3IU6A

Crystal structure of the sixth bromodomain of human poly-bromodomain containing protein 1 (pb1)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
143
structure length
142
Chain Sequence
MNVTLLIQELIHNLFVSVMSHQDDEGRYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVENNRYRRLDLFQEHMFEVLERARRMNRTDSEIYEDAVELQQFFIKIRDELCKNGEILLSPALSYTTKHLHNDVEKERKEKLPKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein polybromo-1
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 142
sequence length 143
ec nomenclature
pdb deposition date 2009-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3iu6A00
4MENA 5I7YA 5LKZA 3DWYA 2N9GA 3MULA 4YH4A 5CQTA 4OUFA 5ENJA 4YY6A 5DKHA 5E9MA 4PKLA 3UW9A 5L96A 5IBNA 5E73A 4UYFA 4QSXA 4Z6IA 4GPJA 4BJXA 4LRGA 4QSTA 5CQ4A 2DKWA 4MEQA 5D3PA 5CP5A 5H85A 5IG6A 5HCLA 3AADA 5ACYA 5D3RA 4QYDA 3U5KA 4YABA 5CUBA 4WHUA 4MEOA 4QUTA 4TQNA 5L98A 4CUQA 4N4IA 5EPBA 5DW1A 5EA1A 4HXNA 5KHMA 3MUKA 5D3LA 4HXPA 5FB0A 5EU1A 5H1UA 4QEVA 5A83A 4IR5A 5HLSA 4QSUA 2DATA 5CUAA 5E9LA 4IOQA 4HBXA 4Z93A 2FSAA 5FE3A 5A81A 4A9IA 5FE8A 4MR6A 5FH7A 3UVDA 4A9OA 5EP7A 2LSPB 5ENBA 2DVVA 5II2A 4YK0A 4O7CA 4YC9A 4QC3A 4YBMA 3O37A 4NUDA 5HENA 5EWWA 2I7KA 5F36A 5F63A 5IGNA 5ENHA 5E3DA 3MQMA 5EVAA 4YYNA 5HQ5A 4Y03A 4A9EA 4AKNA 5F3AA 4CL9A 4YBTA 5I1QA 3HMEA 3P5OA 5CQ8A 3QZTA 4QY4A 2KTBB 4ZQLA 5CQ5A 4LYSA 4F3IA 3UVXA 5CQ7A 2I8NA 4HXSA 5I29A 4UIVA 4YY4A 4IOOA 3Q2EA 2YELA 3ONIA 5HRWA 5F2PA 5LJ0A 4TT6A 2WP1A 5DYCA 4NR4A 3P1CA 5FE4A 4C67A 3MXFA 5AMFA 4KCXA 4CUTA 2R0SA 5COIA 5HRXA 3U5LA 5G4RA 4MEPA 5K29A 5CQ6A 5E0RA 1EQFA 5CQ3A 2RS9B 4NR8A 5CQAA 3G0LA 4KV1A 5FH6A 4A9LA 5EWDA 5I7XA 5DFBA 4TU4A 5FFVA 3O36A 5DKDA 4NQMA 4UIXA 3SVFA 4BHWA 4QYLA 4QSWA 5TCMA 5A5NA 2RNYA 3GG3A 5ENCA 4PCIA 4HXRA 5BT4A 4Z6HA 5II1A 5A5SA 5E3GA 4QBMA 4Z1SA 4J0SA 4QEWA 5FH8A 5H1TA 5F5ZA 4CLBA 4YATA 4UIZA 2WP2A 1WUMA 3U5MA 5JI8A 2YQDA 5CRZA 5DLZA 3P1EA 5DYXA 2YYNA 4CFLA 4TTEA 5E74A 5C87A 3P1DA 5IGKA 5KTWA 4YYMA 2DVRA 4O7BA 4IORA 4XY9A 3DAIA 5FG5A 1ZS5A 3K2JA 3UV4A 3U5JA 4FLPA 5D25A 3S91A 5IGLA 2DWWA 5G4SA 4KV4A 5A5PA 3O35A 3O33A 5FE6A 5KU3A 5I83A 4O7FA 4YADA 5EWCA 4N4GA 5DYAA 1X0JA 5ENEA 5FE9A 4QEUA 4NXJA 4TS8A 4XY8A 5F62A 5CS8A 4QSRA 5EWHA 4J3IA 4A9JA 4YAXA 3UV2A 4UIUA 5CUGA 4OGIA 3U5OA 3U5NA 4YYDA 4LYWA 3ZYUA 5DFCA 5I86A 3LJWA 5J0DA 3LQJA 4N3WA 5DW2A 4UIWA 5BT3A 4QNSA 2MJVB 4NR6A 5FE2A 4QZSA 2R0VA 5BT5A 4QUUA 5LKXA 4NRAA 4TU6A 3FKMX 4PTBA 5DBMA 5DYUA 3MB4A 5TB6A 1F68A 4ZC9A 4Z1QA 4O71A 2L85A 4O7EA 5EGUA 4DONA 5FE1A 5LVRA 5EICA 4LC2A 4CFKA 5L8TA 5CUCA 4YH3A 4O78A 4NYVA 5DX4A 5KTUA 2RNWA 3UV5A 5D24A 1WUGA 2E7NA 1E6IA 4LR6A 2F6JA 3IU6A 4YBSA 4UIYA 4J0RA 4O70A 3P1FA 4BW2A 1JSPB 2RNXA 4PCEA 4LZSA 4TT2A 5FG6A 4QR5A 4IR4A 4QR4A 5C89A 4QR3A 5HFQA 5EM3A 5C4QA 4HBYA 5D26A 4A9FA 2YEMA 3LQIA 4O75A 4RVRA 5KTXA 5D3HA 5L8UA 5JWMA 5ENGA 4NRBA 4NR5A 5A5OA 4O77A 5D3NA 4N4HA 5D3JA 2D9EA 5EPRA 2D82A 4HXMA 3UVYA 5EISA 2G4AA 4ALHA 2OUOA 5E9VA 5AMEA 4CUPA 5A5RA 4HXOA 5C8GA 3RCWA 5HQ6A 2GRCA 2L5EA 4NYXA 5KO4A 1JM4B 3NXBA 3D7CA 5FFWA 4O7AA 5DY7A 3LQHA 5LJ2A 5CU8A 4MR5A 5FG4A 4A9KA 5IGMA 4UYEA 5LUUA 4LDFA 3JVJA 5D7XA 5IIDA 2DVQA 2H60A 4BW4A 4MR4A 5D0CA 5FFYA 4YYJA 1N72A 5ETDA 2R10A 5CZGA 2OO1A 4NQNA 5E7DA 5EI4A 4BW1A 4A9MA 5CUDA 5I40A 4C66A 2L84A 5HFRA 4X2IA 2YEKA 5LVQA 4LZ2A 4XYAA 5FE0A 4TZ8A 4HBVA 5I89A 3QZVA 5E9KA 3S92A 2YW5A 4BW3A 5ENIA 2E7OA 4IR6A 4QSPA 4XUAA 2R0YA 4TT4A 5ENFA 4ALGA 2RFJA 3JVLA 5ETBA 4YYIA 5EPSA 5EQ1A 4Q0OA 4QB3A 4QC1A 3SVHA 5HELA 4LZRA 4WIVA 5CPEA 4O74A 