3IU6A

Crystal structure of the sixth bromodomain of human poly-bromodomain containing protein 1 (pb1)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
143
structure length
142
Chain Sequence
MNVTLLIQELIHNLFVSVMSHQDDEGRYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVENNRYRRLDLFQEHMFEVLERARRMNRTDSEIYEDAVELQQFFIKIRDELCKNGEILLSPALSYTTKHLHNDVEKERKEKLPKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein polybromo-1
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 55
structure length 142
sequence length 143
ec nomenclature
pdb deposition date 2009-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3iu6A00
4DONA 5CP5A 3U5OA 3SVGA 2FSAA 3O36A 5AMEA 3LJWA 4A9NA 2F6JA 5EM3A 4E96A 5DY7A 3ZYUA 5F1HA 4QR3A 3LQJA 2LSPB 3U5LA 5L97A 5D25A 5FE7A 4LZRA 5HENA 3MB3A 5HQ7A 3HMEA 4UIVA 4LDFA 4TZ2A 5FE5A 4QBMA 4Z93A 4HBXA 4C66A 2DVRA 4A9HA 5FB0A 1E6IA 2RNXA 3UW9A 3O37A 4O72A 4LZ2A 3P1DA 5KTUA 5AD3A 5LKUA 3DWYA 5H1TA 4O77A 5F2PA 4O7FA 4MR5A 4QUTA 5L96A 1N72A 4YH4A 2DKWA 5FFVA 5CZGA 4QC3A 5FB1A 3O34A 4XUAA 4QY4A 2DATA 4HXSA 5ENFA 4A9KA 4A9LA 5DW1A 4YH3A 5D26A 4OUFA 3MXFA 4BW3A 4O74A 5FFYA 4OGJA 2WP1A 4UIXA 5LKZA 2YQDA 4N3WA 5HFRA 3ONIA 2N9GA 4AKNA 4KCXA 2L85A 5DFBA 5DKDA 5D7XA 5ENHA 3JVMA 5D3LA 5EICA 4NR6A 5FE0A 3Q2FA 5L98A 4QB3A 5F1LA 3JVJA 4YYMA 4NUCA 4YBSA 5CUEA 1WUGA 5F36A 2E7OA 1JM4B 3HMFA 5A83A 4YABA 5IGNA 5A5SA 5FE8A 5DYAA 4MR6A 3UVDA 5D3SA 5HM0A 4NR8A 3RCWA 4CUSA 4IORA 5H85A 5EVAA 5A5OA 2E3KA 4IR6A 4CFLA 5D3NA 3QZTA 5A5RA 5EPSA 4TT6A 4YC9A 5EWCA 5FE3A 5I88A 4YBTA 5H1VA 5A5QA 5HQ5A 5FH7A 5EI4A 1F68A 5E73A 2YYNA 4GPJA 5A81A 4PCEA 3LXJA 5ETBA 3DAIA 4Q0OA 5A5NA 5DFDA 4PTBA 5DX4A 2R10A 3S92A 5CQ8A 5FE4A 2F6NA 4UYFB 4TT2A 3JVLA 2L5EA 2MJVB 4QEVA 4LC2A 3IU5A 5TCMA 5E3DA 4Z1SA 5CUAA 4XY9A 4LR6A 1ZS5A 4A9EA 5D3HA 4A9JA 5D24A 4O75A 5JWMA 5IBNA 5J0DA 5EWVA 5E9KA 4MEQA 4Z6IA 5E9VA 4NXJA 4YYNA 4ZW1A 3UVYA 3NXBA 5CU8A 3P1EA 5ENGA 5I7XA 5EK9A 5BT3A 5A5PA 4Q0NA 3S91A 5EPRA 3LQIA 4BW2A 3UVWA 4MEPA 2R0SA 2YW5A 5EWDA 4NS5A 2RNWA 3MB4A 4HXLA 2G4AA 4TQNA 5C89A 5C85A 2R0YA 5DKCA 2DVQA 5CQAA 4YY6A 4CFKA 4QEUA 4YYHA 5L8TA 3G0LA 4NR5A 3MULA 1X0JA 5DW2A 2R0VA 5E3GA 5E9MA 3AQAA 5ENBA 5IG6A 5BT4A 3O33A 4TS8A 5FFWA 4LRGA 4NQMA 4WHWA 5BT5A 3SVHA 5I29A 4UIZA 4YK0A 4O76A 5L99A 4XYAA 5KTXA 5LVRA 5HRVA 3FKMX 5CY9A 4QEWA 5D0CA 4CURA 5DBMA 5HLSA 5FE2A 3O35A 5I40A 4HBWA 5LJ1A 4UYGA 2RFJA 5FH8A 5FE1A 5ENIA 2YEMA 4CL9A 5HQ6A 3GG3A 4QSWA 4QYLA 5KO4A 5CQ5A 4LYWA 3UV4A 5EA1A 5G4SA 4TU6A 3MUKA 5L8UA 5CS8A 4F3IA 5K29A 5CRZA 4QR4A 5H1UA 4IR4A 5D3JA 4HBVA 5EU1A 5CGPA 5EPBA 4PS5A 2KTBB 4J1PA 4YBMA 5LUUA 4TTEA 5FBXA 2RS9B 3I3JA 5DYCA 4A9OA 4UYHA 5F61A 3P5OA 5F5ZA 4O7AA 4PY6A 4CLBA 3G0JA 4NUDA 3Q2EA 2YDWA 4QSVA 4TU4A 4XUBA 4NRAA 5CRMA 5A82A 4PCIA 4HXPA 5ACYA 5CTLA 3MQMA 5II2A 4NR4A 4Y03A 4QR5A 4YYIA 5I1QA 4LYIA 5I89A 4YAXA 4HXNA 5EGUA 4Z6HA 5I7YA 5E7DA 5HEMA 4CUTA 3AADA 4QSRA 3U5MA 5JI8A 4NYWA 4O71A 4TYLA 4YYKA 4N4GA 5KHMA 4QZSA 5HRWA 2OO1A 5F62A 4YYDA 2RNYA 4MENA 5IGLA 5I86A 4N4FA 4QSXA 3JVKA 4WIVA 3HMHA 5FG4A 5HJCA 5II1A 5E74A 2DVVA 3UVXA 5CUGA 4YATA 5EISA 3K2JA 3D7CA 4O7EA 4N4HA 4QSUA 5FDZA 4NYXA 5CUCA 2E7NA 4HBYA 4YY4A 4HXKA 4QUUA 5LVQA 4KV4A 4UITA 4NUEA 2DVSA 2YEKA 4UYDA 5LKTA 4IR3A 5EQ1A 5F3AA 5DLZA 5KU3A 2YELA 4OGIA 4BW1A 5DYXA 5HRXA 5E9IA 5EWWA 4NYVA 4CUPA 2RI7A 3SVFA 5I83A 5C87A 5C8GA 5D3TA 4A9MA 5E0RA 4HXOA 5FG6A 5HELA 5ENCA 2RO1A 3IU6A 5COIA 2D82A 3U5PA 1JSPB 4BW4A 3QZVA 3UV2A 4IOQA 4TZ8A 4HXMA 5HCLA 5FG5A 5FE9A 3TLPA 4MEOA 4RVRA 3LQHA 5CQTA 4ZC9A 