3DWYA

Crystal structure of the bromodomain of human crebbp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
114
structure length
114
Chain Sequence
IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CREB-binding protein
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2008-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3dwyA00
3O33A 4BW4A 4QY4A 5F25A 4TT6A 4QUTA 5D3RA 4LZSA 4A9IA 5C7NA 4QNSA 3JVMA 5AMFA 5D3HA 4RVRA 5A85A 4LZRA 5EP7A 4IR4A 4NYWA 5II2A 2DATA 4UIYA 5TCMA 5F60A 4QSXA 5D3NA 4KV4A 5DYCA 4QEWA 5KO4A 3DAIA 2L85A 5CUGA 5H1TA 5A5NA 5FE0A 5CY9A 3P1CA 2DVQA 4KV1A 2YDWA 4UYHA 4QEVA 4UYEA 5G4RA 5CP5A 5FE4A 5DYAA 5ENFA 3UW9A 4UITA 5CUBA 3Q2EA 4YBSA 4A9HA 5LKUA 5BT4A 4Z6IA 4TZ2A 5CQ3A 4HXMA 5CQTA 5HRXA 2L5EA 4MR4A 4IORA 4NXJA 2LSPB 5FE5A 2L84A 4QBMA 5DKHA 4NRCA 2OO1A 2DVSA 5FBXA 4LRGA 4YBMA 4BJXA 3O36A 5H85A 4YYJA 5CU8A 4QR4A 5I29A 4NR8A 2RNXA 4TT2A 3UVWA 4Z1SA 5HQ7A 5EICA 5E0RA 4A9NA 5II1A 5I40A 3IU5A 4FLPA 5CQ7A 5FG4A 4QC1A 5E9KA 5CQ6A 4OGJA 4CFKA 2I8NA 3MB4A 5A5SA 5FH7A 5F3AA 1EQFA 5EV9A 4XUAA 4QSVA 4Z93A 5C87A 1F68A 4LZ2A 4N4IA 2GRCA 4HXSA 4YC9A 2D82A 4IR6A 5L96A 3D7CA 4ZQLA 5I80A 4YYGA 4QSTA 4CUUA 3G0LA 4LYSA 2H60A 2E7OA 4J0RA 1E6IA 2OSSA 2DVRA 2YQDA 3UV2A 4CURA 5CFWA 5CQAA 4YH3A 2YYNA 5A5RA 2NXBA 4NUCA 4TU6A 5EA1A 4A9FA 5AD2A 5BT3A 5A5PA 4YYKA 5CQ8A 5CUAA 5FE9A 1N72A 4QSQA 3HMEA 4NRBA 2E7NA 4MEQA 3MULA 4TS8A 4QYLA 5G4SA 4BHWA 3ONIA 4O74A 4YBTA 5FE1A 2YW5A 4YAXA 5FH6A 2WP1A 3LXJA 4J1PA 5LKTA 4O75A 5ENHA 3LQJA 5LKXA 4N3WA 2YEMA 3K2JA 3P5OA 4O78A 3MXFA 4O7CA 4UIUA 5ENJA 5A83A 5IBNA 5EU1A 4BW1A 2YEKA 5D26A 4YH4A 4CUPA 5FFWA 5J0DA 4MR6A 4ALHA 4HXLA 4NUDA 4IR5A 4J3IA 4YADA 5FDZA 5I88A 5IGNA 2KTBB 2YELA 4NR4A 5CZGA 4MENA 5E9LA 4N4GA 3RCWA 5E9YA 4A9EA 3SVHA 4OUFA 5L8UA 5EK9A 1JM4B 5ENIA 4YYMA 5DKDA 5D0CA 5KU3A 4PCIA 4QSRA 5D3LA 3GG3A 4QC3A 5A5OA 3U5PA 5FG6A 3S91A 3P1EA 5EWVA 5E73A 2R0YA 5HEMA 4YYDA 5TB6A 2R10A 5IGKA 5IGLA 5LVRA 5CPEA 4DONA 5FE3A 4F3IA 5CRMA 5D25A 4HXOA 3ZYUA 4CUSA 3QZVA 2DVVA 3O34A 5L8TA 5EPSA 4Z1QA 5H1UA 2RNYA 5FG5A 4QSWA 5KTWA 2FSAA 4LR6A 4Z6HA 4CFLA 5D3PA 5CQ5A 2MJVB 5EISA 5A5QA 4ZW1A 5L97A 4TTEA 4O7FA 4QR3A 3LQHA 4NQNA 5E9VA 4NUEA 4YY4A 3FKMX 4O7BA 4WHWA 2RS9B 5A82A 5LJ2A 4TQNA 