5F61A 3HMHA 4NYWA 3IU5A 4YYKA 5A82A 5I88A 5FDZA 4ZW1A 5LKUA 4N4FA 5DKCA 5HJCA 2RI7A 4UYHA 5FE5A 4NUCA 4MR3A 5CY9A 4O76A 4LYIA 4NS5A 4TZ2A 2E3KA 4QSQA 5EWVA 5DFDA 4XUBA 4CUSA 4QSSA 5DLXA 3Q2FA 5EV9A 5F1LA 5E9IA 5CFWA 2DVSA 4TYLA 5H1VA 4E96A 3I3JA 2YDWA 5AD3A 3SVGA 4HXLA 5HRVA 4NRCA 5LKTA 4J1PA 2RO1A 4YYHA 3AQAA 5FB1A 5F25A 4NR9A 5HEMA 4A9HA 4CURA 4CUUA 3LXJA 4O72A 5CTLA 5L97A 4UITA 3QZSA 5HM0A 4UYGA 5D3SA 5A5QA 3O34A 4UYDA 5HQ7A 4Q0NA 4IR3A 3JVKA 4UYFB 5CGPA 4OGJA 4YYGA 5LJ1A 5CUEA 4PS5A 3JVMA 5F60A 3TLPA 2OSSA 4NUEA 2NXBA 5C7NA 5FE7A 4QSVA 5AD2A 3G0JA 5CRMA 3U5PA 5EK9A 5A85A 5C85A 5FBXA 5E9YA 4NR7A 5I80A 5D3TA 5L99A 5F1HA 4A9NA 4HXKA 5A7CA 3MB3A 4HBWA 3HMFA 4WHWA 3UVWA 2F6NA 4PY6A
chains in the Genus database with same CATH superfamily
4MENA 5I7YA 5LKZA 3DWYA 2N9GA 3MULA 4YH4A 5CQTA 4OUFA 5ENJA 4YY6A 5DKHA 5E9MA 4PKLA 3UW9A 5L96A 5IBNA 5E73A 4UYFA 4QSXA 4Z6IA 4GPJA 4BJXA 4LRGA 4QSTA 5CQ4A 2DKWA 4MEQA 5D3PA 5CP5A 5H85A 5IG6A 5HCLA 3AADA 5ACYA 5D3RA 4QYDA 3U5KA 4YABA 5CUBA 4WHUA 4MEOA 4QUTA 4TQNA 5L98A 4CUQA 4N4IA 5EPBA 5DW1A 5EA1A 4HXNA 5KHMA 5D3LA 3MUKA 4HXPA 5FB0A 5EU1A 5H1UA 4QEVA 5A83A 4IR5A 5HLSA 4QSUA 1PUOA 2DATA 5CUAA 5E9LA 4IOQA 4HBXA 4Z93A 2FSAA 5FE3A 5A81A 4A9IA 5FE8A 4MR6A 5FH7A 3UVDA 4A9OA 5EP7A 2LSPB 5ENBA 2DVVA 5II2A 4YK0A 4O7CA 4YC9A 4QC3A 4YBMA 3O37A 4NUDA 5HENA 5EWWA 2I7KA 5F36A 5F63A 5IGNA 5ENHA 5E3DA 3MQMA 5EVAA 4YYNA 5HQ5A 4Y03A 4A9EA 4AKNA 5F3AA 4CL9A 4YBTA 5I1QA 3HMEA 3P5OA 5CQ8A 3QZTA 4QY4A 2KTBB 4ZQLA 5CQ5A 4LYSA 4F3IA 3UVXA 5CQ7A 2I8NA 4HXSA 5I29A 4UIVA 4YY4A 4AKIA 4IOOA 3Q2EA 2YELA 3ONIA 5HRWA 5F2PA 5LJ0A 4TT6A 2WP1A 5DYCA 4NR4A 3P1CA 5FE4A 1ZKRA 4C67A 3MXFA 5AMFA 4KCXA 4CUTA 2R0SA 5COIA 5HRXA 3U5LA 5G4RA 4MEPA 5K29A 5CQ6A 5E0RA 1EQFA 5CQ3A 2RS9B 4NR8A 5CQAA 3G0LA 4KV1A 5FH6A 4A9LA 5EWDA 5I7XA 5DFBA 4TU4A 5FFVA 3O36A 5DKDA 4NQMA 4UIXA 3SVFA 4BHWA 4QYLA 4QSWA 5TCMA 5A5NA 2RNYA 3GG3A 5ENCA 4PCIA 4HXRA 5BT4A 4Z6HA 5II1A 5A5SA 5E3GA 4QBMA 4Z1SA 3D1BA 4J0SA 4QEWA 5FH8A 4AI6A 5H1TA 5F5ZA 4CLBA 4YATA 4UIZA 2WP2A 1WUMA 3U5MA 5JI8A 2YQDA 5CRZA 5DLZA 3P1EA 5DYXA 2YYNA 4CFLA 4TTEA 5E74A 5C87A 3P1DA 5IGKA 5KTWA 4YYMA 2DVRA 4O7BA 4IORA 4XY9A 3DAIA 5FG5A 1ZS5A 3K2JA 3UV4A 3U5JA 4FLPA 5D25A 3S91A 5IGLA 2DWWA 5G4SA 4KV4A 5A5PA 3O35A 3O33A 5FE6A 5KU3A 5I83A 4O7FA 4YADA 5EWCA 4N4GA 5DYAA 1X0JA 5ENEA 5FE9A 4QEUA 4NXJA 4TS8A 4XY8A 5F62A 5CS8A 4QSRA 5EWHA 4J3IA 4A9JA 4YAXA 3UV2A 4UIUA 5CUGA 4OGIA 3U5OA 3U5NA 4YYDA 4LYWA 3ZYUA 5DFCA 5I86A 3LJWA 5J0DA 3LQJA 4N3WA 5DW2A 4UIWA 5BT3A 4QNSA 2MJVB 4NR6A 5FE2A 4QZSA 2R0VA 5BT5A 4QUUA 5LKXA 4NRAA 4TU6A 3FKMX 4PTBA 5DBMA 5DYUA 3MB4A 5TB6A 1F68A 4ZC9A 4Z1QA 4O71A 2L85A 4O7EA 5EGUA 4DONA 5FE1A 5LVRA 5EICA 4LC2A 4CFKA 5L8TA 5CUCA 4YH3A 4O78A 4NYVA 5DX4A 5KTUA 2RNWA 3UV5A 5D24A 1WUGA 2E7NA 1E6IA 4LR6A 3VKGA 2F6JA 3IU6A 4YBSA 4UIYA 4J0RA 4O70A 3P1FA 4BW2A 1JSPB 2RNXA 4PCEA 4LZSA 4TT2A 4AKHA 5FG6A 4QR5A 4IR4A 4QR4A 5C89A 4QR3A 5HFQA 5EM3A 5C4QA 4HBYA 5D26A 4A9FA 2YEMA 3LQIA 4O75A 4RVRA 5KTXA 5D3HA 5L8UA 5JWMA 5ENGA 4NRBA 4NR5A 5A5OA 4O77A 5D3NA 4N4HA 5D3JA 2D9EA 5EPRA 2D82A 4HXMA 3UVYA 5EISA 2G4AA 4ALHA 2OUOA 5E9VA 5AMEA 4CUPA 5A5RA 4HXOA 5C8GA 3RCWA 5HQ6A 2GRCA 2L5EA 4NYXA 5KO4A 1JM4B 3NXBA 3D7CA 5FFWA 4O7AA 5DY7A 3LQHA 5LJ2A 5CU8A 4MR5A 5FG4A 4A9KA 5IGMA 4UYEA 5LUUA 4LDFA 3JVJA 5D7XA 5IIDA 2DVQA 2H60A 4BW4A 4MR4A 5D0CA 5FFYA 4YYJA 1N72A 5ETDA 2R10A 5CZGA 2OO1A 4NQNA 5E7DA 5EI4A 4BW1A 4A9MA 5CUDA 5I40A 4C66A 2L84A 5HFRA 4X2IA 2YEKA 5LVQA 4LZ2A 4XYAA 5FE0A 4TZ8A 4HBVA 5I89A 