5G4RA 5F63A 2GRCA 5CQ6A 5IGKA 5LJ2A 5EWHA 4J0RA 2L84A 4O70A 4MR3A 2DWWA 5KTWA 5FH6A 5LKXA 4UIUA 5CUDA 4NRBA 4O7BA 4QSQA 4QNSA 4X2IA 5DKHA 4UIYA 4QSPA 5D3PA 4CUQA 4NQNA 4NR7A 5IIDA 4PKLA 5E9YA 4NRCA 4LYSA 4XY8A 4YYGA 5C4QA 4ZQLA 4YADA 5DFCA 5E9LA 4UYFA 4C67A 5IGMA 2D9EA 5TB6A 4Z1QA 3QZSA 2I7KA 5CQ7A 4IOOA 4KV1A 4QSSA 5AD2A 4ALHA 3U5KA 4O7CA 3U5JA 2OUOA 2I8NA 4O78A 5CQ4A 5F25A 4QYDA 4TT4A 2OSSA 1EQFA 5CUBA 5I80A 4A9IA 4BJXA 4NR9A 5LJ0A 3P1CA 5ENEA 4WHUA 5AMFA 4J3IA 4HXRA 4BHWA 5HFQA 5CQ3A 4A9FA 5C7NA 4IR5A 4QSTA 5A7CA 5A85A 5DLXA 4MR4A 2NXBA 5DYUA 5ENJA 5FE6A 4QC1A 4UIWA 5F60A 4J0SA 4YYJA 5EV9A 3P1FA 4ALGA 5EP7A 4FLPA 5CFWA 4CUUA 3U5NA 5CPEA 2WP2A 4LZSA 5D3RA 4UYEA 2H60A 5ETDA 4N4IA 1WUMA 3UV5A
chains in the Genus database with same CATH superfamily
4DONA 5CP5A 3U5OA 3SVGA 2FSAA 4AKHA 3O36A 5AMEA 3LJWA 4A9NA 2F6JA 5EM3A 4E96A 5DY7A 3ZYUA 5F1HA 4QR3A 3LQJA 2LSPB 3U5LA 5L97A 5D25A 5FE7A 4LZRA 5HENA 3ERRA 3MB3A 5HQ7A 3HMEA 4UIVA 4LDFA 4TZ2A 5FE5A 4QBMA 4Z93A 4HBXA 4C66A 2DVRA 4A9HA 5FB0A 1E6IA 2RNXA 3UW9A 3O37A 4O72A 4LZ2A 3P1DA 5KTUA 5AD3A 5LKUA 3DWYA 5H1TA 4O77A 5F2PA 4O7FA 4MR5A 4QUTA 5L96A 1N72A 4YH4A 2DKWA 5FFVA 5CZGA 4QC3A 5FB1A 3D1DA 3O34A 4XUAA 4QY4A 2DATA 4HXSA 5ENFA 4A9KA 4A9LA 5DW1A 4YH3A 5D26A 4OUFA 3MXFA 4BW3A 4O74A 5FFYA 4OGJA 2WP1A 4UIXA 5LKZA 2YQDA 4N3WA 5HFRA 3ONIA 2N9GA 4AKNA 4KCXA 2L85A 5DFBA 5DKDA 5D7XA 5ENHA 3JVMA 5D3LA 5EICA 4NR6A 5FE0A 3Q2FA 5L98A 4QB3A 5F1LA 3JVJA 4YYMA 4NUCA 4YBSA 5CUEA 1WUGA 5F36A 2E7OA 1JM4B 3HMFA 5A83A 4YABA 5IGNA 5A5SA 5FE8A 5DYAA 4MR6A 3UVDA 5D3SA 5HM0A 4NR8A 3RCWA 4CUSA 4IORA 5H85A 5EVAA 5A5OA 2E3KA 4IR6A 4CFLA 5D3NA 3QZTA 5A5RA 5EPSA 4TT6A 4YC9A 5EWCA 5FE3A 5I88A 4YBTA 5H1VA 5A5QA 5HQ5A 5FH7A 5EI4A 1F68A 5E73A 3VKGA 2YYNA 4GPJA 5A81A 4PCEA 3LXJA 5ETBA 3DAIA 4Q0OA 5A5NA 5DFDA 4PTBA 5DX4A 2R10A 3S92A 5CQ8A 5FE4A 2F6NA 4UYFB 4TT2A 3JVLA 2L5EA 2MJVB 4QEVA 4LC2A 3IU5A 5TCMA 5E3DA 4Z1SA 5CUAA 4XY9A 4LR6A 1ZS5A 4A9EA 5D3HA 4A9JA 5D24A 4O75A 5JWMA 5IBNA 5J0DA 5EWVA 5E9KA 4MEQA 4Z6IA 5E9VA 4NXJA 4YYNA 4ZW1A 3UVYA 3NXBA 5CU8A 3P1EA 5ENGA 5I7XA 4AKIA 5EK9A 5BT3A 5A5PA 4Q0NA 3S91A 5EPRA 3LQIA 4BW2A 3UVWA 4MEPA 2R0SA 2YW5A 5EWDA 4NS5A 2RNWA 3MB4A 4HXLA 2G4AA 4TQNA 5C89A 5C85A 2R0YA 5DKCA 2DVQA 5CQAA 4YY6A 4CFKA 4QEUA 4YYHA 5L8TA 3G0LA 4NR5A 3MULA 1X0JA 5DW2A 2R0VA 5E3GA 5E9MA 3AQAA 5ENBA 5IG6A 5BT4A 3O33A 4TS8A 5FFWA 4LRGA 4NQMA 4WHWA 5BT5A 3SVHA 5I29A 4UIZA 4YK0A 4O76A 5L99A 4XYAA 5KTXA 5LVRA 5HRVA 3FKMX 5CY9A 4QEWA 5D0CA 4CURA 5DBMA 5HLSA 5FE2A 3O35A 5I40A 4HBWA 5LJ1A 4UYGA 2RFJA 5FH8A 5FE1A 5ENIA 2YEMA 4CL9A 5HQ6A 3GG3A 4QSWA 4QYLA 5KO4A 5CQ5A 4LYWA 3UV4A 5EA1A 5G4SA 4TU6A 3MUKA 5L8UA 5CS8A 4F3IA 5K29A 5CRZA 4QR4A 5H1UA 2EJNA 4IR4A 5D3JA 4HBVA 5EU1A 3VKHA 5CGPA 5EPBA 4PS5A 2KTBB 4J1PA 4YBMA 5LUUA 4TTEA 5FBXA 2RS9B 3I3JA 5DYCA 3D1BA 4A9OA 4UYHA 5F61A 3P5OA 5F5ZA 4O7AA 4PY6A 4CLBA 3G0JA 4NUDA 3Q2EA 2YDWA 4QSVA 4TU4A 4XUBA 4NRAA 5CRMA 5A82A 4PCIA 4HXPA 5ACYA 5CTLA 3MQMA 5II2A 4NR4A 4Y03A 4QR5A 4YYIA 5I1QA 4LYIA 5I89A 4YAXA 4HXNA 5EGUA 4Z6HA 5I7YA 5E7DA 5HEMA 4CUTA 3AADA 4QSRA 3U5MA 5JI8A 4NYWA 4O71A 4TYLA 4YYKA 4N4GA 5KHMA 4QZSA 5HRWA 2OO1A 5F62A 4YYDA 2RNYA 4MENA 5IGLA 5I86A 4N4FA 4QSXA 3JVKA 4WIVA 3HMHA 5FG4A 5HJCA 5II1A 5E74A 2DVVA 3UVXA 5CUGA 4YATA 5EISA 3K2JA 3D7CA 4O7EA 4N4HA 4QSUA 5FDZA 4NYXA 5CUCA 2E7NA 1PUOA 4HBYA 4YY4A 4HXKA 4QUUA 5LVQA 4KV4A 4UITA 4NUEA 2DVSA 2YEKA 4UYDA 5LKTA 4IR3A 5EQ1A 5F3AA 5DLZA 5KU3A 2YELA 4OGIA 4BW1A 1ZKRA 5DYXA 5HRXA 5E9IA 5EWWA 4NYVA 4CUPA 2RI7A 