4NYXA 4QSXA 5CUAA 4UYFB 4QSQA 5EPBA 5A5OA 5HENA 4YYJA 5IGLA 5I1QA 4HXOA 5L98A 5A83A 5LUUA 4OGIA 3UVYA 4WIVA 5D3TA 4YY4A 2E7NA 4IR6A 5CUDA 4NRBA 4YBMA 5J0DA 4Q0NA 4TZ2A 4PCEA 4AI6A 3O37A 5E9YA 2OSSA 4TU4A 3U5PA 5IIDA 4LC2A 5CUCA 4PKLA 4IOQA 4MR4A 5DKDA 5LJ0A 4TT4A 5JWMA 5E7DA 1ZKRA 3P1FA 4QC1A 4AKGA 3VKGA 4UYHA 5E9LA 5FFYA 5FE8A 4Q0OA 5IGMA 3O33A 3ZYUA 3HMEA 3UV4A 4NQNA 5C7NA 5CQ4A 5DLXA 5DKHA 5EK9A 4TTEA 3O36A 3GG3A 4HXLA 2N9GA 2D82A 5F62A 4YYKA 4PS5A 5CQAA 4CLBA 4PY6A 4HXKA 4QC3A 5E74A 5I7XA 4X2IA 4J3IA 2YEMA 3S91A 2GRCA 4YH4A 4NR6A 2RNXA 5A5SA 4TQNA 4QYDA 5FE5A 5FB1A 4LYIA 5H1TA 4A9NA 2D9EA 4XY8A 5EQ1A 5EWCA 5G4SA 4C67A 5FFWA 2RNWA 4QSVA 5F63A 5L8UA 5HRVA 5I29A 5F60A 5EWDA 2FSAA 2YDWA 4HBXA 3JVKA 4UIYA 3NXBA 5FH8A 5ENEA 3DWYA 4UYGA 5EM3A 1JSPB 4ALGA 4YADA 4CURA 5CZGA 3D1BA 5DW1A 4MR6A 2I8NA 2G4AA 4E96A 2RO1A 4J0RA 5KU3A 4BW1A 5FG4A 5EPRA 5I40A 2L5EA 3QZVA 4QR4A 4O7AA 5F36A 4KCXA 4ZC9A 5ENFA 2RS9B 4LR6A 4XUAA 4ZW1A 4GPJA 5F61A 5FE9A 5LJ2A 3U5KA 4KV4A 5BT5A 5D3SA 4A9MA 4YY6A 2KTBB 3VKHA 5CUGA 2YEKA 4QY4A 2DVSA 3IU6A 5D3RA 4ZQLA 4UYFA 5EU1A 5E9MA 5LVRA 4HBVA 5F5ZA 2RNYA 5FH6A 4AKIA 4QZSA 5HELA 5I89A 5DKCA 5HM0A 3SVFA 5DBMA 4QSSA 4HBWA 5ENGA 4YABA 3JVJA 5HQ6A 2EJNA 4QUUA 5D25A 3TLPA 1F68A 5C8GA 3O34A 3MB3A 4YC9A 5ENHA 5L96A 4CUSA 3JVMA 5CQ3A 4KV1A 5E9VA 5CUBA 5L97A 3P5OA 2DATA 3MQMA 3O35A 5FFVA 4TT6A 4MR5A 4UITA 5D24A 5D26A 5G4RA 5CTLA 4MR3A 3ERRA 4Y03A 2RI7A 2E3KA 4J1PA 4IR5A 5CY9A 3SVHA 4MENA 2YELA 4QSTA 5HFRA 2OO1A 5AD3A 3ONIA 4YAXA 4A9OA 2DVRA 4LRGA 1ZS5A 4XYAA 3D7CA 4OUFA 5AMEA 5HCLA 5I80A 1N72A 4CUUA 5EV9A 5KO4A 4UYDA 5CQ8A 4NR9A 3P1EA 4Z6HA 3Q2FA 4QB3A 4AKNA 5K29A 4A9FA 5FG6A 4NUDA 4YBSA 5IG6A 4N3WA 2I7KA 5HQ5A 5IGKA 3HMHA 5FE4A 4YYIA 5FE2A 4Z93A 5I86A 5DYCA 5ENJA 5FE3A 5CFWA 2F6NA 5HRXA 1JM4B 5ETBA 1EQFA 4O75A 4LYSA 5BT3A 4OGJA 4A9LA 4DONA 5HRWA 5D3NA 5LKUA 3LJWA 5CQ5A 5EISA 5F3AA 5TB6A 4YYDA 1PUOA 4O7CA 5CQ6A 3QZSA 3LQHA 4QBMA 3AADA 3IU5A 5FH7A 4UIVA 2R0YA 5D3HA 4QSUA 4HXRA 3U5NA 4NRAA 4MEOA 4HXMA 4PTBA 4UIXA 5A5RA 4QR3A 5ENBA 5EWHA 5FG5A 5IGNA 3HMFA 3S92A 4UIWA 5ENIA 3MXFA 5A7CA 5KTWA 4TYLA 3LQJA 3Q2EA 3U5LA 5DYAA 5D3LA 5C85A 5L8TA 4O7EA 3UVDA 2DVQA 4N4GA 4IR3A 4CUTA 5ETDA 4BW4A 3G0LA 4TU6A 5I7YA 4O72A 4NYVA 5F25A 5D7XA
chains in the Genus database with same CATH topology
5II1A 5H1UA 4QSRA 5CGPA 5I88A 4YATA 5AMFA 4NYWA 3RCWA 5E73A 3U5JA 2F6JA 4IR4A 4A9KA 4A9IA 2LSPB 4BHWA 5CQTA 4BJXA 3LXJA 4YBTA 5CQ7A 4QSPA 5HEMA 1X0JA 5LVQA 1WUGA 4NUCA 4A9JA 5EI4A 4NR7A 5KHMA 5E0RA 5EPSA 5FE0A 4YYNA 4BW3A 2DWWA 5E9KA 5KTXA 5H85A 1E6IA 5EICA 4LDFA 4NR5A 4NRCA 4CUQA 3G0JA 2R0VA 5A81A 4O7BA 4QUTA 5C4QA 4N4IA 5D3JA 5A85A 4Z1QA 5HJCA 5C89A 2RFJA 3FKMX 4O74A 2H60A 4O70A 4O77A 5CS8A 4A9HA 3U5MA 4O7FA 4PCIA 5DX4A 4XY9A 4HBYA 2MJVB 4HXSA 5ACYA 3UV5A 5F2PA 