3QZVA 5E9KA 3S92A 2YW5A 4BW3A 5ENIA 2E7OA 4IR6A 4QSPA 4XUAA 2R0YA 4TT4A 5ENFA 4ALGA 2RFJA 3JVLA 5ETBA 4YYIA 5EPSA 5EQ1A 4Q0OA 4QB3A 4QC1A 3SVHA 5HELA 4LZRA 2EJNA 4WIVA 3ERRA 5CPEA 4O74A 5F61A 3HMHA 4NYWA 3IU5A 4YYKA 5A82A 5I88A 3VKHA 5FDZA 4ZW1A 5LKUA 4N4FA 5DKCA 5HJCA 2RI7A 4UYHA 5FE5A 4NUCA 4MR3A 5CY9A 4O76A 4LYIA 4NS5A 4TZ2A 3D1DA 2E3KA 4QSQA 5EWVA 5DFDA 4XUBA 4CUSA 4QSSA 5DLXA 3Q2FA 5EV9A 5F1LA 5E9IA 5CFWA 2DVSA 4TYLA 5H1VA 4E96A 3I3JA 2YDWA 5AD3A 3SVGA 4HXLA 5HRVA 4NRCA 5LKTA 4J1PA 2RO1A 4YYHA 3AQAA 5FB1A 5F25A 4NR9A 5HEMA 4A9HA 4AKGA 4CURA 4CUUA 3LXJA 4O72A 5CTLA 5L97A 4UITA 3QZSA 5HM0A 4UYGA 5D3SA 5A5QA 3O34A 4UYDA 5HQ7A 4Q0NA 4IR3A 3JVKA 4UYFB 5CGPA 4OGJA 4YYGA 5LJ1A 5CUEA 4PS5A 3JVMA 5F60A 3TLPA 2OSSA 4NUEA 2NXBA 5C7NA 5FE7A 4QSVA 5AD2A 3G0JA 5CRMA 3U5PA 5EK9A 5A85A 5C85A 5FBXA 5E9YA 4NR7A 5I80A 5D3TA 5L99A 5F1HA 4A9NA 4HXKA 5A7CA 3MB3A 4HBWA 3HMFA 4WHWA 3UVWA 2F6NA 4PY6A
chains in the Genus database with same CATH topology
4MENA 5I7YA 5LKZA 3DWYA 2N9GA 3MULA 4YH4A 5CQTA 4OUFA 5ENJA 4YY6A 5DKHA 5E9MA 4PKLA 3UW9A 5L96A 5IBNA 5E73A 4UYFA 4QSXA 4Z6IA 4GPJA 4BJXA 4LRGA 4QSTA 5CQ4A 2DKWA 4MEQA 5D3PA 5CP5A 5H85A 5IG6A 5HCLA 3AADA 5ACYA 5D3RA 4QYDA 3U5KA 4YABA 5CUBA 4WHUA 4MEOA 4QUTA 4TQNA 5L98A 4CUQA 4N4IA 5EPBA 5DW1A 5EA1A 4HXNA 5KHMA 3MUKA 5D3LA 4HXPA 5FB0A 5EU1A 5H1UA 4QEVA 5A83A 4IR5A 5HLSA 4QSUA 2DATA 5CUAA 5E9LA 4IOQA 4HBXA 4Z93A 2FSAA 5FE3A 5A81A 4A9IA 5FE8A 4MR6A 5FH7A 3UVDA 4A9OA 5EP7A 2LSPB 5ENBA 2DVVA 5II2A 4YK0A 4O7CA 4YC9A 4QC3A 4YBMA 3O37A 4NUDA 5HENA 5EWWA 2I7KA 5F36A 5F63A 5IGNA 5ENHA 5E3DA 3MQMA 5EVAA 4YYNA 5HQ5A 4Y03A 4A9EA 4AKNA 5F3AA 4CL9A 4YBTA 5I1QA 3HMEA 3P5OA 5CQ8A 3QZTA 4QY4A 2KTBB 4ZQLA 5CQ5A 4LYSA 4F3IA 3UVXA 5CQ7A 2I8NA 4HXSA 5I29A 4UIVA 4YY4A 4IOOA 3Q2EA 2YELA 3ONIA 5HRWA 5F2PA 5LJ0A 4TT6A 2WP1A 5DYCA 4NR4A 3P1CA 5FE4A 4C67A 3MXFA 5AMFA 4KCXA 4CUTA 2R0SA 5COIA 5HRXA 3U5LA 5G4RA 4MEPA 5K29A 5CQ6A 5E0RA 1EQFA 5CQ3A 2RS9B 4NR8A 5CQAA 3G0LA 4KV1A 5FH6A 4A9LA 5EWDA 5I7XA 5DFBA 4TU4A 5FFVA 3O36A 5DKDA 4NQMA 4UIXA 3SVFA 4BHWA 4QYLA 4QSWA 5TCMA 5A5NA 2RNYA 3GG3A 5ENCA 4PCIA 4HXRA 5BT4A 4Z6HA 5II1A 5A5SA 5E3GA 4QBMA 4Z1SA 4J0SA 4QEWA 5FH8A 5H1TA 5F5ZA 4CLBA 4YATA 4UIZA 2WP2A 1WUMA 3U5MA 5JI8A 2YQDA 5CRZA 5DLZA 3P1EA 5DYXA 2YYNA 4CFLA 4TTEA 5E74A 5C87A 3P1DA 5IGKA 5KTWA 4YYMA 2DVRA 4O7BA 4IORA 4XY9A 3DAIA 5FG5A 1ZS5A 3K2JA 3UV4A 3U5JA 4FLPA 5D25A 3S91A 5IGLA 2DWWA 5G4SA 4KV4A 5A5PA 3O35A 3O33A 5FE6A 5KU3A 5I83A 4O7FA 4YADA 5EWCA 4N4GA 5DYAA 1X0JA 5ENEA 5FE9A 4QEUA 4NXJA 4TS8A 4XY8A 5F62A 5CS8A 4QSRA 5EWHA 4J3IA 4A9JA 4YAXA 3UV2A 4UIUA 5CUGA 4OGIA 3U5OA 3U5NA 4YYDA 4LYWA 3ZYUA 5DFCA 5I86A 3LJWA 5J0DA 3LQJA 4N3WA 5DW2A 4UIWA 5BT3A 4QNSA 2MJVB 4NR6A 5FE2A 4QZSA 2R0VA 5BT5A 4QUUA 5LKXA 4NRAA 4TU6A 3FKMX 4PTBA 5DBMA 5DYUA 3MB4A 5TB6A 1F68A 4ZC9A 4Z1QA 4O71A 2L85A 4O7EA 5EGUA 4DONA 5FE1A 5LVRA 5EICA 4LC2A 4CFKA 5L8TA 5CUCA 4YH3A 4O78A 4NYVA 5DX4A 5KTUA 2RNWA 3UV5A 5D24A 1WUGA 2E7NA 1E6IA 4LR6A 2F6JA 3IU6A 4YBSA 4UIYA 4J0RA 4O70A 3P1FA 4BW2A 1JSPB 2RNXA 4PCEA 4LZSA 4TT2A 5FG6A 4QR5A 4IR4A 4QR4A 5C89A 4QR3A 5HFQA 5EM3A 5C4QA 4HBYA 5D26A 4A9FA 2YEMA 3LQIA 4O75A 4RVRA 5KTXA 5D3HA 5L8UA 5JWMA 5ENGA 4NRBA 4NR5A 5A5OA 4O77A 5D3NA 4N4HA 5D3JA 2D9EA 5EPRA 2D82A 4HXMA 3UVYA 5EISA 2G4AA 4ALHA 2OUOA 5E9VA 5AMEA 4CUPA 5A5RA 4HXOA 5C8GA 3RCWA 5HQ6A 2GRCA 2L5EA 4NYXA 5KO4A 1JM4B 3NXBA 3D7CA 5FFWA 4O7AA 5DY7A 3LQHA 5LJ2A 5CU8A 4MR5A 5FG4A 4A9KA 5IGMA 4UYEA 5LUUA 4LDFA 3JVJA 5D7XA 5IIDA 2DVQA 2H60A 4BW4A 4MR4A 5D0CA 