4O7AA 5A7CA 5E3DA 2DKWA 2RNWA 4HXRA 4UIVA 5DFBA 5E9IA 4PKLA 4NR7A 5FFVA 1JSPB 5D3JA 4TYLA 4N4FA 4QSSA 4O71A 5E3GA 4GPJA 4QB3A 2D9EA 5F62A 3MB3A 3SVFA 4XUBA 5CUDA 5CUEA 5I7XA 4NYXA 4O77A 3O37A 5KHMA 4CUTA 2WP2A 3JVJA 4NS5A 5LVQA 2I7KA 5HELA 3HMHA 2R0SA 4QYDA 5FE8A 3P1DA 4Q0OA 4MEPA 5C4QA 4YYNA 2F6NA 4ALGA 5EPBA 4O70A 2OUOA 4TT4A 5IG6A 5I89A 4YYIA 4LYIA 5EWHA 4XY9A 4QZSA 5F2PA 4YABA 4WHUA 5HQ5A 5L99A 5HCLA 5LKZA 5FB1A 4O76A 5FE6A 4WIVA 5ENCA 5KTXA 5D3TA 5DFCA 5CGPA 5FB0A 5DYUA 4TU4A 4A9LA 4A9OA 5HJCA 4N4HA 4MR5A 4YY6A 3UVDA 3JVKA 5C8GA 1WUMA 3SVGA 3UV5A 4UYFA 3UVYA 4PS5A 5ENEA 5IIDA 5BT5A 2DWWA 4MEOA 4HXKA 3O35A 4LYWA 2R0VA 4NYVA 3U5LA 3AQAA 4CUQA 4HBVA 3U5MA 5EGUA 5AD3A 5IGMA 5ENBA 5EM3A 4QR5A 5H1VA 2RFJA 5DW1A 5CTLA 5DFDA 5EWWA 4NRAA 5ETDA 4YK0A 4X2IA 3DWYA 3TLPA 4NQMA 5CRZA 4QUUA 5CS8A 4ZC9A 5DLZA 5JI8A 3HMFA 3JVLA 5COIA 5F5ZA 4HXNA 4O72A 4Y03A 5EWDA 4O7EA 5EWCA 4UYDA 5E7DA 4E96A 5LJ1A 4XY8A 4C66A 4C67A 5LJ0A 5F36A 5ACYA 5L98A 3UVXA 3MUKA 4LC2A 4NR9A 5FFYA 4A9MA 3LQIA 3S92A 4HBYA 5I86A 4KCXA 5DY7A 4BW2A 4NR5A 5HQ6A 4HBWA 5DLXA 5I1QA 4PY6A 5LUUA 2RI7A 4UIXA 5HRWA 3IU6A 5DBMA 5EPRA 5DX4A 4BW3A 4MR3A 4CL9A 1X0JA 5E9MA 1WUGA 5D24A 4UYGA 5KTUA 3QZSA 5CQ4A 5D3SA 2E3KA 2N9GA 4OGIA 4UYFB 5ENGA 4A9JA 5F63A 5HENA 5HRVA 4QSUA 4CLBA 5FH8A 3AADA 5EVAA 4HXPA 5DW2A 3U5OA 3NXBA 4XYAA 3UV4A 3MQMA 4HBXA 4YATA 3U5JA 3QZTA 4UIZA 4UIWA 5JWMA 4QSPA 3LJWA 5K29A 2RO1A 5ETBA 5FE2A 3U5KA 5CUCA 3P1FA 5EQ1A 5AMEA 3Q2FA 4LDFA 5C85A 4PCEA 4IR3A 4AKNA 2F6JA 4IOQA 5A81A 4TZ8A 3U5NA 5DYXA 5DKCA 2G4AA 3G0JA 4IOOA 4YYHA 4NR6A 5HLSA 5HM0A 5F1HA 4Q0NA 1ZS5A 5E74A 5EI4A 5F61A 3I3JA 4QEUA 5I7YA 5HFRA 5FE7A 5C89A 4A9KA 5I83A 5HFQA 4PTBA 4J0SA 5D7XA 5F1LA
chains in the Genus database with same CATH superfamily
3O33A 4BW4A 4QY4A 3D1BA 5F25A 4TT6A 4QUTA 5D3RA 4LZSA 4A9IA 5C7NA 4QNSA 3JVMA 5AMFA 5D3HA 4RVRA 5A85A 4LZRA 5EP7A 4IR4A 4NYWA 5II2A 2DATA 4UIYA 5TCMA 3D1DA 5F60A 4QSXA 5D3NA 4KV4A 5DYCA 4QEWA 5KO4A 3DAIA 2L85A 5CUGA 5H1TA 5A5NA 5FE0A 5CY9A 3P1CA 2DVQA 4KV1A 2YDWA 4UYHA 4QEVA 4UYEA 5G4RA 5CP5A 5FE4A 5DYAA 5ENFA 3UW9A 4UITA 5CUBA 3Q2EA 4YBSA 4A9HA 5LKUA 5BT4A 4Z6IA 4TZ2A 5CQ3A 4HXMA 5CQTA 5HRXA 2L5EA 4MR4A 4IORA 4NXJA 2LSPB 2EJNA 4AI6A 5FE5A 2L84A 