3SVFA 5I83A 5C87A 5C8GA 5D3TA 4A9MA 5E0RA 4HXOA 5FG6A 5HELA 5ENCA 2RO1A 3IU6A 5COIA 2D82A 3U5PA 1JSPB 4BW4A 3QZVA 3UV2A 4IOQA 4TZ8A 4HXMA 5HCLA 4AI6A 5FG5A 5FE9A 3TLPA 4MEOA 4RVRA 3LQHA 5CQTA 4ZC9A 5G4RA 5F63A 2GRCA 5CQ6A 5IGKA 5LJ2A 5EWHA 4J0RA 2L84A 4O70A 4MR3A 2DWWA 5KTWA 5FH6A 5LKXA 4UIUA 5CUDA 4NRBA 4O7BA 4QSQA 4QNSA 4X2IA 5DKHA 4UIYA 4QSPA 5D3PA 4CUQA 4NQNA 4NR7A 5IIDA 4PKLA 5E9YA 4NRCA 4LYSA 4XY8A 4YYGA 5C4QA 4ZQLA 4YADA 5DFCA 5E9LA 4UYFA 4C67A 5IGMA 2D9EA 5TB6A 4Z1QA 3QZSA 2I7KA 5CQ7A 4IOOA 4KV1A 4QSSA 5AD2A 4ALHA 3U5KA 4O7CA 3U5JA 2OUOA 2I8NA 4O78A 5CQ4A 5F25A 4QYDA 4TT4A 2OSSA 1EQFA 5CUBA 5I80A 4A9IA 4BJXA 4NR9A 5LJ0A 3P1CA 5ENEA 4WHUA 5AMFA 4J3IA 4HXRA 4BHWA 5HFQA 5CQ3A 4A9FA 5C7NA 4IR5A 4QSTA 5A7CA 5A85A 5DLXA 4MR4A 2NXBA 5DYUA 5ENJA 5FE6A 4QC1A 4UIWA 5F60A 4J0SA 4YYJA 5EV9A 3P1FA 4ALGA 5EP7A 4FLPA 5CFWA 4CUUA 3U5NA 5CPEA 2WP2A 4LZSA 5D3RA 4AKGA 4UYEA 2H60A 5ETDA 4N4IA 1WUMA 3UV5A
chains in the Genus database with same CATH topology
4DONA 5CP5A 3U5OA 3SVGA 2FSAA 3O36A 5AMEA 3LJWA 4A9NA 2F6JA 5EM3A 4E96A 5DY7A 3ZYUA 5F1HA 4QR3A 3LQJA 2LSPB 3U5LA 5L97A 5D25A 5FE7A 4LZRA 5HENA 3MB3A 5HQ7A 3HMEA 4UIVA 4LDFA 4TZ2A 5FE5A 4QBMA 4Z93A 4HBXA 4C66A 2DVRA 4A9HA 5FB0A 1E6IA 2RNXA 3UW9A 3O37A 4O72A 4LZ2A 3P1DA 5KTUA 5AD3A 5LKUA 3DWYA 5H1TA 4O77A 5F2PA 4O7FA 4MR5A 4QUTA 5L96A 1N72A 4YH4A 2DKWA 5FFVA 5CZGA 4QC3A 5FB1A 3O34A 4XUAA 4QY4A 2DATA 4HXSA 5ENFA 4A9KA 4A9LA 5DW1A 4YH3A 5D26A 4OUFA 3MXFA 4BW3A 4O74A 5FFYA 4OGJA 2WP1A 4UIXA 5LKZA 2YQDA 4N3WA 5HFRA 3ONIA 2N9GA 4AKNA 4KCXA 2L85A 5DFBA 5DKDA 5D7XA 5ENHA 3JVMA 5D3LA 5EICA 4NR6A 5FE0A 3Q2FA 5L98A 4QB3A 5F1LA 3JVJA 4YYMA 4NUCA 4YBSA 5CUEA 1WUGA 5F36A 2E7OA 1JM4B 3HMFA 5A83A 4YABA 5IGNA 5A5SA 5FE8A 5DYAA 4MR6A 3UVDA 5D3SA 5HM0A 4NR8A 3RCWA 4CUSA 4IORA 5H85A 5EVAA 5A5OA 2E3KA 4IR6A 4CFLA 5D3NA 3QZTA 5A5RA 5EPSA 4TT6A 4YC9A 5EWCA 5FE3A 5I88A 4YBTA 5H1VA 5A5QA 5HQ5A 5FH7A 5EI4A 1F68A 5E73A 2YYNA 4GPJA 5A81A 4PCEA 3LXJA 5ETBA 3DAIA 4Q0OA 5A5NA 5DFDA 4PTBA 5DX4A 2R10A 3S92A 5CQ8A 5FE4A 2F6NA 4UYFB 4TT2A 3JVLA 2L5EA 2MJVB 4QEVA 4LC2A 3IU5A 5TCMA 5E3DA 4Z1SA 5CUAA 4XY9A 4LR6A 1ZS5A 4A9EA 5D3HA 4A9JA 5D24A 4O75A 5JWMA 5IBNA 5J0DA 5EWVA 5E9KA 4MEQA 4Z6IA 5E9VA 4NXJA 4YYNA 4ZW1A 3UVYA 3NXBA 5CU8A 3P1EA 5ENGA 5I7XA 5EK9A 5BT3A 5A5PA 4Q0NA 3S91A 5EPRA 3LQIA 4BW2A 3UVWA 4MEPA 2R0SA 2YW5A 5EWDA 4NS5A 2RNWA 3MB4A 4HXLA 2G4AA 4TQNA 5C89A 5C85A 2R0YA 5DKCA 2DVQA 5CQAA 4YY6A 4CFKA 4QEUA 4YYHA 5L8TA 3G0LA 4NR5A 3MULA 1X0JA 5DW2A 2R0VA 5E3GA 5E9MA 3AQAA 5ENBA 5IG6A 5BT4A 3O33A 4TS8A 5FFWA 4LRGA 4NQMA 4WHWA 5BT5A 3SVHA 5I29A 4UIZA 4YK0A 4O76A 5L99A 4XYAA 5KTXA 5LVRA 5HRVA 3FKMX 5CY9A 4QEWA 5D0CA 4CURA 5DBMA 5HLSA 5FE2A 3O35A 5I40A 4HBWA 5LJ1A 4UYGA 2RFJA 5FH8A 5FE1A 5ENIA 2YEMA 4CL9A 5HQ6A 3GG3A 4QSWA 4QYLA 5KO4A 5CQ5A 4LYWA 3UV4A 5EA1A 5G4SA 4TU6A 3MUKA 5L8UA 5CS8A 4F3IA 5K29A 5CRZA 4QR4A 5H1UA 4IR4A 5D3JA 4HBVA 5EU1A 5CGPA 5EPBA 4PS5A 2KTBB 4J1PA 4YBMA 5LUUA 4TTEA 5FBXA 2RS9B 3I3JA 5DYCA 4A9OA 4UYHA 5F61A 3P5OA 5F5ZA 4O7AA 4PY6A 4CLBA 3G0JA 4NUDA 3Q2EA 2YDWA 4QSVA 4TU4A 4XUBA 4NRAA 5CRMA 5A82A 4PCIA 4HXPA 5ACYA 5CTLA 3MQMA 5II2A 4NR4A 4Y03A 4QR5A 4YYIA 5I1QA 4LYIA 5I89A 4YAXA 4HXNA 5EGUA 4Z6HA 5I7YA 5E7DA 5HEMA 4CUTA 3AADA 4QSRA 3U5MA 5JI8A 4NYWA 4O71A 4TYLA 4YYKA 4N4GA 5KHMA 4QZSA 5HRWA 2OO1A 5F62A 4YYDA 2RNYA 4MENA 5IGLA 5I86A 4N4FA 4QSXA 3JVKA 4WIVA 3HMHA 5FG4A 5HJCA 5II1A 5E74A 2DVVA 3UVXA 5CUGA 4YATA 5EISA 3K2JA 3D7CA 4O7EA 4N4HA 4QSUA 5FDZA 4NYXA 5CUCA 2E7NA 4HBYA 4YY4A 4HXKA 4QUUA 