5FFYA 4YYJA 1N72A 5ETDA 2R10A 5CZGA 2OO1A 4NQNA 5E7DA 5EI4A 4BW1A 4A9MA 5CUDA 5I40A 4C66A 2L84A 5HFRA 4X2IA 2YEKA 5LVQA 4LZ2A 4XYAA 5FE0A 4TZ8A 4HBVA 5I89A 3QZVA 5E9KA 3S92A 2YW5A 4BW3A 5ENIA 2E7OA 4IR6A 4QSPA 4XUAA 2R0YA 4TT4A 5ENFA 4ALGA 2RFJA 3JVLA 5ETBA 4YYIA 5EPSA 5EQ1A 4Q0OA 4QB3A 4QC1A 3SVHA 5HELA 4LZRA 4WIVA 5CPEA 4O74A 5F61A 3HMHA 4NYWA 3IU5A 4YYKA 5A82A 5I88A 5FDZA 4ZW1A 5LKUA 4N4FA 5DKCA 5HJCA 2RI7A 4UYHA 5FE5A 4NUCA 4MR3A 5CY9A 4O76A 4LYIA 4NS5A 4TZ2A 2E3KA 4QSQA 5EWVA 5DFDA 4XUBA 4CUSA 4QSSA 5DLXA 3Q2FA 5EV9A 5F1LA 5E9IA 5CFWA 2DVSA 4TYLA 5H1VA 4E96A 3I3JA 2YDWA 5AD3A 3SVGA 4HXLA 5HRVA 4NRCA 5LKTA 4J1PA 2RO1A 4YYHA 3AQAA 5FB1A 5F25A 4NR9A 5HEMA 4A9HA 4CURA 4CUUA 3LXJA 4O72A 5CTLA 5L97A 4UITA 3QZSA 5HM0A 4UYGA 5D3SA 5A5QA 3O34A 4UYDA 5HQ7A 4Q0NA 4IR3A 3JVKA 4UYFB 5CGPA 4OGJA 4YYGA 5LJ1A 5CUEA 4PS5A 3JVMA 5F60A 3TLPA 2OSSA 4NUEA 2NXBA 5C7NA 5FE7A 4QSVA 5AD2A 3G0JA 5CRMA 3U5PA 5EK9A 5A85A 5C85A 5FBXA 5E9YA 4NR7A 5I80A 5D3TA 5L99A 5F1HA 4A9NA 4HXKA 5A7CA 3MB3A 4HBWA 3HMFA 4WHWA 3UVWA 2F6NA 4PY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEN A;  5I7Y A;  5LKZ A;  3DWY A;  2N9G A;  3MUL A;  4YH4 A;  5CQT A;  4OUF A;  5ENJ A;  4YY6 A;  5DKH A;  5E9M A;  4PKL A;  3UW9 A;  5L96 A;  5IBN A;  5E73 A;  4UYF A;  4QSX A;  4Z6I A;  4GPJ A;  4BJX A;  4LRG A;  4QST A;  5CQ4 A;  2DKW A;  4MEQ A;  5D3P A;  5CP5 A;  5H85 A;  5IG6 A;  5HCL A;  3AAD A;  5ACY A;  5D3R A;  4QYD A;  3U5K A;  4YAB A;  5CUB A;  4WHU A;  4MEO A;  4QUT A;  4TQN A;  5L98 A;  4CUQ A;  4N4I A;  5EPB A;  5DW1 A;  5EA1 A;  4HXN A;  5KHM A;  3MUK A;  5D3L A;  4HXP A;  5FB0 A;  5EU1 A;  5H1U A;  4QEV A;  5A83 A;  4IR5 A;  5HLS A;  4QSU A;  2DAT A;  5CUA A;  5E9L A;  4IOQ A;  4HBX A;  4Z93 A;  2FSA A;  5FE3 A;  5A81 A;  4A9I A;  5FE8 A;  4MR6 A;  5FH7 A;  3UVD A;  4A9O A;  5EP7 A;  2LSP B;  5ENB A;  2DVV A;  5II2 A;  4YK0 A;  4O7C A;  4YC9 A;  4QC3 A;  4YBM A;  3O37 A;  4NUD A;  5HEN A;  5EWW A;  2I7K A;  5F36 A;  5F63 A;  5IGN A;  5ENH A;  5E3D A;  3MQM A;  5EVA A;  4YYN A;  5HQ5 A;  4Y03 A;  4A9E A;  4AKN A;  5F3A A;  4CL9 A;  4YBT A;  5I1Q A;  3HME A;  3P5O A;  5CQ8 A;  3QZT A;  4QY4 A;  2KTB B;  4ZQL A;  5CQ5 A;  4LYS A;  4F3I A;  3UVX A;  5CQ7 A;  2I8N A;  4HXS A;  5I29 A;  4UIV A;  4YY4 A;  4IOO A;  3Q2E A;  2YEL A;  3ONI A;  5HRW A;  5F2P A;  5LJ0 A;  4TT6 A;  2WP1 A;  5DYC A;  4NR4 A;  3P1C A;  5FE4 A;  4C67 A;  3MXF A;  5AMF A;  4KCX A;  4CUT A;  2R0S A;  5COI A;  5HRX A;  3U5L A;  5G4R A;  4MEP A;  5K29 A;  5CQ6 A;  5E0R A;  1EQF A;  5CQ3 A;  2RS9 B;  4NR8 A;  5CQA A;  3G0L A;  4KV1 A;  5FH6 A;  4A9L A;  5EWD A;  5I7X A;  5DFB A;  4TU4 A;  5FFV A;  3O36 A;  5DKD A;  4NQM A;  4UIX A;  3SVF A;  4BHW A;  4QYL A;  4QSW A;  5TCM A;  5A5N A;  2RNY A;  3GG3 A;  5ENC A;  4PCI A;  4HXR A;  5BT4 A;  4Z6H A;  5II1 A;  5A5S A;  5E3G A;  4QBM A;  4Z1S A;  4J0S A;  4QEW A;  5FH8 A;  5H1T A;  5F5Z A;  4CLB A;  4YAT A;  4UIZ A;  2WP2 A;  1WUM A;  3U5M A;  5JI8 A;  2YQD A;  5CRZ A;  5DLZ A;  3P1E A;  5DYX A;  2YYN A;  4CFL A;  4TTE A;  5E74 A;  5C87 A;  3P1D A;  5IGK A;  5KTW A;  4YYM A;  2DVR A;  4O7B A;  4IOR A;  4XY9 A;  3DAI A;  5FG5 A;  1ZS5 A;  3K2J A;  3UV4 A;  3U5J A;  4FLP A;  5D25 A;  3S91 A;  5IGL A;  2DWW A;  5G4S A;  4KV4 A;  5A5P A;  3O35 A;  3O33 A;  5FE6 A;  5KU3 A;  5I83 A;  4O7F A;  4YAD A;  5EWC A;  4N4G A;  5DYA A;  1X0J A;  5ENE A;  5FE9 A;  4QEU A;  4NXJ A;  4TS8 A;  4XY8 A;  5F62 A;  5CS8 A;  4QSR A;  5EWH A;  4J3I A;  4A9J