4AKIA 4QBMA 5DKHA 4NRCA 2OO1A 2DVSA 5FBXA 4LRGA 4YBMA 4BJXA 3O36A 5H85A 4YYJA 5CU8A 4QR4A 5I29A 4NR8A 2RNXA 4TT2A 3UVWA 4Z1SA 5HQ7A 5EICA 5E0RA 4A9NA 5II1A 5I40A 3IU5A 4FLPA 5CQ7A 5FG4A 4QC1A 5E9KA 5CQ6A 4OGJA 4CFKA 2I8NA 3MB4A 5A5SA 5FH7A 5F3AA 1EQFA 5EV9A 4XUAA 4QSVA 4Z93A 5C87A 1F68A 4LZ2A 4N4IA 2GRCA 4HXSA 4YC9A 2D82A 4IR6A 5L96A 3D7CA 4ZQLA 5I80A 4YYGA 4QSTA 4CUUA 3G0LA 4LYSA 2H60A 2E7OA 4J0RA 1E6IA 1PUOA 2OSSA 2DVRA 2YQDA 3UV2A 4CURA 5CFWA 5CQAA 4YH3A 2YYNA 5A5RA 2NXBA 4NUCA 4TU6A 5EA1A 4A9FA 5AD2A 5BT3A 5A5PA 4YYKA 5CQ8A 5CUAA 5FE9A 1N72A 4QSQA 3HMEA 4NRBA 2E7NA 4MEQA 3MULA 4TS8A 4QYLA 5G4SA 4BHWA 3ONIA 4O74A 4YBTA 5FE1A 2YW5A 4YAXA 5FH6A 2WP1A 3LXJA 4J1PA 5LKTA 4O75A 5ENHA 3LQJA 5LKXA 4N3WA 2YEMA 3K2JA 3P5OA 4O78A 3MXFA 4O7CA 4UIUA 5ENJA 5A83A 5IBNA 5EU1A 4BW1A 2YEKA 5D26A 4YH4A 4CUPA 5FFWA 5J0DA 4MR6A 4ALHA 4HXLA 4NUDA 4IR5A 4J3IA 4YADA 5FDZA 5I88A 5IGNA 2KTBB 2YELA 4NR4A 5CZGA 4MENA 5E9LA 4N4GA 3RCWA 5E9YA 4A9EA 3SVHA 4OUFA 5L8UA 5EK9A 1JM4B 5ENIA 4YYMA 5DKDA 5D0CA 5KU3A 4PCIA 4QSRA 5D3LA 3GG3A 4QC3A 5A5OA 3U5PA 5FG6A 3S91A 3P1EA 5EWVA 5E73A 2R0YA 5HEMA 4YYDA 5TB6A 2R10A 5IGKA 5IGLA 5LVRA 5CPEA 4DONA 5FE3A 4F3IA 5CRMA 5D25A 4HXOA 3ZYUA 4CUSA 3QZVA 2DVVA 3O34A 5L8TA 5EPSA 4Z1QA 5H1UA 2RNYA 5FG5A 4QSWA 5KTWA 2FSAA 4LR6A 4Z6HA 4CFLA 5D3PA 5CQ5A 2MJVB 5EISA 5A5QA 4ZW1A 5L97A 4TTEA 4O7FA 4QR3A 4AKHA 3LQHA 4NQNA 5E9VA 4NUEA 3ERRA 4YY4A 3FKMX 4O7BA 4WHWA 2RS9B 5A82A 5LJ2A 4TQNA 4O7AA 5A7CA 5E3DA 2DKWA 2RNWA 4HXRA 4UIVA 5DFBA 5E9IA 4PKLA 4NR7A 5FFVA 1JSPB 5D3JA 4TYLA 4N4FA 4QSSA 4O71A 5E3GA 4GPJA 4QB3A 2D9EA 5F62A 3MB3A 3SVFA 4XUBA 5CUDA 5CUEA 5I7XA 4NYXA 4O77A 3O37A 5KHMA 4CUTA 2WP2A 3JVJA 4NS5A 5LVQA 2I7KA 5HELA 3HMHA 2R0SA 4QYDA 5FE8A 3P1DA 4Q0OA 4MEPA 5C4QA 4YYNA 2F6NA 4ALGA 5EPBA 4O70A 2OUOA 4TT4A 5IG6A 5I89A 4YYIA 4LYIA 5EWHA 4XY9A 4QZSA 5F2PA 4YABA 4WHUA 5HQ5A 5L99A 5HCLA 5LKZA 3VKGA 5FB1A 4O76A 5FE6A 4WIVA 5ENCA 5KTXA 5D3TA 5DFCA 5CGPA 5FB0A 5DYUA 4TU4A 4A9LA 4A9OA 5HJCA 4N4HA 4MR5A 4YY6A 3UVDA 3JVKA 5C8GA 1WUMA 3SVGA 3UV5A 4UYFA 3UVYA 4PS5A 5ENEA 5IIDA 5BT5A 2DWWA 4MEOA 4HXKA 3O35A 4LYWA 2R0VA 4NYVA 3U5LA 3AQAA 4CUQA 4HBVA 3U5MA 5EGUA 5AD3A 5IGMA 5ENBA 5EM3A 4QR5A 5H1VA 2RFJA 5DW1A 5CTLA 5DFDA 5EWWA 4NRAA 