5LKTA 5HQ7A 4NUEA 4LZSA 4WHWA 5DFDA 2DKWA 4O76A 5E3DA 3MUKA 4QR5A 3MULA 5DYXA 4QEUA 4YYMA 4YYGA 4QYLA 5AD2A 5DFCA 3LQIA 4QEWA 2R0SA 2R10A 3QZTA 3P1CA 5A5NA 2YYNA 4MEPA 5EVAA 3P1DA 4IOOA 5F1LA 4NXJA 4TS8A 3K2JA 5CP5A 5CU8A 3UW9A 2L85A 4A9EA 4UYEA 4O78A 4F3IA 5JI8A 4J0SA 2L84A 4CUPA 5ENCA 5TCMA 4LYWA 5DLZA 3UV2A 4NQMA 4UIUA 4XUBA 5EWWA 5CRMA 4CL9A 5DFBA 5EP7A 4C66A 3U5OA 4CFLA 4YK0A 4O71A 5EA1A 5FE6A 3UVWA 5HLSA 5FDZA 2WP1A 4QNSA 4LZ2A 3I3JA 4ALHA 5A82A 2YW5A 3SVGA 5FE1A 4N4FA 4MEQA 3UVXA 4Z1SA 5BT4A 5DW2A 4UIZA 2DVVA 4FLPA 5FE7A 3AQAA 5FB0A 5EGUA 5EWVA 5HFQA 5FBXA 4Z6IA 5LJ1A 4QSWA 2OUOA 4NR8A 5CPEA 5CRZA 4TZ8A 5L99A 5COIA 5CUEA 4NR4A 5E9IA 4TT2A 3JVLA 4NS5A 5KTUA 4QEVA 5D0CA 2YQDA 5A5PA 4RVRA 4BW2A 2NXBA 5DY7A 4YYHA 5A5QA 5I83A 5H1VA 4IORA 5DYUA 5C87A 5F1HA 2WP2A 1WUMA 4LZRA 5II2A 3DAIA 5E3GA 5IBNA 4HXPA 5LKXA 4YH3A 5D3PA 4CFKA 5LKZA 2E7OA 4WHUA 4HXNA 3MB4A 4N4HA 4NYXA 4QSXA 5CUAA 4UYFB 4QSQA 5EPBA 5A5OA 5HENA 4YYJA 5IGLA 5I1QA 4HXOA 5L98A 5A83A 5LUUA 4OGIA 3UVYA 4WIVA 5D3TA 4YY4A 2E7NA 4IR6A 5CUDA 4NRBA 4YBMA 5J0DA 4Q0NA 4TZ2A 4PCEA 3O37A 5E9YA 2OSSA 4TU4A 3U5PA 5IIDA 4LC2A 5CUCA 4PKLA 4IOQA 4MR4A 5DKDA 5LJ0A 4TT4A 5JWMA 5E7DA 3P1FA 4QC1A 4UYHA 5E9LA 5FFYA 5FE8A 4Q0OA 5IGMA 3O33A 3ZYUA 3HMEA 3UV4A 4NQNA 5C7NA 5CQ4A 5DLXA 5DKHA 5EK9A 4TTEA 3O36A 3GG3A 4HXLA 2N9GA 2D82A 5F62A 4YYKA 4PS5A 5CQAA 4CLBA 4PY6A 4HXKA 4QC3A 5E74A 5I7XA 4X2IA 4J3IA 2YEMA 3S91A 2GRCA 4YH4A 4NR6A 2RNXA 5A5SA 4TQNA 4QYDA 5FE5A 5FB1A 4LYIA 5H1TA 4A9NA 2D9EA 4XY8A 5EQ1A 5EWCA 5G4SA 4C67A 5FFWA 2RNWA 4QSVA 5F63A 5L8UA 5HRVA 5I29A 5F60A 5EWDA 2FSAA 2YDWA 4HBXA 3JVKA 4UIYA 3NXBA 5FH8A 5ENEA 3DWYA 4UYGA 5EM3A 1JSPB 4ALGA 4YADA 4CURA 5CZGA 5DW1A 4MR6A 2I8NA 2G4AA 4E96A 2RO1A 4J0RA 5KU3A 4BW1A 5FG4A 5EPRA 5I40A 2L5EA 3QZVA 4QR4A 4O7AA 5F36A 4KCXA 4ZC9A 5ENFA 2RS9B 4LR6A 4XUAA 4ZW1A 4GPJA 5F61A 5FE9A 5LJ2A 3U5KA 4KV4A 5BT5A 5D3SA 4A9MA 4YY6A 2KTBB 5CUGA 2YEKA 4QY4A 2DVSA 3IU6A 5D3RA 4ZQLA 4UYFA 5EU1A 5E9MA 5LVRA 4HBVA 5F5ZA 2RNYA 5FH6A 4QZSA 5HELA 5I89A 5DKCA 5HM0A 3SVFA 5DBMA 4QSSA 4HBWA 5ENGA 4YABA 3JVJA 5HQ6A 4QUUA 5D25A 3TLPA 1F68A 5C8GA 3O34A 3MB3A 4YC9A 5ENHA 5L96A 4CUSA 3JVMA 5CQ3A 4KV1A 5E9VA 5CUBA 5L97A 3P5OA 2DATA 3MQMA 3O35A 5FFVA 4TT6A 4MR5A 4UITA 5D24A 5D26A 5G4RA 5CTLA 4MR3A 4Y03A 2RI7A 2E3KA 4J1PA 4IR5A 5CY9A 3SVHA 4MENA 2YELA 4QSTA 5HFRA 2OO1A 5AD3A 3ONIA 4YAXA 4A9OA 2DVRA 4LRGA 1ZS5A 4XYAA 3D7CA 4OUFA 5AMEA 5HCLA 5I80A 1N72A 4CUUA 5EV9A 5KO4A 4UYDA 5CQ8A 4NR9A 3P1EA 4Z6HA 3Q2FA 4QB3A 4AKNA 5K29A 4A9FA 5FG6A 4NUDA 4YBSA 5IG6A 4N3WA 2I7KA 5HQ5A 5IGKA 3HMHA 5FE4A 4YYIA 5FE2A 4Z93A 5I86A 5DYCA 5ENJA 5FE3A 5CFWA 2F6NA 5HRXA 1JM4B 5ETBA 1EQFA 4O75A 4LYSA 5BT3A 4OGJA 4A9LA 4DONA 5HRWA 5D3NA 5LKUA 3LJWA 5CQ5A 5EISA 5F3AA 5TB6A 4YYDA 4O7CA 5CQ6A 3QZSA 3LQHA 4QBMA 3AADA 