A;  4YAX A;  3UV2 A;  4UIU A;  5CUG A;  4OGI A;  3U5O A;  3U5N A;  4YYD A;  4LYW A;  3ZYU A;  5DFC A;  5I86 A;  3LJW A;  5J0D A;  3LQJ A;  4N3W A;  5DW2 A;  4UIW A;  5BT3 A;  4QNS A;  2MJV B;  4NR6 A;  5FE2 A;  4QZS A;  2R0V A;  5BT5 A;  4QUU A;  5LKX A;  4NRA A;  4TU6 A;  3FKM X;  4PTB A;  5DBM A;  5DYU A;  3MB4 A;  5TB6 A;  1F68 A;  4ZC9 A;  4Z1Q A;  4O71 A;  2L85 A;  4O7E A;  5EGU A;  4DON A;  5FE1 A;  5LVR A;  5EIC A;  4LC2 A;  4CFK A;  5L8T A;  5CUC A;  4YH3 A;  4O78 A;  4NYV A;  5DX4 A;  5KTU A;  2RNW A;  3UV5 A;  5D24 A;  1WUG A;  2E7N A;  1E6I A;  4LR6 A;  2F6J A;  3IU6 A;  4YBS A;  4UIY A;  4J0R A;  4O70 A;  3P1F A;  4BW2 A;  1JSP B;  2RNX A;  4PCE A;  4LZS A;  4TT2 A;  5FG6 A;  4QR5 A;  4IR4 A;  4QR4 A;  5C89 A;  4QR3 A;  5HFQ A;  5EM3 A;  5C4Q A;  4HBY A;  5D26 A;  4A9F A;  2YEM A;  3LQI A;  4O75 A;  4RVR A;  5KTX A;  5D3H A;  5L8U A;  5JWM A;  5ENG A;  4NRB A;  4NR5 A;  5A5O A;  4O77 A;  5D3N A;  4N4H A;  5D3J A;  2D9E A;  5EPR A;  2D82 A;  4HXM A;  3UVY A;  5EIS A;  2G4A A;  4ALH A;  2OUO A;  5E9V A;  5AME A;  4CUP A;  5A5R A;  4HXO A;  5C8G A;  3RCW A;  5HQ6 A;  2GRC A;  2L5E A;  4NYX A;  5KO4 A;  1JM4 B;  3NXB A;  3D7C A;  5FFW A;  4O7A A;  5DY7 A;  3LQH A;  5LJ2 A;  5CU8 A;  4MR5 A;  5FG4 A;  4A9K A;  5IGM A;  4UYE A;  5LUU A;  4LDF A;  3JVJ A;  5D7X A;  5IID A;  2DVQ A;  2H60 A;  4BW4 A;  4MR4 A;  5D0C A;  5FFY A;  4YYJ A;  1N72 A;  5ETD A;  2R10 A;  5CZG A;  2OO1 A;  4NQN A;  5E7D A;  5EI4 A;  4BW1 A;  4A9M A;  5CUD A;  5I40 A;  4C66 A;  2L84 A;  5HFR A;  4X2I A;  2YEK A;  5LVQ A;  4LZ2 A;  4XYA A;  5FE0 A;  4TZ8 A;  4HBV A;  5I89 A;  3QZV A;  5E9K A;  3S92 A;  2YW5 A;  4BW3 A;  5ENI A;  2E7O A;  4IR6 A;  4QSP A;  4XUA A;  2R0Y A;  4TT4 A;  5ENF A;  4ALG A;  2RFJ A;  3JVL A;  5ETB A;  4YYI A;  5EPS A;  5EQ1 A;  4Q0O A;  4QB3 A;  4QC1 A;  3SVH A;  5HEL A;  4LZR A;  4WIV A;  5CPE A;  4O74 A;  5F61 A;  3HMH A;  4NYW A;  3IU5 A;  4YYK A;  5A82 A;  5I88 A;  5FDZ A;  4ZW1 A;  5LKU A;  4N4F A;  5DKC A;  5HJC A;  2RI7 A;  4UYH A;  5FE5 A;  4NUC A;  4MR3 A;  5CY9 A;  4O76 A;  4LYI A;  4NS5 A;  4TZ2 A;  2E3K A;  4QSQ A;  5EWV A;  5DFD A;  4XUB A;  4CUS A;  4QSS A;  5DLX A;  3Q2F A;  5EV9 A;  5F1L A;  5E9I A;  5CFW A;  2DVS A;  4TYL A;  5H1V A;  4E96 A;  3I3J A;  2YDW A;  5AD3 A;  3SVG A;  4HXL A;  5HRV A;  4NRC A;  5LKT A;  4J1P A;  2RO1 A;  4YYH A;  3AQA A;  5FB1 A;  5F25 A;  4NR9 A;  5HEM A;  4A9H A;  4CUR A;  4CUU A;  3LXJ A;  4O72 A;  5CTL A;  5L97 A;  4UIT A;  3QZS A;  5HM0 A;  4UYG A;  5D3S A;  5A5Q A;  3O34 A;  4UYD A;  5HQ7 A;  4Q0N A;  4IR3 A;  3JVK A;  4UYF B;  5CGP A;  4OGJ A;  4YYG A;  5LJ1 A;  5CUE A;  4PS5 A;  3JVM A;  5F60 A;  3TLP A;  2OSS A;  4NUE A;  2NXB A;  5C7N A;  5FE7 A;  4QSV A;  5AD2 A;  3G0J A;  5CRM A;  3U5P A;  5EK9 A;  5A85 A;  5C85 A;  5FBX A;  5E9Y A;  4NR7 A;  5I80 A;  5D3T A;  5L99 A;  5F1H A;  4A9N A;  4HXK A;  5A7C A;  3MB3 A;  4HBW A;  3HMF A;  4WHW A;  3UVW A;  2F6N A;  4PY6 A; 
#chains in the Genus database with same CATH topology