5ETDA 4YK0A 4X2IA 3DWYA 3TLPA 4NQMA 5CRZA 4QUUA 5CS8A 4ZC9A 5DLZA 5JI8A 3HMFA 3JVLA 5COIA 5F5ZA 4HXNA 4O72A 4Y03A 5EWDA 4O7EA 5EWCA 4UYDA 5E7DA 4E96A 5LJ1A 4XY8A 4C66A 4C67A 5LJ0A 5F36A 5ACYA 5L98A 3UVXA 3MUKA 4LC2A 4NR9A 5FFYA 4A9MA 3LQIA 3S92A 4HBYA 5I86A 4KCXA 5DY7A 4BW2A 4NR5A 5HQ6A 4HBWA 5DLXA 5I1QA 4PY6A 5LUUA 2RI7A 4UIXA 5HRWA 3IU6A 5DBMA 5EPRA 5DX4A 4BW3A 4MR3A 4CL9A 1X0JA 5E9MA 1ZKRA 3VKHA 1WUGA 5D24A 4UYGA 5KTUA 3QZSA 5CQ4A 5D3SA 2E3KA 2N9GA 4OGIA 4UYFB 5ENGA 4A9JA 5F63A 5HENA 5HRVA 4QSUA 4CLBA 5FH8A 3AADA 5EVAA 4HXPA 5DW2A 3U5OA 3NXBA 4XYAA 3UV4A 3MQMA 4HBXA 4YATA 3U5JA 3QZTA 4UIZA 4UIWA 5JWMA 4QSPA 3LJWA 5K29A 2RO1A 5ETBA 5FE2A 3U5KA 5CUCA 3P1FA 5EQ1A 5AMEA 3Q2FA 4LDFA 5C85A 4PCEA 4IR3A 4AKNA 2F6JA 4IOQA 5A81A 4TZ8A 3U5NA 5DYXA 5DKCA 2G4AA 3G0JA 4AKGA 4IOOA 4YYHA 4NR6A 5HLSA 5HM0A 5F1HA 4Q0NA 1ZS5A 5E74A 5EI4A 5F61A 3I3JA 4QEUA 5I7YA 5HFRA 5FE7A 5C89A 4A9KA 5I83A 5HFQA 4PTBA 4J0SA 5D7XA 5F1LA
chains in the Genus database with same CATH topology
3O33A 4BW4A 4QY4A 5F25A 4TT6A 4QUTA 5D3RA 4LZSA 4A9IA 5C7NA 4QNSA 3JVMA 5AMFA 5D3HA 4RVRA 5A85A 4LZRA 5EP7A 4IR4A 4NYWA 5II2A 2DATA 4UIYA 5TCMA 5F60A 4QSXA 5D3NA 4KV4A 5DYCA 4QEWA 5KO4A 3DAIA 2L85A 5CUGA 5H1TA 5A5NA 5FE0A 5CY9A 3P1CA 2DVQA 4KV1A 2YDWA 4UYHA 4QEVA 4UYEA 5G4RA 5CP5A 5FE4A 5DYAA 5ENFA 3UW9A 4UITA 5CUBA 3Q2EA 4YBSA 4A9HA 5LKUA 5BT4A 4Z6IA 4TZ2A 5CQ3A 4HXMA 5CQTA 5HRXA 2L5EA 4MR4A 4IORA 4NXJA 2LSPB 5FE5A 2L84A 4QBMA 5DKHA 4NRCA 2OO1A 2DVSA 5FBXA 4LRGA 4YBMA 4BJXA 3O36A 5H85A 4YYJA 5CU8A 4QR4A 5I29A 4NR8A 2RNXA 4TT2A 3UVWA 4Z1SA 5HQ7A 5EICA 5E0RA 4A9NA 5II1A 5I40A 3IU5A 4FLPA 5CQ7A 5FG4A 4QC1A 5E9KA 5CQ6A 4OGJA 4CFKA 2I8NA 3MB4A 5A5SA 5FH7A 5F3AA 1EQFA 5EV9A 4XUAA 4QSVA 4Z93A 5C87A 1F68A 4LZ2A 4N4IA 2GRCA 4HXSA 4YC9A 2D82A 4IR6A 5L96A 3D7CA 4ZQLA 5I80A 4YYGA 4QSTA 4CUUA 3G0LA 4LYSA 2H60A 2E7OA 4J0RA 1E6IA 2OSSA 2DVRA 2YQDA 3UV2A 4CURA 5CFWA 5CQAA 4YH3A 2YYNA 5A5RA 2NXBA 4NUCA 4TU6A 5EA1A 4A9FA 5AD2A 5BT3A 5A5PA 4YYKA 5CQ8A 5CUAA 5FE9A 1N72A 4QSQA 3HMEA 4NRBA 2E7NA 4MEQA 3MULA 4TS8A 4QYLA 5G4SA 4BHWA 3ONIA 4O74A 4YBTA 5FE1A 2YW5A 4YAXA 5FH6A 2WP1A 3LXJA 4J1PA 5LKTA 4O75A 5ENHA 3LQJA 5LKXA 4N3WA 2YEMA 3K2JA 3P5OA 4O78A 3MXFA 4O7CA 4UIUA 5ENJA 5A83A 