3IU5A 5FH7A 4UIVA 2R0YA 5D3HA 4QSUA 4HXRA 3U5NA 4NRAA 4MEOA 4HXMA 4PTBA 4UIXA 5A5RA 4QR3A 5ENBA 5EWHA 5FG5A 5IGNA 3HMFA 3S92A 4UIWA 5ENIA 3MXFA 5A7CA 5KTWA 4TYLA 3LQJA 3Q2EA 3U5LA 5DYAA 5D3LA 5C85A 5L8TA 4O7EA 3UVDA 2DVQA 4N4GA 4IR3A 4CUTA 5ETDA 4BW4A 3G0LA 4TU6A 5I7YA 4O72A 4NYVA 5F25A 5D7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5II1 A;  5H1U A;  4QSR A;  5CGP A;  5I88 A;  4YAT A;  5AMF A;  4NYW A;  3RCW A;  5E73 A;  3U5J A;  2F6J A;  4IR4 A;  4A9K A;  4A9I A;  2LSP B;  4BHW A;  5CQT A;  4BJX A;  3LXJ A;  4YBT A;  5CQ7 A;  4QSP A;  5HEM A;  1X0J A;  5LVQ A;  1WUG A;  4NUC A;  4A9J A;  5EI4 A;  4NR7 A;  5KHM A;  5E0R A;  5EPS A;  5FE0 A;  4YYN A;  4BW3 A;  2DWW A;  5E9K A;  5KTX A;  5H85 A;  1E6I A;  5EIC A;  4LDF A;  4NR5 A;  4NRC A;  4CUQ A;  3G0J A;  2R0V A;  5A81 A;  4O7B A;  4QUT A;  5C4Q A;  4N4I A;  5D3J A;  5A85 A;  4Z1Q A;  5HJC A;  5C89 A;  2RFJ A;  3FKM X;  4O74 A;  2H60 A;  4O70 A;  4O77 A;  5CS8 A;  4A9H A;  3U5M A;  4O7F A;  4PCI A;  5DX4 A;  4XY9 A;  4HBY A;  2MJV B;  4HXS A;  5ACY A;  3UV5 A;  5F2P A;  5LKT A;  5HQ7 A;  4NUE A;  4LZS A;  4WHW A;  5DFD A;  2DKW A;  4O76 A;  5E3D A;  3MUK A;  4QR5 A;  3MUL A;  5DYX A;  4QEU A;  4YYM A;  4YYG A;  4QYL A;  5AD2 A;  5DFC A;  3LQI A;  4QEW A;  2R0S A;  2R10 A;  3QZT A;  3P1C A;  5A5N A;  2YYN A;  4MEP A;  5EVA A;  3P1D A;  4IOO A;  5F1L A;  4NXJ A;  4TS8 A;  3K2J A;  5CP5 A;  5CU8 A;  3UW9 A;  2L85 A;  4A9E A;  4UYE A;  4O78 A;  4F3I A;  5JI8 A;  4J0S A;  2L84 A;  4CUP A;  5ENC A;  5TCM A;  4LYW A;  5DLZ A;  3UV2 A;  4NQM A;  4UIU A;  4XUB A;  5EWW A;  5CRM A;  4CL9 A;  5DFB A;  5EP7 A;  4C66 A;  3U5O A;  4CFL A;  4YK0 A;  4O71 A;  5EA1 A;  5FE6 A;  3UVW A;  5HLS A;  5FDZ A;  2WP1 A;  4QNS A;  4LZ2 A;  3I3J A;  4ALH A;  5A82 A;  2YW5 A;  3SVG A;  5FE1 A;  4N4F A;  4MEQ A;  3UVX A;  4Z1S A;  5BT4 A;  5DW2 A;  4UIZ A;  2DVV A;  4FLP A;  5FE7 A;  3AQA A;  5FB0 A;  5EGU A;  5EWV A;  5HFQ A;  5FBX A;  4Z6I A;  5LJ1 A;  4QSW A;  2OUO A;  4NR8 A;  5CPE A;  5CRZ A;  4TZ8 A;  5L99 A;  5COI A;  5CUE A;  4NR4 A;  5E9I A;  4TT2 A;  3JVL A;  4NS5 A;  5KTU A;  4QEV A;  5D0C A;  2YQD A;  5A5P A;  4RVR A;  4BW2 A;  2NXB A;  5DY7 A;  4YYH A;  5A5Q A;  5I83 A;  5H1V A;  4IOR A;  5DYU A;  5C87 A;  5F1H A;  2WP2 A;  1WUM A;  4LZR A;  5II2 A;  3DAI A;  5E3G A;  5IBN A;  4HXP A;  5LKX A;  4YH3 A;  5D3P A;  4CFK A;  5LKZ A;  2E7O A;  4WHU A;  4HXN A;  3MB4 A;  4N4H A;  4NYX A;  4QSX A;  5CUA A;  4UYF B;  4QSQ A;  5EPB A;  5A5O A;  5HEN A;  4YYJ A;  5IGL A;  5I1Q A;  4HXO A;  5L98 A;  5A83 A;  5LUU A;  4OGI A;  3UVY A;  4WIV A;  5D3T A;  4YY4 A;  2E7N A;  4IR6 A;  5CUD A;  4NRB A;  4YBM A;  5J0D A;  4Q0N A;  4TZ2 A;  4PCE A;  3O37 A;  5E9Y A;  2OSS A;  4TU4 A;  3U5P A;  5IID A;  4LC2 A;  5CUC A;  