 4MEN A;  5I7Y A;  5LKZ A;  3DWY A;  2N9G A;  3MUL A;  4YH4 A;  5CQT A;  4OUF A;  5ENJ A;  4YY6 A;  5DKH A;  5E9M A;  4PKL A;  3UW9 A;  5L96 A;  5IBN A;  5E73 A;  4UYF A;  4QSX A;  4Z6I A;  4GPJ A;  4BJX A;  4LRG A;  4QST A;  5CQ4 A;  2DKW A;  4MEQ A;  5D3P A;  5CP5 A;  5H85 A;  5IG6 A;  5HCL A;  3AAD A;  5ACY A;  5D3R A;  4QYD A;  3U5K A;  4YAB A;  5CUB A;  4WHU A;  4MEO A;  4QUT A;  4TQN A;  5L98 A;  4CUQ A;  4N4I A;  5EPB A;  5DW1 A;  5EA1 A;  4HXN A;  5KHM A;  5D3L A;  3MUK A;  4HXP A;  5FB0 A;  5EU1 A;  5H1U A;  4QEV A;  5A83 A;  4IR5 A;  5HLS A;  4QSU A;  1PUO A;  2DAT A;  5CUA A;  5E9L A;  4IOQ A;  4HBX A;  4Z93 A;  2FSA A;  5FE3 A;  5A81 A;  4A9I A;  5FE8 A;  4MR6 A;  5FH7 A;  3UVD A;  4A9O A;  5EP7 A;  2LSP B;  5ENB A;  2DVV A;  5II2 A;  4YK0 A;  4O7C A;  4YC9 A;  4QC3 A;  4YBM A;  3O37 A;  4NUD A;  5HEN A;  5EWW A;  2I7K A;  5F36 A;  5F63 A;  5IGN A;  5ENH A;  5E3D A;  3MQM A;  5EVA A;  4YYN A;  5HQ5 A;  4Y03 A;  4A9E A;  4AKN A;  5F3A A;  4CL9 A;  4YBT A;  5I1Q A;  3HME A;  3P5O A;  5CQ8 A;  3QZT A;  4QY4 A;  2KTB B;  4ZQL A;  5CQ5 A;  4LYS A;  4F3I A;  3UVX A;  5CQ7 A;  2I8N A;  4HXS A;  5I29 A;  4UIV A;  4YY4 A;  4AKI A;  4IOO A;  3Q2E A;  2YEL A;  3ONI A;  5HRW A;  5F2P A;  5LJ0 A;  4TT6 A;  2WP1 A;  5DYC A;  4NR4 A;  3P1C A;  5FE4 A;  1ZKR A;  4C67 A;  3MXF A;  5AMF A;  4KCX A;  4CUT A;  2R0S A;  5COI A;  5HRX A;  3U5L A;  5G4R A;  4MEP A;  5K29 A;  5CQ6 A;  5E0R A;  1EQF A;  5CQ3 A;  2RS9 B;  4NR8 A;  5CQA A;  3G0L A;  4KV1 A;  5FH6 A;  4A9L A;  5EWD A;  5I7X A;  5DFB A;  4TU4 A;  5FFV A;  3O36 A;  5DKD A;  4NQM A;  4UIX A;  3SVF A;  4BHW A;  4QYL A;  4QSW A;  5TCM A;  5A5N A;  2RNY A;  3GG3 A;  5ENC A;  4PCI A;  4HXR A;  5BT4 A;  4Z6H A;  5II1 A;  5A5S A;  5E3G A;  4QBM A;  4Z1S A;  3D1B A;  4J0S A;  4QEW A;  5FH8 A;  4AI6 A;  5H1T A;  5F5Z A;  4CLB A;  4YAT A;  4UIZ A;  2WP2 A;  1WUM A;  3U5M A;  5JI8 A;  2YQD A;  5CRZ A;  5DLZ A;  3P1E A;  5DYX A;  2YYN A;  4CFL A;  4TTE A;  5E74 A;  5C87 A;  3P1D A;  5IGK A;  5KTW A;  4YYM A;  2DVR A;  4O7B A;  4IOR A;  4XY9 A;  3DAI A;  5FG5 A;  1ZS5 A;  3K2J A;  3UV4 A;  3U5J A;  4FLP A;  5D25 A;  3S91 A;  5IGL A;  2DWW A;  5G4S A;  4KV4 A;  5A5P A;  3O35 A;  3O33 A;  5FE6 A;  5KU3 A;  5I83 A;  4O7F A;  4YAD A;  5EWC A;  4N4G A;  5DYA A;  1X0J A;  5ENE A;  5FE9 A;  4QEU A;  4NXJ A;  4TS8 A;  4XY8 A;  5F62 A;  5CS8 A;  4QSR A;  5EWH A;  4J3I A;  4A9J A;  4YAX A;  3UV2 A;  4UIU A;  5CUG A;  4OGI A;  3U5O A;  3U5N A;  4YYD A;  4LYW A;  3ZYU A;  5DFC A;  5I86 A;  3LJW A;  5J0D A;  3LQJ A;  4N3W A;  5DW2 A;  4UIW A;  5BT3 A;  4QNS A;  2MJV B;  4NR6 A;  5FE2 A;  4QZS A;  2R0V A;  5BT5 A;  4QUU A;  5LKX A;  4NRA A;  4TU6 A;  3FKM X;  4PTB A;  5DBM A;  5DYU A;  3MB4 A;  5TB6 A;  1F68 A;  4ZC9 A;  4Z1Q A;  4O71 A;  2L85 A;  4O7E A;  5EGU A;  4DON A;  5FE1 A;  5LVR A;  5EIC A;  4LC2 A;  4CFK A;  5L8T A;  5CUC A;  4YH3 A;  4O78 A;  4NYV A;  5DX4 A;  5KTU A;  2RNW A;  3UV5 A;  5D24 A;  1WUG A;  2E7N A;  1E6I A;  4LR6 A;  3VKG A;  2F6J A;  3IU6 A;  4YBS A;  4UIY A;  4J0R A;  4O70 A;  3P1F A;  4BW2 A;  1JSP B;  2RNX A;  4PCE A;  4LZS A;  4TT2 A;  4AKH A;  5FG6 A;  4QR5 A;  4IR4 A;  4QR4 A;  5C89 A;  4QR3 A;  5HFQ A;  5EM3 A;  5C4Q A;  4HBY A;  5D26 A;  4A9F A;  2YEM A;  3LQI A;  4O75 A;  4RVR A;  5KTX A;  5D3H A;  5L8U A;  5JWM A;  5ENG A;  4NRB A;  4NR5 A;  5A5O A;  4O77 A;  5D3N A;  4N4H A;  5D3J A;  2D9E A;  5EPR A;  2D82 A;  4HXM A;  3UVY A;  5EIS A;  2G4A A;  4ALH A;  2OUO A;  5E9V A;  5AME A;  4CUP A;  5A5R A;  4HXO A;  5C8G A;  3RCW A;  5HQ6 A;  2GRC A;  2L5E A;  4NYX A;  5KO4 A;  1JM4 B;  3NXB A;  3D7C A;  5FFW A;  4O7A A;  5DY7 A;  3LQH A;  5LJ2 A;  5CU8 A;  4MR5 A;  5FG4 A;  4A9K A;  5IGM A;  4UYE A;  5LUU A;  4LDF A;  3JVJ A;  5D7X A;  5IID A;  2DVQ A;  2H60 A;  4BW4 A;  4MR4 A;  5D0C A;  5FFY A;  4YYJ A;  1N72 A;  5ETD A;  2R10 A;  5CZG A;  2OO1 A;  4NQN A;  5E7D A;  5EI4 A;  4BW1 A;  4A9M A;  