5IBNA 5EU1A 4BW1A 2YEKA 5D26A 4YH4A 4CUPA 5FFWA 5J0DA 4MR6A 4ALHA 4HXLA 4NUDA 4IR5A 4J3IA 4YADA 5FDZA 5I88A 5IGNA 2KTBB 2YELA 4NR4A 5CZGA 4MENA 5E9LA 4N4GA 3RCWA 5E9YA 4A9EA 3SVHA 4OUFA 5L8UA 5EK9A 1JM4B 5ENIA 4YYMA 5DKDA 5D0CA 5KU3A 4PCIA 4QSRA 5D3LA 3GG3A 4QC3A 5A5OA 3U5PA 5FG6A 3S91A 3P1EA 5EWVA 5E73A 2R0YA 5HEMA 4YYDA 5TB6A 2R10A 5IGKA 5IGLA 5LVRA 5CPEA 4DONA 5FE3A 4F3IA 5CRMA 5D25A 4HXOA 3ZYUA 4CUSA 3QZVA 2DVVA 3O34A 5L8TA 5EPSA 4Z1QA 5H1UA 2RNYA 5FG5A 4QSWA 5KTWA 2FSAA 4LR6A 4Z6HA 4CFLA 5D3PA 5CQ5A 2MJVB 5EISA 5A5QA 4ZW1A 5L97A 4TTEA 4O7FA 4QR3A 3LQHA 4NQNA 5E9VA 4NUEA 4YY4A 3FKMX 4O7BA 4WHWA 2RS9B 5A82A 5LJ2A 4TQNA 4O7AA 5A7CA 5E3DA 2DKWA 2RNWA 4HXRA 4UIVA 5DFBA 5E9IA 4PKLA 4NR7A 5FFVA 1JSPB 5D3JA 4TYLA 4N4FA 4QSSA 4O71A 5E3GA 4GPJA 4QB3A 2D9EA 5F62A 3MB3A 3SVFA 4XUBA 5CUDA 5CUEA 5I7XA 4NYXA 4O77A 3O37A 5KHMA 4CUTA 2WP2A 3JVJA 4NS5A 5LVQA 2I7KA 5HELA 3HMHA 2R0SA 4QYDA 5FE8A 3P1DA 4Q0OA 4MEPA 5C4QA 4YYNA 2F6NA 4ALGA 5EPBA 4O70A 2OUOA 4TT4A 5IG6A 5I89A 4YYIA 4LYIA 5EWHA 4XY9A 4QZSA 5F2PA 4YABA 4WHUA 5HQ5A 5L99A 5HCLA 5LKZA 5FB1A 4O76A 5FE6A 4WIVA 5ENCA 5KTXA 5D3TA 5DFCA 5CGPA 5FB0A 5DYUA 4TU4A 4A9LA 4A9OA 5HJCA 4N4HA 4MR5A 4YY6A 3UVDA 3JVKA 5C8GA 1WUMA 3SVGA 3UV5A 4UYFA 3UVYA 4PS5A 5ENEA 5IIDA 5BT5A 2DWWA 4MEOA 4HXKA 3O35A 4LYWA 2R0VA 4NYVA 3U5LA 3AQAA 4CUQA 4HBVA 3U5MA 5EGUA 5AD3A 5IGMA 5ENBA 5EM3A 4QR5A 5H1VA 2RFJA 5DW1A 5CTLA 5DFDA 5EWWA 4NRAA 5ETDA 4YK0A 4X2IA 3DWYA 3TLPA 4NQMA 5CRZA 4QUUA 5CS8A 4ZC9A 5DLZA 5JI8A 3HMFA 3JVLA 5COIA 5F5ZA 4HXNA 4O72A 4Y03A 5EWDA 4O7EA 5EWCA 4UYDA 5E7DA 4E96A 5LJ1A 4XY8A 4C66A 4C67A 5LJ0A 5F36A 5ACYA 5L98A 3UVXA 3MUKA 4LC2A 4NR9A 5FFYA 4A9MA 3LQIA 3S92A 4HBYA 5I86A 4KCXA 5DY7A 4BW2A 4NR5A 5HQ6A 4HBWA 5DLXA 5I1QA 4PY6A 5LUUA 2RI7A 4UIXA 5HRWA 3IU6A 5DBMA 5EPRA 5DX4A 4BW3A 4MR3A 4CL9A 1X0JA 5E9MA 1WUGA 5D24A 4UYGA 5KTUA 3QZSA 5CQ4A 5D3SA 2E3KA 2N9GA 4OGIA 4UYFB 5ENGA 4A9JA 5F63A 5HENA 5HRVA 4QSUA 4CLBA 5FH8A 3AADA 5EVAA 4HXPA 5DW2A 3U5OA 3NXBA 4XYAA 3UV4A 3MQMA 4HBXA 4YATA 3U5JA 3QZTA 4UIZA 4UIWA 5JWMA 4QSPA 3LJWA 5K29A 2RO1A 5ETBA 5FE2A 3U5KA 5CUCA 3P1FA 5EQ1A 5AMEA 3Q2FA 4LDFA 5C85A 4PCEA 4IR3A 4AKNA 2F6JA 4IOQA 5A81A 4TZ8A 3U5NA 5DYXA 5DKCA 2G4AA 3G0JA 4IOOA 4YYHA 4NR6A 5HLSA 