4PKL A;  4IOQ A;  4MR4 A;  5DKD A;  5LJ0 A;  4TT4 A;  5JWM A;  5E7D A;  3P1F A;  4QC1 A;  4UYH A;  5E9L A;  5FFY A;  5FE8 A;  4Q0O A;  5IGM A;  3O33 A;  3ZYU A;  3HME A;  3UV4 A;  4NQN A;  5C7N A;  5CQ4 A;  5DLX A;  5DKH A;  5EK9 A;  4TTE A;  3O36 A;  3GG3 A;  4HXL A;  2N9G A;  2D82 A;  5F62 A;  4YYK A;  4PS5 A;  5CQA A;  4CLB A;  4PY6 A;  4HXK A;  4QC3 A;  5E74 A;  5I7X A;  4X2I A;  4J3I A;  2YEM A;  3S91 A;  2GRC A;  4YH4 A;  4NR6 A;  2RNX A;  5A5S A;  4TQN A;  4QYD A;  5FE5 A;  5FB1 A;  4LYI A;  5H1T A;  4A9N A;  2D9E A;  4XY8 A;  5EQ1 A;  5EWC A;  5G4S A;  4C67 A;  5FFW A;  2RNW A;  4QSV A;  5F63 A;  5L8U A;  5HRV A;  5I29 A;  5F60 A;  5EWD A;  2FSA A;  2YDW A;  4HBX A;  3JVK A;  4UIY A;  3NXB A;  5FH8 A;  5ENE A;  3DWY A;  4UYG A;  5EM3 A;  1JSP B;  4ALG A;  4YAD A;  4CUR A;  5CZG A;  5DW1 A;  4MR6 A;  2I8N A;  2G4A A;  4E96 A;  2RO1 A;  4J0R A;  5KU3 A;  4BW1 A;  5FG4 A;  5EPR A;  5I40 A;  2L5E A;  3QZV A;  4QR4 A;  4O7A A;  5F36 A;  4KCX A;  4ZC9 A;  5ENF A;  2RS9 B;  4LR6 A;  4XUA A;  4ZW1 A;  4GPJ A;  5F61 A;  5FE9 A;  5LJ2 A;  3U5K A;  4KV4 A;  5BT5 A;  5D3S A;  4A9M A;  4YY6 A;  2KTB B;  5CUG A;  2YEK A;  4QY4 A;  2DVS A;  3IU6 A;  5D3R A;  4ZQL A;  4UYF A;  5EU1 A;  5E9M A;  5LVR A;  4HBV A;  5F5Z A;  2RNY A;  5FH6 A;  4QZS A;  5HEL A;  5I89 A;  5DKC A;  5HM0 A;  3SVF A;  5DBM A;  4QSS A;  4HBW A;  5ENG A;  4YAB A;  3JVJ A;  5HQ6 A;  4QUU A;  5D25 A;  3TLP A;  1F68 A;  5C8G A;  3O34 A;  3MB3 A;  4YC9 A;  5ENH A;  5L96 A;  4CUS A;  3JVM A;  5CQ3 A;  4KV1 A;  5E9V A;  5CUB A;  5L97 A;  3P5O A;  2DAT A;  3MQM A;  3O35 A;  5FFV A;  4TT6 A;  4MR5 A;  4UIT A;  5D24 A;  5D26 A;  5G4R A;  5CTL A;  4MR3 A;  4Y03 A;  2RI7 A;  2E3K A;  4J1P A;  4IR5 A;  5CY9 A;  3SVH A;  4MEN A;  2YEL A;  4QST A;  5HFR A;  2OO1 A;  5AD3 A;  3ONI A;  4YAX A;  4A9O A;  2DVR A;  4LRG A;  1ZS5 A;  4XYA A;  3D7C A;  4OUF A;  5AME A;  5HCL A;  5I80 A;  1N72 A;  4CUU A;  5EV9 A;  5KO4 A;  4UYD A;  5CQ8 A;  4NR9 A;  3P1E A;  4Z6H A;  3Q2F A;  4QB3 A;  4AKN A;  5K29 A;  4A9F A;  5FG6 A;  4NUD A;  4YBS A;  5IG6 A;  4N3W A;  2I7K A;  5HQ5 A;  5IGK A;  3HMH A;  5FE4 A;  4YYI A;  5FE2 A;  4Z93 A;  5I86 A;  5DYC A;  5ENJ A;  5FE3 A;  5CFW A;  2F6N A;  5HRX A;  1JM4 B;  5ETB A;  1EQF A;  4O75 A;  4LYS A;  5BT3 A;  4OGJ A;  4A9L A;  4DON A;  5HRW A;  5D3N A;  5LKU A;  3LJW A;  5CQ5 A;  5EIS A;  5F3A A;  5TB6 A;  4YYD A;  4O7C A;  5CQ6 A;  3QZS A;  3LQH A;  4QBM A;  3AAD A;  3IU5 A;  5FH7 A;  4UIV A;  2R0Y A;  5D3H A;  4QSU A;  4HXR A;  3U5N A;  4NRA A;  4MEO A;  4HXM A;  4PTB A;  4UIX A;  5A5R A;  4QR3 A;  5ENB A;  5EWH A;  5FG5 A;  5IGN A;  3HMF A;  3S92 A;  4UIW A;  5ENI A;  3MXF A;  5A7C A;  5KTW A;  4TYL A;  3LQJ A;  3Q2E A;  3U5L A;  5DYA A;  5D3L A;  5C85 A;  5L8T A;  4O7E A;  3UVD A;  2DVQ A;  4N4G A;  4IR3 A;  4CUT A;  5ETD A;  4BW4 A;  3G0L A;  4TU6 A;  5I7Y A;  4O72 A;  4NYV A;  5F25 A;  5D7X A; 