5CUD A;  5I40 A;  4C66 A;  2L84 A;  5HFR A;  4X2I A;  2YEK A;  5LVQ A;  4LZ2 A;  4XYA A;  5FE0 A;  4TZ8 A;  4HBV A;  5I89 A;  3QZV A;  5E9K A;  3S92 A;  2YW5 A;  4BW3 A;  5ENI A;  2E7O A;  4IR6 A;  4QSP A;  4XUA A;  2R0Y A;  4TT4 A;  5ENF A;  4ALG A;  2RFJ A;  3JVL A;  5ETB A;  4YYI A;  5EPS A;  5EQ1 A;  4Q0O A;  4QB3 A;  4QC1 A;  3SVH A;  5HEL A;  4LZR A;  2EJN A;  4WIV A;  3ERR A;  5CPE A;  4O74 A;  5F61 A;  3HMH A;  4NYW A;  3IU5 A;  4YYK A;  5A82 A;  5I88 A;  3VKH A;  5FDZ A;  4ZW1 A;  5LKU A;  4N4F A;  5DKC A;  5HJC A;  2RI7 A;  4UYH A;  5FE5 A;  4NUC A;  4MR3 A;  5CY9 A;  4O76 A;  4LYI A;  4NS5 A;  4TZ2 A;  3D1D A;  2E3K A;  4QSQ A;  5EWV A;  5DFD A;  4XUB A;  4CUS A;  4QSS A;  5DLX A;  3Q2F A;  5EV9 A;  5F1L A;  5E9I A;  5CFW A;  2DVS A;  4TYL A;  5H1V A;  4E96 A;  3I3J A;  2YDW A;  5AD3 A;  3SVG A;  4HXL A;  5HRV A;  4NRC A;  5LKT A;  4J1P A;  2RO1 A;  4YYH A;  3AQA A;  5FB1 A;  5F25 A;  4NR9 A;  5HEM A;  4A9H A;  4AKG A;  4CUR A;  4CUU A;  3LXJ A;  4O72 A;  5CTL A;  5L97 A;  4UIT A;  3QZS A;  5HM0 A;  4UYG A;  5D3S A;  5A5Q A;  3O34 A;  4UYD A;  5HQ7 A;  4Q0N A;  4IR3 A;  3JVK A;  4UYF B;  5CGP A;  4OGJ A;  4YYG A;  5LJ1 A;  5CUE A;  4PS5 A;  3JVM A;  5F60 A;  3TLP A;  2OSS A;  4NUE A;  2NXB A;  5C7N A;  5FE7 A;  4QSV A;  5AD2 A;  3G0J A;  5CRM A;  3U5P A;  5EK9 A;  5A85 A;  5C85 A;  5FBX A;  5E9Y A;  4NR7 A;  5I80 A;  5D3T A;  5L99 A;  5F1H A;  4A9N A;  4HXK A;  5A7C A;  3MB3 A;  4HBW A;  3HMF A;  4WHW A;  3UVW A;  2F6N A;  4PY6 A; 
#chains in the Genus database with same CATH homology
 4MEN A;  5I7Y A;  5LKZ A;  3DWY A;  2N9G A;  3MUL A;  4YH4 A;  5CQT A;  4OUF A;  5ENJ A;  4YY6 A;  5DKH A;  5E9M A;  4PKL A;  3UW9 A;  5L96 A;  5IBN A;  5E73 A;  4UYF A;  4QSX A;  4Z6I A;  4GPJ A;  4BJX A;  4LRG A;  4QST A;  5CQ4 A;  2DKW A;  4MEQ A;  5D3P A;  5CP5 A;  5H85 A;  5IG6 A;  5HCL A;  3AAD A;  5ACY A;  5D3R A;  4QYD A;  3U5K A;  4YAB A;  5CUB A;  4WHU A;  4MEO A;  4QUT A;  4TQN A;  5L98 A;  4CUQ A;  4N4I A;  5EPB A;  5DW1 A;  5EA1 A;  4HXN A;  5KHM A;  3MUK A;  5D3L A;  4HXP A;  5FB0 A;  5EU1 A;  5H1U A;  4QEV A;  5A83 A;  4IR5 A;  5HLS A;  4QSU A;  2DAT A;  5CUA A;  5E9L A;  4IOQ A;  4HBX A;  4Z93 A;  2FSA A;  5FE3 A;  5A81 A;  4A9I A;  5FE8 A;  4MR6 A;  5FH7 A;  3UVD A;  4A9O A;  5EP7 A;  2LSP B;  5ENB A;  2DVV A;  5II2 A;  4YK0 A;  4O7C A;  4YC9 A;  4QC3 A;  4YBM A;  3O37 A;  4NUD A;  5HEN A;  5EWW A;  2I7K A;  5F36 A;  5F63 A;  5IGN A;  5ENH A;  5E3D A;  3MQM A;  5EVA A;  4YYN A;  5HQ5 A;  4Y03 A;  4A9E A;  4AKN A;  5F3A A;  4CL9 A;  4YBT A;  5I1Q A;  3HME A;  3P5O A;  5CQ8 A;  3QZT A;  4QY4 A;  2KTB B;  4ZQL A;  5CQ5 A;  4LYS A;  4F3I A;  3UVX A;  5CQ7 A;  2I8N A;  4HXS A;  5I29 A;  4UIV A;  4YY4 A;  4IOO A;  3Q2E A;  2YEL A;  3ONI A;  5HRW A;  5F2P A;  5LJ0 A;  4TT6 A;  2WP1 A;  5DYC A;  4NR4 A;  3P1C A;  5FE4 A;  4C67 A;  3MXF A;  5AMF A;  4KCX A;  4CUT A;  2R0S A;  5COI A;  5HRX A;  3U5L A;  5G4R A;  4MEP A;  5K29 A;  5CQ6 A;  5E0R A;  1EQF A;  5CQ3 A;  2RS9 B;  4NR8 A;  5CQA A;  3G0L A;  4KV1 A;  5FH6 A;  4A9L A;  5EWD A;  5I7X A;  5DFB A;  4TU4 A;  5FFV A;  3O36 A;  5DKD A;  4NQM A;  4UIX A;  3SVF A;  4BHW A;  4QYL A;  4QSW A;  5TCM A;  5A5N A;  2RNY A;  3GG3 A;  5ENC A;  4PCI A;  4HXR A;  5BT4 A;  4Z6H A;  5II1 A;  5A5S A;  5E3G A;  4QBM A;  4Z1S A;  4J0S A;  4QEW A;  5FH8 A;  5H1T A;  5F5Z A;  4CLB A;  4YAT A;  4UIZ A;  2WP2 A;  1WUM A;  3U5M A;  5JI8 A;  2YQD A;  5CRZ A;  5DLZ A;  3P1E A;  5DYX A;  