5HM0A 5F1HA 4Q0NA 1ZS5A 5E74A 5EI4A 5F61A 3I3JA 4QEUA 5I7YA 5HFRA 5FE7A 5C89A 4A9KA 5I83A 5HFQA 4PTBA 4J0SA 5D7XA 5F1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O33 A;  4BW4 A;  4QY4 A;  5F25 A;  4TT6 A;  4QUT A;  5D3R A;  4LZS A;  4A9I A;  5C7N A;  4QNS A;  3JVM A;  5AMF A;  5D3H A;  4RVR A;  5A85 A;  4LZR A;  5EP7 A;  4IR4 A;  4NYW A;  5II2 A;  2DAT A;  4UIY A;  5TCM A;  5F60 A;  4QSX A;  5D3N A;  4KV4 A;  5DYC A;  4QEW A;  5KO4 A;  3DAI A;  2L85 A;  5CUG A;  5H1T A;  5A5N A;  5FE0 A;  5CY9 A;  3P1C A;  2DVQ A;  4KV1 A;  2YDW A;  4UYH A;  4QEV A;  4UYE A;  5G4R A;  5CP5 A;  5FE4 A;  5DYA A;  5ENF A;  3UW9 A;  4UIT A;  5CUB A;  3Q2E A;  4YBS A;  4A9H A;  5LKU A;  5BT4 A;  4Z6I A;  4TZ2 A;  5CQ3 A;  4HXM A;  5CQT A;  5HRX A;  2L5E A;  4MR4 A;  4IOR A;  4NXJ A;  2LSP B;  5FE5 A;  2L84 A;  4QBM A;  5DKH A;  4NRC A;  2OO1 A;  2DVS A;  5FBX A;  4LRG A;  4YBM A;  4BJX A;  3O36 A;  5H85 A;  4YYJ A;  5CU8 A;  4QR4 A;  5I29 A;  4NR8 A;  2RNX A;  4TT2 A;  3UVW A;  4Z1S A;  5HQ7 A;  5EIC A;  5E0R A;  4A9N A;  5II1 A;  5I40 A;  3IU5 A;  4FLP A;  5CQ7 A;  5FG4 A;  4QC1 A;  5E9K A;  5CQ6 A;  4OGJ A;  4CFK A;  2I8N A;  3MB4 A;  5A5S A;  5FH7 A;  5F3A A;  1EQF A;  5EV9 A;  4XUA A;  4QSV A;  4Z93 A;  5C87 A;  1F68 A;  4LZ2 A;  4N4I A;  2GRC A;  4HXS A;  4YC9 A;  2D82 A;  4IR6 A;  5L96 A;  3D7C A;  4ZQL A;  5I80 A;  4YYG A;  4QST A;  4CUU A;  3G0L A;  4LYS A;  2H60 A;  2E7O A;  4J0R A;  1E6I A;  2OSS A;  2DVR A;  2YQD A;  3UV2 A;  4CUR A;  5CFW A;  5CQA A;  4YH3 A;  2YYN A;  5A5R A;  2NXB A;  4NUC A;  4TU6 A;  5EA1 A;  4A9F A;  5AD2 A;  5BT3 A;  5A5P A;  4YYK A;  5CQ8 A;  5CUA A;  5FE9 A;  1N72 A;  4QSQ A;  3HME A;  4NRB A;  2E7N A;  4MEQ A;  3MUL A;  4TS8 A;  4QYL A;  5G4S A;  4BHW A;  3ONI A;  4O74 A;  4YBT A;  5FE1 A;  2YW5 A;  4YAX A;  5FH6 A;  2WP1 A;  3LXJ A;  4J1P A;  5LKT A;  4O75 A;  5ENH A;  3LQJ A;  5LKX A;  4N3W A;  2YEM A;  3K2J A;  3P5O A;  4O78 A;  3MXF A;  4O7C A;  4UIU A;  5ENJ A;  5A83 A;  5IBN A;  5EU1 A;  4BW1 A;  2YEK A;  5D26 A;  4YH4 A;  4CUP A;  5FFW A;  5J0D A;  4MR6 A;  4ALH A;  4HXL A;  4NUD A;  4IR5 A;  4J3I A;  4YAD A;  5FDZ A;  5I88 A;  5IGN A;  2KTB B;  2YEL A;  4NR4 A;  5CZG A;  4MEN A;  5E9L