5LVQA 4KV4A 4UITA 4NUEA 2DVSA 2YEKA 4UYDA 5LKTA 4IR3A 5EQ1A 5F3AA 5DLZA 5KU3A 2YELA 4OGIA 4BW1A 5DYXA 5HRXA 5E9IA 5EWWA 4NYVA 4CUPA 2RI7A 3SVFA 5I83A 5C87A 5C8GA 5D3TA 4A9MA 5E0RA 4HXOA 5FG6A 5HELA 5ENCA 2RO1A 3IU6A 5COIA 2D82A 3U5PA 1JSPB 4BW4A 3QZVA 3UV2A 4IOQA 4TZ8A 4HXMA 5HCLA 5FG5A 5FE9A 3TLPA 4MEOA 4RVRA 3LQHA 5CQTA 4ZC9A 5G4RA 5F63A 2GRCA 5CQ6A 5IGKA 5LJ2A 5EWHA 4J0RA 2L84A 4O70A 4MR3A 2DWWA 5KTWA 5FH6A 5LKXA 4UIUA 5CUDA 4NRBA 4O7BA 4QSQA 4QNSA 4X2IA 5DKHA 4UIYA 4QSPA 5D3PA 4CUQA 4NQNA 4NR7A 5IIDA 4PKLA 5E9YA 4NRCA 4LYSA 4XY8A 4YYGA 5C4QA 4ZQLA 4YADA 5DFCA 5E9LA 4UYFA 4C67A 5IGMA 2D9EA 5TB6A 4Z1QA 3QZSA 2I7KA 5CQ7A 4IOOA 4KV1A 4QSSA 5AD2A 4ALHA 3U5KA 4O7CA 3U5JA 2OUOA 2I8NA 4O78A 5CQ4A 5F25A 4QYDA 4TT4A 2OSSA 1EQFA 5CUBA 5I80A 4A9IA 4BJXA 4NR9A 5LJ0A 3P1CA 5ENEA 4WHUA 5AMFA 4J3IA 4HXRA 4BHWA 5HFQA 5CQ3A 4A9FA 5C7NA 4IR5A 4QSTA 5A7CA 5A85A 5DLXA 4MR4A 2NXBA 5DYUA 5ENJA 5FE6A 4QC1A 4UIWA 5F60A 4J0SA 4YYJA 5EV9A 3P1FA 4ALGA 5EP7A 4FLPA 5CFWA 4CUUA 3U5NA 5CPEA 2WP2A 4LZSA 5D3RA 4UYEA 2H60A 5ETDA 4N4IA 1WUMA 3UV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DON A;  5CP5 A;  3U5O A;  3SVG A;  2FSA A;  3O36 A;  5AME A;  3LJW A;  4A9N A;  2F6J A;  5EM3 A;  4E96 A;  5DY7 A;  3ZYU A;  5F1H A;  4QR3 A;  3LQJ A;  2LSP B;  3U5L A;  5L97 A;  5D25 A;  5FE7 A;  4LZR A;  5HEN A;  3MB3 A;  5HQ7 A;  3HME A;  4UIV A;  4LDF A;  4TZ2 A;  5FE5 A;  4QBM A;  4Z93 A;  4HBX A;  4C66 A;  2DVR A;  4A9H A;  5FB0 A;  1E6I A;  2RNX A;  3UW9 A;  3O37 A;  4O72 A;  4LZ2 A;  3P1D A;  5KTU A;  5AD3 A;  5LKU A;  3DWY A;  5H1T A;  4O77 A;  5F2P A;  4O7F A;  4MR5 A;  4QUT A;  5L96 A;  1N72 A;  4YH4 A;  2DKW A;  5FFV A;  5CZG A;  4QC3 A;  5FB1 A;  3O34 A;  4XUA A;  4QY4 A;  2DAT A;  4HXS A;  5ENF A;  4A9K A;  4A9L A;  5DW1 A;  4YH3 A;  5D26 A;  4OUF A;  3MXF A;  4BW3 A;  4O74 A;  5FFY A;  4OGJ A;  2WP1 A;  4UIX A;  5LKZ A;  2YQD A;  4N3W A;  5HFR A;  3ONI A;  2N9G A;  4AKN A;  4KCX A;  2L85 A;  5DFB A;  5DKD A;  5D7X A;  5ENH A;  3JVM A;  5D3L A;  5EIC A;  4NR6 A;  5FE0 A;  3Q2F A;  5L98 A;  4QB3 A;  5F1L A;  3JVJ A;  4YYM A;  4NUC A;  4YBS A;  5CUE A;  1WUG A;  5F36 A;  2E7O A;  1JM4 B;  3HMF A;  5A83 A;  4YAB A;  5IGN A;  5A5S A;  5FE8 A;  5DYA A;  4MR6 A;  3UVD A;  5D3S A;  5HM0 A;  4NR8 A;  3RCW A;  4CUS A;  4IOR A;  5H85 A;  5EVA A;  5A5O A;  2E3K A;  4IR6 A;  4CFL A;  5D3N A;  3QZT A;  5A5R A;  5EPS A;  4TT6 A;  4YC9 A;  5EWC A;  5FE3 A;  5I88 A;  4YBT A;  5H1V A;  5A5Q A;  5HQ5 A;  5FH7 A;  5EI4 A;  1F68 A;  5E73 A;  2YYN A;  4GPJ A;  5A81 A;  4PCE A;  3LXJ A;  5ETB A;  3DAI A;  4Q0O A;  5A5N A;  5DFD A;  4PTB A;  5DX4 A;  2R10 A;  3S92 A;  5CQ8 A;  5FE4 A;  2F6N A;  4UYF B;  4TT2 A;  3JVL A;  2L5E A;  2MJV B;  4QEV A;  4LC2 A;  3IU5 A;  5TCM A;  5E3D A;  4Z1S A;  5CUA A;  4XY9 A;  4LR6 A;  1ZS5 A;  4A9E A;  5D3H A;  4A9J A;  5D24 A;  4O75 A;  5JWM A;  5IBN A;  5J0D A;  5EWV A;  5E9K A;  4MEQ A;  4Z6I A;  5E9V A;  4NXJ A;  4YYN A;  4ZW1 A;  3UVY A;  3NXB A;  5CU8 A;  3P1E A;  5ENG A;  5I7X A;  5EK9 A;  5BT3 A;  5A5P A;  4Q0N A;  3S91 A;  5EPR A;  3LQI A;  4BW2 A;  3UVW A;  4MEP A;  2R0S A;  2YW5 A;  5EWD A;  4NS5 A;  2RNW A;  3MB4 A;  4HXL A;  2G4A A;  4TQN A;  5C89 A;  5C85 A;  2R0Y A;  5DKC A;  2DVQ A;  5CQA A;  4YY6 A;  4CFK A;  4QEU A;  4YYH A;  5L8T A;  3G0L A;  4NR5 A;  3MUL A;  1X0J A;  5DW2 A;  2R0V A;  5E3G A;  5E9M A;  3AQA A;  5ENB A;  5IG6 A;  5BT4 A;  3O33 A;  4TS8 A;  5FFW A;  4LRG A;  4NQM A;  4WHW A;  5BT5 A;  3SVH