2YYN A;  4CFL A;  4TTE A;  5E74 A;  5C87 A;  3P1D A;  5IGK A;  5KTW A;  4YYM A;  2DVR A;  4O7B A;  4IOR A;  4XY9 A;  3DAI A;  5FG5 A;  1ZS5 A;  3K2J A;  3UV4 A;  3U5J A;  4FLP A;  5D25 A;  3S91 A;  5IGL A;  2DWW A;  5G4S A;  4KV4 A;  5A5P A;  3O35 A;  3O33 A;  5FE6 A;  5KU3 A;  5I83 A;  4O7F A;  4YAD A;  5EWC A;  4N4G A;  5DYA A;  1X0J A;  5ENE A;  5FE9 A;  4QEU A;  4NXJ A;  4TS8 A;  4XY8 A;  5F62 A;  5CS8 A;  4QSR A;  5EWH A;  4J3I A;  4A9J A;  4YAX A;  3UV2 A;  4UIU A;  5CUG A;  4OGI A;  3U5O A;  3U5N A;  4YYD A;  4LYW A;  3ZYU A;  5DFC A;  5I86 A;  3LJW A;  5J0D A;  3LQJ A;  4N3W A;  5DW2 A;  4UIW A;  5BT3 A;  4QNS A;  2MJV B;  4NR6 A;  5FE2 A;  4QZS A;  2R0V A;  5BT5 A;  4QUU A;  5LKX A;  4NRA A;  4TU6 A;  3FKM X;  4PTB A;  5DBM A;  5DYU A;  3MB4 A;  5TB6 A;  1F68 A;  4ZC9 A;  4Z1Q A;  4O71 A;  2L85 A;  4O7E A;  5EGU A;  4DON A;  5FE1 A;  5LVR A;  5EIC A;  4LC2 A;  4CFK A;  5L8T A;  5CUC A;  4YH3 A;  4O78 A;  4NYV A;  5DX4 A;  5KTU A;  2RNW A;  3UV5 A;  5D24 A;  1WUG A;  2E7N A;  1E6I A;  4LR6 A;  2F6J A;  3IU6 A;  4YBS A;  4UIY A;  4J0R A;  4O70 A;  3P1F A;  4BW2 A;  1JSP B;  2RNX A;  4PCE A;  4LZS A;  4TT2 A;  5FG6 A;  4QR5 A;  4IR4 A;  4QR4 A;  5C89 A;  4QR3 A;  5HFQ A;  5EM3 A;  5C4Q A;  4HBY A;  5D26 A;  4A9F A;  2YEM A;  3LQI A;  4O75 A;  4RVR A;  5KTX A;  5D3H A;  5L8U A;  5JWM A;  5ENG A;  4NRB A;  4NR5 A;  5A5O A;  4O77 A;  5D3N A;  4N4H A;  5D3J A;  2D9E A;  5EPR A;  2D82 A;  4HXM A;  3UVY A;  5EIS A;  2G4A A;  4ALH A;  2OUO A;  5E9V A;  5AME A;  4CUP A;  5A5R A;  4HXO A;  5C8G A;  3RCW A;  5HQ6 A;  2GRC A;  2L5E A;  4NYX A;  5KO4 A;  1JM4 B;  3NXB A;  3D7C A;  5FFW A;  4O7A A;  5DY7 A;  3LQH A;  5LJ2 A;  5CU8 A;  4MR5 A;  5FG4 A;  4A9K A;  5IGM A;  4UYE A;  5LUU A;  4LDF A;  3JVJ A;  5D7X A;  5IID A;  2DVQ A;  2H60 A;  4BW4 A;  4MR4 A;  5D0C A;  5FFY A;  4YYJ A;  1N72 A;  5ETD A;  2R10 A;  5CZG A;  2OO1 A;  4NQN A;  5E7D A;  5EI4 A;  4BW1 A;  4A9M A;  5CUD A;  5I40 A;  4C66 A;  2L84 A;  5HFR A;  4X2I A;  2YEK A;  5LVQ A;  4LZ2 A;  4XYA A;  5FE0 A;  4TZ8 A;  4HBV A;  5I89 A;  3QZV A;  5E9K A;  3S92 A;  2YW5 A;  4BW3 A;  5ENI A;  2E7O A;  4IR6 A;  4QSP A;  4XUA A;  2R0Y A;  4TT4 A;  5ENF A;  4ALG A;  2RFJ A;  3JVL A;  5ETB A;  4YYI A;  5EPS A;  5EQ1 A;  4Q0O A;  4QB3 A;  4QC1 A;  3SVH A;  5HEL A;  4LZR A;  4WIV A;  5CPE A;  4O74 A;  5F61 A;  3HMH A;  4NYW A;  3IU5 A;  4YYK A;  5A82 A;  5I88 A;  5FDZ A;  4ZW1 A;  5LKU A;  4N4F A;  5DKC A;  5HJC A;  2RI7 A;  4UYH A;  5FE5 A;  4NUC A;  4MR3 A;  5CY9 A;  4O76 A;  4LYI A;  4NS5 A;  4TZ2 A;  2E3K A;  4QSQ A;  5EWV A;  5DFD A;  4XUB A;  4CUS A;  4QSS A;  5DLX A;  3Q2F A;  5EV9 A;  5F1L A;  5E9I A;  5CFW A;  2DVS A;  4TYL A;  5H1V A;  4E96 A;  3I3J A;  2YDW A;  5AD3 A;  3SVG A;  4HXL A;  5HRV A;  4NRC A;  5LKT A;  4J1P A;  2RO1 A;  4YYH A;  3AQA A;  5FB1 A;  5F25 A;  4NR9 A;  5HEM A;  4A9H A;  4CUR A;  4CUU A;  3LXJ A;  4O72 A;  5CTL A;  5L97 A;  4UIT A;  3QZS A;  5HM0 A;  4UYG A;  5D3S A;  5A5Q A;  3O34 A;  4UYD A;  5HQ7 A;  4Q0N A;  4IR3 A;  3JVK A;  4UYF B;  5CGP A;  4OGJ A;  4YYG A;  5LJ1 A;  5CUE A;  4PS5 A;  3JVM A;  5F60 A;  3TLP A;  2OSS A;  4NUE A;  2NXB A;  5C7N A;  5FE7 A;  4QSV A;  5AD2 A;  3G0J A;  5CRM A;  3U5P A;  5EK9 A;  5A85 A;  5C85 A;  5FBX A;  5E9Y A;  4NR7 A;  5I80 A;  5D3T A;  5L99 A;  5F1H A;  4A9N A;  4HXK A;  5A7C A;  3MB3 A;  4HBW A;  3HMF A;  4WHW A;  3UVW A;  2F6N A;  4PY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...