#chains in the Genus database with same CATH topology
 5II1 A;  5H1U A;  4QSR A;  5CGP A;  5I88 A;  4YAT A;  5AMF A;  4NYW A;  3RCW A;  5E73 A;  3U5J A;  2F6J A;  4IR4 A;  4A9K A;  4A9I A;  2LSP B;  4BHW A;  5CQT A;  4BJX A;  3LXJ A;  4YBT A;  5CQ7 A;  4QSP A;  5HEM A;  1X0J A;  5LVQ A;  1WUG A;  4NUC A;  4A9J A;  5EI4 A;  4NR7 A;  5KHM A;  5E0R A;  5EPS A;  5FE0 A;  4YYN A;  4BW3 A;  2DWW A;  5E9K A;  5KTX A;  5H85 A;  1E6I A;  5EIC A;  4LDF A;  4NR5 A;  4NRC A;  4CUQ A;  3G0J A;  2R0V A;  5A81 A;  4O7B A;  4QUT A;  5C4Q A;  4N4I A;  5D3J A;  5A85 A;  4Z1Q A;  5HJC A;  5C89 A;  2RFJ A;  3FKM X;  4O74 A;  2H60 A;  4O70 A;  4O77 A;  5CS8 A;  4A9H A;  3U5M A;  4O7F A;  4PCI A;  5DX4 A;  4XY9 A;  4HBY A;  2MJV B;  4HXS A;  5ACY A;  3UV5 A;  5F2P A;  5LKT A;  5HQ7 A;  4NUE A;  4LZS A;  4WHW A;  5DFD A;  2DKW A;  4O76 A;  5E3D A;  3MUK A;  4QR5 A;  3MUL A;  5DYX A;  4QEU A;  4YYM A;  4YYG A;  4QYL A;  5AD2 A;  5DFC A;  3LQI A;  4QEW A;  2R0S A;  2R10 A;  3QZT A;  3P1C A;  5A5N A;  2YYN A;  4MEP A;  5EVA A;  3P1D A;  4IOO A;  5F1L A;  4NXJ A;  4TS8 A;  3K2J A;  5CP5 A;  5CU8 A;  3UW9 A;  2L85 A;  4A9E A;  4UYE A;  4O78 A;  4F3I A;  5JI8 A;  4J0S A;  2L84 A;  4CUP A;  5ENC A;  5TCM A;  4LYW A;  5DLZ A;  3UV2 A;  4NQM A;  4UIU A;  4XUB A;  5EWW A;  5CRM A;  4CL9 A;  5DFB A;  5EP7 A;  4C66 A;  3U5O A;  4CFL A;  4YK0 A;  4O71 A;  5EA1 A;  5FE6 A;  3UVW A;  5HLS A;  5FDZ A;  2WP1 A;  4QNS A;  4LZ2 A;  3I3J A;  4ALH A;  5A82 A;  2YW5 A;  3SVG A;  5FE1 A;  4N4F A;  4MEQ A;  3UVX A;  4Z1S A;  5BT4 A;  5DW2 A;  4UIZ A;  2DVV A;  4FLP A;  5FE7 A;  3AQA A;  5FB0 A;  5EGU A;  5EWV A;  5HFQ A;  5FBX A;  4Z6I A;  5LJ1 A;  4QSW A;  2OUO A;  4AKH A;  4NR8 A;  5CPE A;  5CRZ A;  4TZ8 A;  5L99 A;  5COI A;  5CUE A;  4NR4 A;  5E9I A;  4TT2 A;  3JVL A;  4NS5 A;  5KTU A;  4QEV A;  5D0C A;  2YQD A;  5A5P A;  4RVR A;  4BW2 A;  2NXB A;  5DY7 A;  4YYH A;  3D1D A;  5A5Q A;  5I83 A;  5H1V A;  4IOR A;  5DYU A;  5C87 A;  5F1H A;  2WP2 A;  1WUM A;  4LZR A;  5II2 A;  3DAI A;  5E3G A;  5IBN A;  4HXP A;  5LKX A;  4YH3 A;  5D3P A;  4CFK A;  5LKZ A;  2E7O A;  4WHU A;  4HXN A;  3MB4 A;  4N4H A;  4NYX A;  4QSX A;  5CUA A;  4UYF B;  4QSQ A;  5EPB A;  5A5O A;  5HEN A;  4YYJ A;  5IGL A;  5I1Q A;  4HXO A;  5L98 A;  5A83 A;  5LUU A;  4OGI A;  3UVY A;  4WIV A;  5D3T A;  4YY4 A;  2E7N A;  4IR6 A;  5CUD A;  4NRB A;  4YBM A;  5J0D A;  4Q0N A;  4TZ2 A;  4PCE A;  4AI6 A;  3O37 A;  5E9Y A;  2OSS A;  4TU4 A;  3U5P A;  5IID A;  4LC2 A;  5CUC A;  4PKL A;  4IOQ A;  4MR4 A;  5DKD A;  5LJ0 A;  4TT4 A;  5JWM A;  5E7D A;  1ZKR A;  3P1F A;  4QC1 A;  4AKG A;  3VKG A;  4UYH