A;  5I29 A;  4UIZ A;  4YK0 A;  4O76 A;  5L99 A;  4XYA A;  5KTX A;  5LVR A;  5HRV A;  3FKM X;  5CY9 A;  4QEW A;  5D0C A;  4CUR A;  5DBM A;  5HLS A;  5FE2 A;  3O35 A;  5I40 A;  4HBW A;  5LJ1 A;  4UYG A;  2RFJ A;  5FH8 A;  5FE1 A;  5ENI A;  2YEM A;  4CL9 A;  5HQ6 A;  3GG3 A;  4QSW A;  4QYL A;  5KO4 A;  5CQ5 A;  4LYW A;  3UV4 A;  5EA1 A;  5G4S A;  4TU6 A;  3MUK A;  5L8U A;  5CS8 A;  4F3I A;  5K29 A;  5CRZ A;  4QR4 A;  5H1U A;  4IR4 A;  5D3J A;  4HBV A;  5EU1 A;  5CGP A;  5EPB A;  4PS5 A;  2KTB B;  4J1P A;  4YBM A;  5LUU A;  4TTE A;  5FBX A;  2RS9 B;  3I3J A;  5DYC A;  4A9O A;  4UYH A;  5F61 A;  3P5O A;  5F5Z A;  4O7A A;  4PY6 A;  4CLB A;  3G0J A;  4NUD A;  3Q2E A;  2YDW A;  4QSV A;  4TU4 A;  4XUB A;  4NRA A;  5CRM A;  5A82 A;  4PCI A;  4HXP A;  5ACY A;  5CTL A;  3MQM A;  5II2 A;  4NR4 A;  4Y03 A;  4QR5 A;  4YYI A;  5I1Q A;  4LYI A;  5I89 A;  4YAX A;  4HXN A;  5EGU A;  4Z6H A;  5I7Y A;  5E7D A;  5HEM A;  4CUT A;  3AAD A;  4QSR A;  3U5M A;  5JI8 A;  4NYW A;  4O71 A;  4TYL A;  4YYK A;  4N4G A;  5KHM A;  4QZS A;  5HRW A;  2OO1 A;  5F62 A;  4YYD A;  2RNY A;  4MEN A;  5IGL A;  5I86 A;  4N4F A;  4QSX A;  3JVK A;  4WIV A;  3HMH A;  5FG4 A;  5HJC A;  5II1 A;  5E74 A;  2DVV A;  3UVX A;  5CUG A;  4YAT A;  5EIS A;  3K2J A;  3D7C A;  4O7E A;  4N4H A;  4QSU A;  5FDZ A;  4NYX A;  5CUC A;  2E7N A;  4HBY A;  4YY4 A;  4HXK A;  4QUU A;  5LVQ A;  4KV4 A;  4UIT A;  4NUE A;  2DVS A;  2YEK A;  4UYD A;  5LKT A;  4IR3 A;  5EQ1 A;  5F3A A;  5DLZ A;  5KU3 A;  2YEL A;  4OGI A;  4BW1 A;  5DYX A;  5HRX A;  5E9I A;  5EWW A;  4NYV A;  4CUP A;  2RI7 A;  3SVF A;  5I83 A;  5C87 A;  5C8G A;  5D3T A;  4A9M A;  5E0R A;  4HXO A;  5FG6 A;  5HEL A;  5ENC A;  2RO1 A;  3IU6 A;  5COI A;  2D82 A;  3U5P A;  1JSP B;  4BW4 A;  3QZV A;  3UV2 A;  4IOQ A;  4TZ8 A;  4HXM A;  5HCL A;  5FG5 A;  5FE9 A;  3TLP A;  4MEO A;  4RVR A;  3LQH A;  5CQT A;  4ZC9 A;  5G4R A;  5F63 A;  2GRC A;  5CQ6 A;  5IGK A;  5LJ2 A;  5EWH A;  4J0R A;  2L84 A;  4O70 A;  4MR3 A;  2DWW A;  5KTW A;  5FH6 A;  5LKX A;  4UIU A;  5CUD A;  4NRB A;  4O7B A;  4QSQ A;  4QNS A;  4X2I A;  5DKH A;  4UIY A;  4QSP A;  5D3P A;  4CUQ A;  4NQN A;  4NR7 A;  5IID A;  4PKL A;  5E9Y A;  4NRC A;  4LYS A;  4XY8 A;  4YYG A;  5C4Q A;  4ZQL A;  4YAD A;  5DFC A;  5E9L A;  4UYF A;  4C67 A;  5IGM A;  2D9E A;  5TB6 A;  4Z1Q A;  3QZS A;  2I7K A;  5CQ7 A;  4IOO A;  4KV1 A;  4QSS A;  5AD2 A;  4ALH A;  3U5K A;  4O7C A;  3U5J A;  2OUO A;  2I8N A;  4O78 A;  5CQ4 A;  5F25 A;  4QYD A;  4TT4 A;  2OSS A;  1EQF A;  5CUB A;  5I80 A;  4A9I A;  4BJX A;  4NR9 A;  5LJ0 A;  3P1C A;  5ENE A;  4WHU A;  5AMF A;  4J3I A;  4HXR A;  4BHW A;  5HFQ A;  5CQ3 A;  4A9F A;  5C7N A;  4IR5 A;  4QST A;  5A7C A;  5A85 A;  5DLX A;  4MR4 A;  2NXB A;  5DYU A;  5ENJ A;  5FE6 A;  4QC1 A;  4UIW A;  5F60 A;  4J0S A;  4YYJ A;  5EV9 A;  3P1F A;  4ALG A;  5EP7 A;  4FLP A;  5CFW A;  4CUU A;  3U5N A;  5CPE A;  2WP2 A;  4LZS A;  5D3R A;  4UYE A;  2H60 A;  5ETD A;  4N4I A;  1WUM A;  3UV5 A; 
#chains in the Genus database with same CATH topology