A;  4N4G A;  3RCW A;  5E9Y A;  4A9E A;  3SVH A;  4OUF A;  5L8U A;  5EK9 A;  1JM4 B;  5ENI A;  4YYM A;  5DKD A;  5D0C A;  5KU3 A;  4PCI A;  4QSR A;  5D3L A;  3GG3 A;  4QC3 A;  5A5O A;  3U5P A;  5FG6 A;  3S91 A;  3P1E A;  5EWV A;  5E73 A;  2R0Y A;  5HEM A;  4YYD A;  5TB6 A;  2R10 A;  5IGK A;  5IGL A;  5LVR A;  5CPE A;  4DON A;  5FE3 A;  4F3I A;  5CRM A;  5D25 A;  4HXO A;  3ZYU A;  4CUS A;  3QZV A;  2DVV A;  3O34 A;  5L8T A;  5EPS A;  4Z1Q A;  5H1U A;  2RNY A;  5FG5 A;  4QSW A;  5KTW A;  2FSA A;  4LR6 A;  4Z6H A;  4CFL A;  5D3P A;  5CQ5 A;  2MJV B;  5EIS A;  5A5Q A;  4ZW1 A;  5L97 A;  4TTE A;  4O7F A;  4QR3 A;  3LQH A;  4NQN A;  5E9V A;  4NUE A;  4YY4 A;  3FKM X;  4O7B A;  4WHW A;  2RS9 B;  5A82 A;  5LJ2 A;  4TQN A;  4O7A A;  5A7C A;  5E3D A;  2DKW A;  2RNW A;  4HXR A;  4UIV A;  5DFB A;  5E9I A;  4PKL A;  4NR7 A;  5FFV A;  1JSP B;  5D3J A;  4TYL A;  4N4F A;  4QSS A;  4O71 A;  5E3G A;  4GPJ A;  4QB3 A;  2D9E A;  5F62 A;  3MB3 A;  3SVF A;  4XUB A;  5CUD A;  5CUE A;  5I7X A;  4NYX A;  4O77 A;  3O37 A;  5KHM A;  4CUT A;  2WP2 A;  3JVJ A;  4NS5 A;  5LVQ A;  2I7K A;  5HEL A;  3HMH A;  2R0S A;  4QYD A;  5FE8 A;  3P1D A;  4Q0O A;  4MEP A;  5C4Q A;  4YYN A;  2F6N A;  4ALG A;  5EPB A;  4O70 A;  2OUO A;  4TT4 A;  5IG6 A;  5I89 A;  4YYI A;  4LYI A;  5EWH A;  4XY9 A;  4QZS A;  5F2P A;  4YAB A;  4WHU A;  5HQ5 A;  5L99 A;  5HCL A;  5LKZ A;  5FB1 A;  4O76 A;  5FE6 A;  4WIV A;  5ENC A;  5KTX A;  5D3T A;  5DFC A;  5CGP A;  5FB0 A;  5DYU A;  4TU4 A;  4A9L A;  4A9O A;  5HJC A;  4N4H A;  4MR5 A;  4YY6 A;  3UVD A;  3JVK A;  5C8G A;  1WUM A;  3SVG A;  3UV5 A;  4UYF A;  3UVY A;  4PS5 A;  5ENE A;  5IID A;  5BT5 A;  2DWW A;  4MEO A;  4HXK A;  3O35 A;  4LYW A;  2R0V A;  4NYV A;  3U5L A;  3AQA A;  4CUQ A;  4HBV A;  3U5M A;  5EGU A;  5AD3 A;  5IGM A;  5ENB A;  5EM3 A;  4QR5 A;  5H1V A;  2RFJ A;  5DW1 A;  5CTL A;  5DFD A;  5EWW A;  4NRA A;  5ETD A;  4YK0 A;  4X2I A;  3DWY A;  3TLP A;  4NQM A;  5CRZ A;  4QUU A;  5CS8 A;  4ZC9 A;  5DLZ A;  5JI8 A;  3HMF A;  3JVL A;  5COI A;  5F5Z A;  4HXN A;  4O72 A;  4Y03 A;  5EWD A;  4O7E A;  5EWC A;  4UYD A;  5E7D A;  4E96 A;  5LJ1 A;  4XY8 A;  4C66 A;  4C67 A;  5LJ0 A;  5F36 A;  5ACY A;  5L98 A;  3UVX A;  3MUK