A;  5E9L A;  5FFY A;  5FE8 A;  4Q0O A;  5IGM A;  3O33 A;  3ZYU A;  3HME A;  3UV4 A;  4NQN A;  5C7N A;  5CQ4 A;  5DLX A;  5DKH A;  5EK9 A;  4TTE A;  3O36 A;  3GG3 A;  4HXL A;  2N9G A;  2D82 A;  5F62 A;  4YYK A;  4PS5 A;  5CQA A;  4CLB A;  4PY6 A;  4HXK A;  4QC3 A;  5E74 A;  5I7X A;  4X2I A;  4J3I A;  2YEM A;  3S91 A;  2GRC A;  4YH4 A;  4NR6 A;  2RNX A;  5A5S A;  4TQN A;  4QYD A;  5FE5 A;  5FB1 A;  4LYI A;  5H1T A;  4A9N A;  2D9E A;  4XY8 A;  5EQ1 A;  5EWC A;  5G4S A;  4C67 A;  5FFW A;  2RNW A;  4QSV A;  5F63 A;  5L8U A;  5HRV A;  5I29 A;  5F60 A;  5EWD A;  2FSA A;  2YDW A;  4HBX A;  3JVK A;  4UIY A;  3NXB A;  5FH8 A;  5ENE A;  3DWY A;  4UYG A;  5EM3 A;  1JSP B;  4ALG A;  4YAD A;  4CUR A;  5CZG A;  3D1B A;  5DW1 A;  4MR6 A;  2I8N A;  2G4A A;  4E96 A;  2RO1 A;  4J0R A;  5KU3 A;  4BW1 A;  5FG4 A;  5EPR A;  5I40 A;  2L5E A;  3QZV A;  4QR4 A;  4O7A A;  5F36 A;  4KCX A;  4ZC9 A;  5ENF A;  2RS9 B;  4LR6 A;  4XUA A;  4ZW1 A;  4GPJ A;  5F61 A;  5FE9 A;  5LJ2 A;  3U5K A;  4KV4 A;  5BT5 A;  5D3S A;  4A9M A;  4YY6 A;  2KTB B;  3VKH A;  5CUG A;  2YEK A;  4QY4 A;  2DVS A;  3IU6 A;  5D3R A;  4ZQL A;  4UYF A;  5EU1 A;  5E9M A;  5LVR A;  4HBV A;  5F5Z A;  2RNY A;  5FH6 A;  4AKI A;  4QZS A;  5HEL A;  5I89 A;  5DKC A;  5HM0 A;  3SVF A;  5DBM A;  4QSS A;  4HBW A;  5ENG A;  4YAB A;  3JVJ A;  5HQ6 A;  2EJN A;  4QUU A;  5D25 A;  3TLP A;  1F68 A;  5C8G A;  3O34 A;  3MB3 A;  4YC9 A;  5ENH A;  5L96 A;  4CUS A;  3JVM A;  5CQ3 A;  4KV1 A;  5E9V A;  5CUB A;  5L97 A;  3P5O A;  2DAT A;  3MQM A;  3O35 A;  5FFV A;  4TT6 A;  4MR5 A;  4UIT A;  5D24 A;  5D26 A;  5G4R A;  5CTL A;  4MR3 A;  3ERR A;  4Y03 A;  2RI7 A;  2E3K A;  4J1P A;  4IR5 A;  5CY9 A;  3SVH A;  4MEN A;  2YEL A;  4QST A;  5HFR A;  2OO1 A;  5AD3 A;  3ONI A;  4YAX A;  4A9O A;  2DVR A;  4LRG A;  1ZS5 A;  4XYA A;  3D7C A;  4OUF A;  5AME A;  5HCL A;  5I80 A;  1N72 A;  4CUU A;  5EV9 A;  5KO4 A;  4UYD A;  5CQ8 A;  4NR9 A;  3P1E A;  4Z6H A;  3Q2F A;  4QB3 A;  4AKN A;  5K29 A;  4A9F A;  5FG6 A;  4NUD A;  4YBS A;  5IG6 A;  4N3W A;  2I7K A;  5HQ5 A;  5IGK A;  3HMH A;  5FE4 A;  4YYI A;  5FE2 A;  4Z93 A;  5I86 A;  5DYC A;  5ENJ A;  5FE3 A;  5CFW A;  2F6N A;  5HRX A;  1JM4 B;  5ETB A;  1EQF A;  4O75 A;  4LYS A;  5BT3 A;  4OGJ A;  4A9L A;  4DON A;  5HRW A;  5D3N A;  5LKU A;  3LJW A;  5CQ5 A;  5EIS A;  5F3A A;  5TB6 A;  4YYD A;  1PUO A;  4O7C A;  5CQ6 A;  3QZS A;  3LQH A;  4QBM A;  3AAD A;  3IU5 A;  5FH7 A;  4UIV A;  2R0Y A;  5D3H A;  4QSU A;  4HXR A;  3U5N A;  4NRA A;  4MEO A;  4HXM A;  4PTB A;  4UIX A;  5A5R A;  4QR3 A;  5ENB A;  5EWH A;  5FG5 A;  5IGN A;  3HMF A;  3S92 A;  4UIW A;  5ENI A;  3MXF A;  5A7C A;  5KTW A;  4TYL A;  3LQJ A;  3Q2E A;  3U5L A;  5DYA A;  5D3L A;  5C85 A;  5L8T A;  4O7E A;  3UVD A;  2DVQ A;  4N4G A;  4IR3 A;  4CUT A;  5ETD A;  4BW4 A;  3G0L A;  4TU6 A;  5I7Y A;  4O72 A;  4NYV A;  5F25 A;  5D7X A; 