 4DON A;  5CP5 A;  3U5O A;  3SVG A;  2FSA A;  4AKH A;  3O36 A;  5AME A;  3LJW A;  4A9N A;  2F6J A;  5EM3 A;  4E96 A;  5DY7 A;  3ZYU A;  5F1H A;  4QR3 A;  3LQJ A;  2LSP B;  3U5L A;  5L97 A;  5D25 A;  5FE7 A;  4LZR A;  5HEN A;  3ERR A;  3MB3 A;  5HQ7 A;  3HME A;  4UIV A;  4LDF A;  4TZ2 A;  5FE5 A;  4QBM A;  4Z93 A;  4HBX A;  4C66 A;  2DVR A;  4A9H A;  5FB0 A;  1E6I A;  2RNX A;  3UW9 A;  3O37 A;  4O72 A;  4LZ2 A;  3P1D A;  5KTU A;  5AD3 A;  5LKU A;  3DWY A;  5H1T A;  4O77 A;  5F2P A;  4O7F A;  4MR5 A;  4QUT A;  5L96 A;  1N72 A;  4YH4 A;  2DKW A;  5FFV A;  5CZG A;  4QC3 A;  5FB1 A;  3D1D A;  3O34 A;  4XUA A;  4QY4 A;  2DAT A;  4HXS A;  5ENF A;  4A9K A;  4A9L A;  5DW1 A;  4YH3 A;  5D26 A;  4OUF A;  3MXF A;  4BW3 A;  4O74 A;  5FFY A;  4OGJ A;  2WP1 A;  4UIX A;  5LKZ A;  2YQD A;  4N3W A;  5HFR A;  3ONI A;  2N9G A;  4AKN A;  4KCX A;  2L85 A;  5DFB A;  5DKD A;  5D7X A;  5ENH A;  3JVM A;  5D3L A;  5EIC A;  4NR6 A;  5FE0 A;  3Q2F A;  5L98 A;  4QB3 A;  5F1L A;  3JVJ A;  4YYM A;  4NUC A;  4YBS A;  5CUE A;  1WUG A;  5F36 A;  2E7O A;  1JM4 B;  3HMF A;  5A83 A;  4YAB A;  5IGN A;  5A5S A;  5FE8 A;  5DYA A;  4MR6 A;  3UVD A;  5D3S A;  5HM0 A;  4NR8 A;  3RCW A;  4CUS A;  4IOR A;  5H85 A;  5EVA A;  5A5O A;  2E3K A;  4IR6 A;  4CFL A;  5D3N A;  3QZT A;  5A5R A;  5EPS A;  4TT6 A;  4YC9 A;  5EWC A;  5FE3 A;  5I88 A;  4YBT A;  5H1V A;  5A5Q A;  5HQ5 A;  5FH7 A;  5EI4 A;  1F68 A;  5E73 A;  3VKG A;  2YYN A;  4GPJ A;  5A81 A;  4PCE A;  3LXJ A;  5ETB A;  3DAI A;  4Q0O A;  5A5N A;  5DFD A;  4PTB A;  5DX4 A;  2R10 A;  3S92 A;  5CQ8 A;  5FE4 A;  2F6N A;  4UYF B;  4TT2 A;  3JVL A;  2L5E A;  2MJV B;  4QEV A;  4LC2 A;  3IU5 A;  5TCM A;  5E3D A;  4Z1S A;  5CUA A;  4XY9 A;  4LR6 A;  1ZS5 A;  4A9E A;  5D3H A;  4A9J A;  5D24 A;  4O75 A;  5JWM A;  5IBN A;  5J0D A;  5EWV A;  5E9K A;  4MEQ A;  4Z6I A;  5E9V A;  4NXJ A;  4YYN A;  4ZW1 A;  3UVY A;  3NXB A;  5CU8 A;  3P1E A;  5ENG A;  5I7X A;  4AKI A;  5EK9 A;  5BT3 A;  5A5P A;  4Q0N A;  3S91 A;  5EPR A;  3LQI A;  4BW2 A;  3UVW A;  4MEP A;  2R0S A;  2YW5 A;  5EWD A;  4NS5 A;  2RNW A;  3MB4 A;  4HXL A;  2G4A A;  4TQN A;  5C89 A;  5C85 A;  2R0Y A;  5DKC A;  2DVQ A;  5CQA A;  4YY6 A;  4CFK A;  4QEU A;  4YYH A;  5L8T A;  3G0L A;  4NR5 A;  3MUL A;  1X0J A;  5DW2 A;  2R0V A;  5E3G A;  5E9M A;  3AQA A;  5ENB A;  5IG6 A;  5BT4 A;  3O33 A;  4TS8 A;  5FFW A;  4LRG A;  4NQM A;  4WHW A;  5BT5 A;  3SVH A;  5I29 A;  4UIZ A;  4YK0 A;  4O76 A;  5L99 A;  4XYA A;  5KTX A;  5LVR A;  5HRV A;  3FKM X;  5CY9 A;  4QEW A;  5D0C A;  4CUR A;  5DBM A;  5HLS A;  5FE2 A;  3O35 A;  5I40 A;  4HBW A;  5LJ1 A;  4UYG A;  2RFJ A;  5FH8 A;  5FE1 A;  5ENI A;  2YEM A;  4CL9 A;  5HQ6 A;  3GG3 A;  4QSW A;  4QYL A;  5KO4 A;  5CQ5 A;  4LYW A;  3UV4 A;  5EA1 A;  5G4S A;  4TU6 A;  3MUK A;  5L8U A;  5CS8 A;  4F3I A;  5K29 A;  5CRZ A;  4QR4 A;  5H1U A;  2EJN A;  4IR4 A;  5D3J A;  4HBV A;  5EU1 A;  3VKH A;  5CGP A;  5EPB A;  4PS5 A;  2KTB B;  4J1P A;  4YBM A;  5LUU A;  4TTE A;  5FBX A;  2RS9 B;  3I3J A;  5DYC A;  3D1B A;  4A9O A;  4UYH A;  5F61 A;  3P5O A;  5F5Z A;  4O7A A;  4PY6 A;  4CLB A;  3G0J A;  4NUD A;  3Q2E A;  2YDW A;  4QSV A;  4TU4 A;  4XUB A;  4NRA A;  5CRM A;  5A82 A;  4PCI A;  4HXP A;  5ACY A;  5CTL A;  3MQM A;  5II2 A;  4NR4 A;  4Y03 A;  4QR5 A;  4YYI A;  5I1Q A;  4LYI A;  5I89 A;  4YAX A;  4HXN A;  5EGU A;  4Z6H A;  5I7Y A;  5E7D A;  5HEM A;  4CUT A;  3AAD A;  4QSR A;  3U5M A;  5JI8 A;  4NYW A;  4O71 A;  4TYL A;  4YYK A;  4N4G A;  5KHM A;  4QZS A;  5HRW A;  2OO1 A;  5F62 A;  4YYD A;  2RNY A;  4MEN A;  5IGL A;  5I86 A;  4N4F A;  4QSX A;  3JVK A;  4WIV A;  3HMH A;  5FG4 A;  5HJC A;  5II1 A;  5E74 A;  2DVV A;  3UVX A;  5CUG A;  4YAT A;  5EIS A;  3K2J A;  3D7C A;  4O7E A;  4N4H A;  4QSU A;  5FDZ A;  4NYX A;  5CUC A;  2E7N A;  1PUO A;  4HBY A;  4YY4 A;  4HXK A;  4QUU A;  5LVQ A;  4KV4 A;  4UIT A;  4NUE A;  2DVS A;  2YEK A;  4UYD A;  5LKT A;  4IR3 A;  5EQ1 A;  5F3A A;  5DLZ A;  5KU3 A;  2YEL A;  4OGI A;  4BW1 A;  1ZKR A;  5DYX A;  5HRX A;  5E9I A;  5EWW A;  4NYV A;  4CUP A;  2RI7 A;  3SVF A;  5I83 A;  5C87 A;  5C8G A;  5D3T A;  4A9M A;  5E0R A;  4HXO A;  5FG6 A;  5HEL A;  5ENC A;  2RO1 A;  3IU6 A;  5COI A;  2D82 A;  3U5P A;  1JSP B;  4BW4 A;  3QZV A;  3UV2 A;  4IOQ A;  4TZ8 A;  4HXM A;  5HCL A;  4AI6 A;  5FG5 A;  5FE9 A;  3TLP A;  4MEO A;  4RVR A;  3LQH A;  5CQT A;  4ZC9 A;  5G4R A;  5F63 A;  2GRC A;  5CQ6 A;  5IGK A;  5LJ2 A;  5EWH A;  4J0R A;  2L84 A;  4O70 A;  4MR3 A;  2DWW A;  5KTW A;  5FH6 A;  5LKX A;  4UIU A;  5CUD A;  4NRB A;  4O7B A;  4QSQ A;  4QNS A;  4X2I A;  5DKH A;  4UIY A;  4QSP A;  5D3P A;  4CUQ A;  4NQN A;  4NR7 A;  5IID A;  4PKL A;  5E9Y A;  4NRC A;  4LYS A;  4XY8 A;  4YYG A;  5C4Q A;  4ZQL A;  4YAD A;  5DFC A;  5E9L A;  4UYF A;  4C67 A;  5IGM A;  2D9E A;  5TB6 A;  4Z1Q A;  3QZS A;  2I7K A;  5CQ7 A;  4IOO A;  4KV1 A;  4QSS A;  5AD2 A;  4ALH A;  3U5K A;  4O7C A;  3U5J A;  2OUO A;  2I8N A;  4O78 A;  5CQ4 A;  5F25 A;  4QYD A;  4TT4 A;  2OSS A;  1EQF A;  5CUB A;  5I80 A;  4A9I A;  4BJX A;  4NR9 A;  5LJ0 A;  3P1C A;  5ENE A;  4WHU A;  5AMF A;  4J3I A;  4HXR A;  4BHW A;  5HFQ A;  5CQ3 A;  4A9F A;  5C7N A;  4IR5 A;  4QST A;  5A7C A;  5A85 A;  5DLX A;  4MR4 A;  2NXB A;  5DYU A;  5ENJ A;  5FE6 A;  4QC1 A;  4UIW A;  5F60 A;  4J0S A;  4YYJ A;  5EV9 A;  3P1F A;  4ALG A;  5EP7 A;  4FLP A;  5CFW A;  4CUU A;  3U5N A;  5CPE A;  2WP2 A;  4LZS A;  5D3R A;  4AKG A;  4UYE A;  2H60 A;  5ETD A;  4N4I A;  1WUM A;  3UV5 A; 
#chains in the Genus database with same CATH homology
 4DON A;  5CP5 A;  3U5O A;  3SVG A;  2FSA A;  3O36 A;  5AME A;  3LJW A;  4A9N A;  2F6J A;  5EM3 A;  4E96 A;  5DY7 A;  3ZYU A;  5F1H A;  4QR3 A;  3LQJ A;  2LSP B;  3U5L A;  5L97 A;  5D25 A;  5FE7 A;  4LZR A;  5HEN A;  3MB3 A;  5HQ7 A;  3HME A;  4UIV A;  4LDF A;  4TZ2 A;  5FE5 A;  4QBM A;  4Z93 A;  4HBX A;  4C66 A;  2DVR A;  4A9H A;  5FB0 A;  1E6I A;  2RNX A;  3UW9 A;  3O37 A;  4O72 A;  4LZ2 A;  3P1D A;  5KTU A;  5AD3 A;  5LKU A;  3DWY A;  5H1T A;  4O77 A;  5F2P A;  4O7F A;  4MR5 A;  4QUT A;  5L96 A;  1N72 A;  4YH4 A;  2DKW A;  5FFV A;  5CZG A;  4QC3 A;  5FB1 A;  3O34 A;  4XUA A;  4QY4 A;  2DAT A;  4HXS A;  5ENF A;  4A9K A;  4A9L A;  5DW1 A;  4YH3 A;  5D26 A;  4OUF A;  3MXF A;  4BW3 A;  4O74 A;  5FFY A;  4OGJ A;  2WP1 A;  4UIX A;  5LKZ A;  2YQD A;  4N3W A;  5HFR A;  3ONI A;  2N9G A;  4AKN A;  4KCX A;  2L85 A;  5DFB A;  5DKD A;  5D7X A;  5ENH A;  3JVM A;  5D3L A;  5EIC A;  4NR6 A;  5FE0 A;  3Q2F A;  5L98 A;  4QB3 A;  5F1L A;  3JVJ A;  4YYM A;  4NUC A;  4YBS A;  5CUE A;  1WUG A;  5F36 A;  2E7O A;  1JM4 B;  3HMF A;  5A83 A;  4YAB A;  5IGN A;  5A5S A;  5FE8 A;  5DYA A;  4MR6 A;  3UVD A;  5D3S A;  5HM0 A;  4NR8 A;  3RCW A;  4CUS A;  4IOR A;  5H85 A;  5EVA A;  5A5O A;  2E3K A;  4IR6 A;  4CFL A;  5D3N A;  3QZT A;  5A5R A;  5EPS A;  4TT6 A;  4YC9 A;  5EWC A;  5FE3 A;  5I88 A;  4YBT A;  5H1V A;  5A5Q A;  5HQ5 A;  5FH7 A;  5EI4 A;  1F68 A;  5E73 A;  2YYN A;  4GPJ A;  5A81 A;  4PCE A;  3LXJ A;  5ETB A;  3DAI A;  4Q0O A;  5A5N A;  5DFD A;  4PTB A;  5DX4 A;  2R10 A;  3S92 A;  5CQ8 A;  5FE4 A;  2F6N A;  4UYF B;  4TT2 A;  3JVL A;  2L5E A;  2MJV B;  4QEV A;  4LC2 A;  3IU5 A;  5TCM A;  5E3D A;  4Z1S A;  5CUA A;  4XY9 A;  4LR6 A;  1ZS5 A;  4A9E A;  5D3H A;  4A9J A;  5D24 A;  4O75 A;  5JWM A;  5IBN A;  5J0D A;  5EWV A;  5E9K A;  4MEQ A;  4Z6I A;  5E9V A;  4NXJ A;  4YYN A;  4ZW1 A;  3UVY A;  3NXB A;  5CU8 A;  3P1E A;  5ENG A;  5I7X A;  5EK9 