#chains in the Genus database with same CATH homology
 5II1 A;  5H1U A;  4QSR A;  5CGP A;  5I88 A;  4YAT A;  5AMF A;  4NYW A;  3RCW A;  5E73 A;  3U5J A;  2F6J A;  4IR4 A;  4A9K A;  4A9I A;  2LSP B;  4BHW A;  5CQT A;  4BJX A;  3LXJ A;  4YBT A;  5CQ7 A;  4QSP A;  5HEM A;  1X0J A;  5LVQ A;  1WUG A;  4NUC A;  4A9J A;  5EI4 A;  4NR7 A;  5KHM A;  5E0R A;  5EPS A;  5FE0 A;  4YYN A;  4BW3 A;  2DWW A;  5E9K A;  5KTX A;  5H85 A;  1E6I A;  5EIC A;  4LDF A;  4NR5 A;  4NRC A;  4CUQ A;  3G0J A;  2R0V A;  5A81 A;  4O7B A;  4QUT A;  5C4Q A;  4N4I A;  5D3J A;  5A85 A;  4Z1Q A;  5HJC A;  5C89 A;  2RFJ A;  3FKM X;  4O74 A;  2H60 A;  4O70 A;  4O77 A;  5CS8 A;  4A9H A;  3U5M A;  4O7F A;  4PCI A;  5DX4 A;  4XY9 A;  4HBY A;  2MJV B;  4HXS A;  5ACY A;  3UV5 A;  5F2P A;  5LKT A;  5HQ7 A;  4NUE A;  4LZS A;  4WHW A;  5DFD A;  2DKW A;  4O76 A;  5E3D A;  3MUK A;  4QR5 A;  3MUL A;  5DYX A;  4QEU A;  4YYM A;  4YYG A;  4QYL A;  5AD2 A;  5DFC A;  3LQI A;  4QEW A;  2R0S A;  2R10 A;  3QZT A;  3P1C A;  5A5N A;  2YYN A;  4MEP A;  5EVA A;  3P1D A;  4IOO A;  5F1L A;  4NXJ A;  4TS8 A;  3K2J A;  5CP5 A;  5CU8 A;  3UW9 A;  2L85 A;  4A9E A;  4UYE A;  4O78 A;  4F3I A;  5JI8 A;  4J0S A;  2L84 A;  4CUP A;  5ENC A;  5TCM A;  4LYW A;  5DLZ A;  3UV2 A;  4NQM A;  4UIU A;  4XUB A;  5EWW A;  5CRM A;  4CL9 A;  5DFB A;  5EP7 A;  4C66 A;  3U5O A;  4CFL A;  4YK0 A;  4O71 A;  5EA1 A;  5FE6 A;  3UVW A;  5HLS A;  5FDZ A;  2WP1 A;  4QNS A;  4LZ2 A;  3I3J A;  4ALH A;  5A82 A;  2YW5 A;  3SVG A;  5FE1 A;  4N4F A;  4MEQ A;  3UVX A;  4Z1S A;  5BT4 A;  5DW2 A;  4UIZ A;  2DVV A;  4FLP A;  5FE7 A;  3AQA A;  5FB0 A;  5EGU A;  5EWV A;  5HFQ A;  5FBX A;  4Z6I A;  5LJ1 A;  4QSW A;  2OUO A;  4NR8 A;  5CPE A;  5CRZ A;  4TZ8 A;  5L99 A;  5COI A;  5CUE A;  4NR4 A;  5E9I A;  4TT2 A;  3JVL A;  4NS5 A;  5KTU A;  4QEV A;  5D0C A;  2YQD A;  5A5P A;  4RVR A;  4BW2 A;  2NXB A;  5DY7 A;  4YYH A;  5A5Q A;  5I83 A;  5H1V A;  4IOR A;  5DYU A;  5C87 A;  5F1H A;  2WP2 A;  1WUM A;  4LZR A;  5II2 A;  3DAI A;  5E3G A;  5IBN A;  4HXP A;  5LKX A;  4YH3 A;  5D3P A;  4CFK A;  5LKZ A;  2E7O A;  4WHU A;  4HXN A;  3MB4 A;  4N4H A;  4NYX A;  4QSX A;  5CUA A;  4UYF B;  4QSQ A;  5EPB A;  5A5O A;  5HEN A;  4YYJ A;  5IGL A;  5I1Q A;  4HXO A;  5L98 A;  5A83 A;  5LUU A;  4OGI A;  3UVY A;  4WIV A;  5D3T A;  4YY4 A;  2E7N A;  4IR6 A;  5CUD A;  4NRB A;  4YBM A;  5J0D A;  4Q0N A;  4TZ2 A;  4PCE A;  3O37 A;  5E9Y A;  2OSS A;  4TU4 A;  3U5P A;  5IID A;  4LC2 A;  5CUC A;  4PKL A;  4IOQ A;  4MR4 A;  5DKD A;  5LJ0 A;  4TT4 A;  5JWM A;  5E7D A;  3P1F A;  4QC1 A;  4UYH A;  5E9L A;  5FFY A;  5FE8 A;  4Q0O A;  5IGM A;  3O33 A;  3ZYU A;  3HME A;  3UV4 A;  4NQN A;  5C7N A;  5CQ4 A;  5DLX A;  5DKH A;  5EK9 A;  4TTE A;  3O36 A;  3GG3 A;  4HXL A;  2N9G A;  2D82 A;  5F62 A;  4YYK A;  4PS5 A;  5CQA A;  4CLB A;  4PY6 A;  4HXK A;  4QC3 A;  5E74 A;  5I7X A;  4X2I A;  4J3I A;  2YEM A;  3S91 A;  2GRC A;  4YH4 A;  4NR6 A;  2RNX A;  5A5S A;  4TQN A;  4QYD A;  5FE5 A;  5FB1 A;  4LYI A;  5H1T A;  4A9N A;  2D9E A;  4XY8 A;  5EQ1 A;  5EWC A;  5G4S A;  4C67 A;  5FFW A;  2RNW A;  4QSV A;  5F63 A;  5L8U A;  5HRV A;  5I29 A;  5F60 A;  5EWD A;  2FSA A;  2YDW A;  4HBX A;  3JVK A;  4UIY A;  3NXB A;  5FH8 A;  5ENE A;  3DWY A;  4UYG A;  5EM3 A;  1JSP B;  4ALG A;  4YAD A;  4CUR A;  5CZG A;  5DW1 A;  4MR6 A;  2I8N A;  2G4A A;  4E96 A;  2RO1 A;  4J0R A;  5KU3 A;  4BW1 A;  5FG4 A;  5EPR A;  5I40 A;  2L5E A;  3QZV A;  4QR4 A;  4O7A A;  5F36 A;  4KCX A;  4ZC9 A;  5ENF A;  2RS9 B;  4LR6 A;  4XUA A;  4ZW1 A;  4GPJ A;  5F61 A;  5FE9 A;  5LJ2 A;  3U5K A;  4KV4 A;  5BT5 A;  5D3S A;  4A9M A;  4YY6 A;  2KTB B;  5CUG A;  2YEK A;  4QY4 A;  2DVS A;  3IU6 A;  5D3R A;  4ZQL A;  4UYF A;  5EU1 A;  5E9M A;  5LVR A;  4HBV A;  5F5Z A;  2RNY A;  5FH6 A;  4QZS A;  5HEL A;  5I89 A;  5DKC A;  5HM0 A;  3SVF A;  5DBM A;  4QSS A;  4HBW A;  5ENG A;  4YAB A;  3JVJ A;  5HQ6 A;  4QUU A;  5D25 A;  3TLP A;  1F68 A;  5C8G A;  3O34 A;  3MB3 A;  4YC9 A;  5ENH A;  5L96 A;  4CUS A;  3JVM A;  5CQ3 A;  4KV1 A;  5E9V A;  5CUB A;  5L97 A;  3P5O A;  2DAT A;  3MQM A;  3O35 A;  5FFV A;  4TT6 A;  4MR5 A;  4UIT A;  5D24 A;  5D26 A;  5G4R A;  5CTL A;  4MR3 A;  4Y03 A;  2RI7 A;  2E3K A;  4J1P A;  4IR5 A;  5CY9 A;  3SVH A;  4MEN A;  2YEL A;  4QST A;  5HFR A;  2OO1 A;  5AD3 A;  3ONI A;  4YAX A;  4A9O A;  2DVR A;  4LRG A;  1ZS5 A;  4XYA A;  3D7C A;  4OUF A;  5AME A;  5HCL A;  5I80 A;  1N72 A;  4CUU A;  5EV9 A;  5KO4 A;  4UYD A;  5CQ8 A;  4NR9 A;  3P1E A;  4Z6H A;  3Q2F A;  4QB3 A;  4AKN A;  5K29 A;  4A9F A;  5FG6 A;  4NUD A;  4YBS A;  5IG6 A;  4N3W A;  2I7K A;  5HQ5 A;  5IGK A;  3HMH A;  5FE4 A;  4YYI A;  5FE2 A;  4Z93 A;  5I86 A;  5DYC A;  5ENJ A;  5FE3 A;  5CFW A;  2F6N A;  5HRX A;  1JM4 B;  5ETB A;  1EQF A;  4O75 A;  4LYS A;  5BT3 A;  4OGJ A;  4A9L A;  4DON A;  5HRW A;  5D3N A;  5LKU A;  3LJW A;  5CQ5 A;  5EIS A;  5F3A A;  5TB6 A;  4YYD A;  4O7C A;  5CQ6 A;  3QZS A;  3LQH A;  4QBM A;  3AAD A;  3IU5 A;  5FH7 A;  4UIV A;  2R0Y A;  5D3H A;  4QSU A;  4HXR A;  3U5N A;  4NRA A;  4MEO A;  4HXM A;  4PTB A;  4UIX A;  5A5R A;  4QR3 A;  5ENB A;  5EWH A;  5FG5 A;  5IGN A;  3HMF A;  3S92 A;  4UIW A;  5ENI A;  3MXF A;  5A7C A;  5KTW A;  4TYL A;  3LQJ A;  3Q2E A;  3U5L A;  5DYA A;  5D3L A;  5C85 A;  5L8T A;  4O7E A;  3UVD A;  2DVQ A;  4N4G A;  4IR3 A;  4CUT A;  5ETD A;  4BW4 A;  3G0L A;  4TU6 A;  5I7Y A;  4O72 A;  4NYV A;  5F25 A;  5D7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...