A;  5BT3 A;  5A5P A;  4Q0N A;  3S91 A;  5EPR A;  3LQI A;  4BW2 A;  3UVW A;  4MEP A;  2R0S A;  2YW5 A;  5EWD A;  4NS5 A;  2RNW A;  3MB4 A;  4HXL A;  2G4A A;  4TQN A;  5C89 A;  5C85 A;  2R0Y A;  5DKC A;  2DVQ A;  5CQA A;  4YY6 A;  4CFK A;  4QEU A;  4YYH A;  5L8T A;  3G0L A;  4NR5 A;  3MUL A;  1X0J A;  5DW2 A;  2R0V A;  5E3G A;  5E9M A;  3AQA A;  5ENB A;  5IG6 A;  5BT4 A;  3O33 A;  4TS8 A;  5FFW A;  4LRG A;  4NQM A;  4WHW A;  5BT5 A;  3SVH A;  5I29 A;  4UIZ A;  4YK0 A;  4O76 A;  5L99 A;  4XYA A;  5KTX A;  5LVR A;  5HRV A;  3FKM X;  5CY9 A;  4QEW A;  5D0C A;  4CUR A;  5DBM A;  5HLS A;  5FE2 A;  3O35 A;  5I40 A;  4HBW A;  5LJ1 A;  4UYG A;  2RFJ A;  5FH8 A;  5FE1 A;  5ENI A;  2YEM A;  4CL9 A;  5HQ6 A;  3GG3 A;  4QSW A;  4QYL A;  5KO4 A;  5CQ5 A;  4LYW A;  3UV4 A;  5EA1 A;  5G4S A;  4TU6 A;  3MUK A;  5L8U A;  5CS8 A;  4F3I A;  5K29 A;  5CRZ A;  4QR4 A;  5H1U A;  4IR4 A;  5D3J A;  4HBV A;  5EU1 A;  5CGP A;  5EPB A;  4PS5 A;  2KTB B;  4J1P A;  4YBM A;  5LUU A;  4TTE A;  5FBX A;  2RS9 B;  3I3J A;  5DYC A;  4A9O A;  4UYH A;  5F61 A;  3P5O A;  5F5Z A;  4O7A A;  4PY6 A;  4CLB A;  3G0J A;  4NUD A;  3Q2E A;  2YDW A;  4QSV A;  4TU4 A;  4XUB A;  4NRA A;  5CRM A;  5A82 A;  4PCI A;  4HXP A;  5ACY A;  5CTL A;  3MQM A;  5II2 A;  4NR4 A;  4Y03 A;  4QR5 A;  4YYI A;  5I1Q A;  4LYI A;  5I89 A;  4YAX A;  4HXN A;  5EGU A;  4Z6H A;  5I7Y A;  5E7D A;  5HEM A;  4CUT A;  3AAD A;  4QSR A;  3U5M A;  5JI8 A;  4NYW A;  4O71 A;  4TYL A;  4YYK A;  4N4G A;  5KHM A;  4QZS A;  5HRW A;  2OO1 A;  5F62 A;  4YYD A;  2RNY A;  4MEN A;  5IGL A;  5I86 A;  4N4F A;  4QSX A;  3JVK A;  4WIV A;  3HMH A;  5FG4 A;  5HJC A;  5II1 A;  5E74 A;  2DVV A;  3UVX A;  5CUG A;  4YAT A;  5EIS A;  3K2J A;  3D7C A;  4O7E A;  4N4H A;  4QSU A;  5FDZ A;  4NYX A;  5CUC A;  2E7N A;  4HBY A;  4YY4 A;  4HXK A;  4QUU A;  5LVQ A;  4KV4 A;  4UIT A;  4NUE A;  2DVS A;  2YEK A;  4UYD A;  5LKT A;  4IR3 A;  5EQ1 A;  5F3A A;  5DLZ A;  5KU3 A;  2YEL A;  4OGI A;  4BW1 A;  5DYX A;  5HRX A;  5E9I A;  5EWW A;  4NYV A;  4CUP A;  2RI7 A;  3SVF A;  5I83 A;  5C87 A;  5C8G A;  5D3T A;  4A9M A;  5E0R A;  4HXO A;  5FG6 A;  5HEL A;  5ENC A;  2RO1 A;  3IU6 A;  5COI A;  2D82 A;  3U5P A;  1JSP B;  4BW4 A;  3QZV A;  3UV2 A;  4IOQ A;  4TZ8 A;  4HXM A;  5HCL A;  5FG5 A;  5FE9 A;  3TLP A;  4MEO A;  4RVR A;  3LQH A;  5CQT A;  4ZC9 A;  5G4R A;  5F63 A;  2GRC A;  5CQ6 A;  5IGK A;  5LJ2 A;  5EWH A;  4J0R A;  2L84 A;  4O70 A;  4MR3 A;  2DWW A;  5KTW A;  5FH6 A;  5LKX A;  4UIU A;  5CUD A;  4NRB A;  4O7B A;  4QSQ A;  4QNS A;  4X2I A;  5DKH A;  4UIY A;  4QSP A;  5D3P A;  4CUQ A;  4NQN A;  4NR7 A;  5IID A;  4PKL A;  5E9Y A;  4NRC A;  4LYS A;  4XY8 A;  4YYG A;  5C4Q A;  4ZQL A;  4YAD A;  5DFC A;  5E9L A;  4UYF A;  4C67 A;  5IGM A;  2D9E A;  5TB6 A;  4Z1Q A;  3QZS A;  2I7K A;  5CQ7 A;  4IOO A;  4KV1 A;  4QSS A;  5AD2 A;  4ALH A;  3U5K A;  4O7C A;  3U5J A;  2OUO A;  2I8N A;  4O78 A;  5CQ4 A;  5F25 A;  4QYD A;  4TT4 A;  2OSS A;  1EQF A;  5CUB A;  5I80 A;  4A9I A;  4BJX A;  4NR9 A;  5LJ0 A;  3P1C A;  5ENE A;  4WHU A;  5AMF A;  4J3I A;  4HXR A;  4BHW A;  5HFQ A;  5CQ3 A;  4A9F A;  5C7N A;  4IR5 A;  4QST A;  5A7C A;  5A85 A;  5DLX A;  4MR4 A;  2NXB A;  5DYU A;  5ENJ A;  5FE6 A;  4QC1 A;  4UIW A;  5F60 A;  4J0S A;  4YYJ A;  5EV9 A;  3P1F A;  4ALG A;  5EP7 A;  4FLP A;  5CFW A;  4CUU A;  3U5N A;  5CPE A;  2WP2 A;  4LZS A;  5D3R A;  4UYE A;  2H60 A;  5ETD A;  4N4I A;  1WUM A;  3UV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...