A;  4LC2 A;  4NR9 A;  5FFY A;  4A9M A;  3LQI A;  3S92 A;  4HBY A;  5I86 A;  4KCX A;  5DY7 A;  4BW2 A;  4NR5 A;  5HQ6 A;  4HBW A;  5DLX A;  5I1Q A;  4PY6 A;  5LUU A;  2RI7 A;  4UIX A;  5HRW A;  3IU6 A;  5DBM A;  5EPR A;  5DX4 A;  4BW3 A;  4MR3 A;  4CL9 A;  1X0J A;  5E9M A;  1WUG A;  5D24 A;  4UYG A;  5KTU A;  3QZS A;  5CQ4 A;  5D3S A;  2E3K A;  2N9G A;  4OGI A;  4UYF B;  5ENG A;  4A9J A;  5F63 A;  5HEN A;  5HRV A;  4QSU A;  4CLB A;  5FH8 A;  3AAD A;  5EVA A;  4HXP A;  5DW2 A;  3U5O A;  3NXB A;  4XYA A;  3UV4 A;  3MQM A;  4HBX A;  4YAT A;  3U5J A;  3QZT A;  4UIZ A;  4UIW A;  5JWM A;  4QSP A;  3LJW A;  5K29 A;  2RO1 A;  5ETB A;  5FE2 A;  3U5K A;  5CUC A;  3P1F A;  5EQ1 A;  5AME A;  3Q2F A;  4LDF A;  5C85 A;  4PCE A;  4IR3 A;  4AKN A;  2F6J A;  4IOQ A;  5A81 A;  4TZ8 A;  3U5N A;  5DYX A;  5DKC A;  2G4A A;  3G0J A;  4IOO A;  4YYH A;  4NR6 A;  5HLS A;  5HM0 A;  5F1H A;  4Q0N A;  1ZS5 A;  5E74 A;  5EI4 A;  5F61 A;  3I3J A;  4QEU A;  5I7Y A;  5HFR A;  5FE7 A;  5C89 A;  4A9K A;  5I83 A;  5HFQ A;  4PTB A;  4J0S A;  5D7X A;  5F1L A; 
#chains in the Genus database with same CATH topology
 3O33 A;  4BW4 A;  4QY4 A;  3D1B A;  5F25 A;  4TT6 A;  4QUT A;  5D3R A;  4LZS A;  4A9I A;  5C7N A;  4QNS A;  3JVM A;  5AMF A;  5D3H A;  4RVR A;  5A85 A;  4LZR A;  5EP7 A;  4IR4 A;  4NYW A;  5II2 A;  2DAT A;  4UIY A;  5TCM A;  3D1D A;  5F60 A;  4QSX A;  5D3N A;  4KV4 A;  5DYC A;  4QEW A;  5KO4 A;  3DAI A;  2L85 A;  5CUG A;  5H1T A;  5A5N A;  5FE0 A;  5CY9 A;  3P1C A;  2DVQ A;  4KV1 A;  2YDW A;  4UYH A;  4QEV A;  4UYE A;  5G4R A;  5CP5 A;  5FE4 A;  5DYA A;  5ENF A;  3UW9 A;  4UIT A;  5CUB A;  3Q2E A;  4YBS A;  4A9H A;  5LKU A;  5BT4 A;  4Z6I A;  4TZ2 A;  5CQ3 A;  4HXM A;  5CQT A;  5HRX A;  2L5E A;  4MR4 A;  4IOR A;  4NXJ A;  2LSP B;  2EJN A;  4AI6 A;  5FE5 A;  2L84 A;  4AKI A;  4QBM A;  5DKH A;  4NRC A;  2OO1 A;  2DVS A;  5FBX A;  4LRG A;  4YBM A;  4BJX A;  3O36 A;  5H85 A;  4YYJ A;  5CU8 A;  4QR4 A;  5I29 A;  4NR8 A;  2RNX A;  4TT2 A;  3UVW A;  4Z1S A;  5HQ7 A;  5EIC A;  5E0R A;  4A9N A;  5II1 A;  5I40 A;  3IU5 A;  4FLP A;  5CQ7 A;  5FG4 A;  4QC1 A;  5E9K A;  5CQ6 A;  4OGJ A;  4CFK A;  2I8N A;  3MB4 A;  5A5S A;  5FH7 A;  5F3A A;  1EQF A;  5EV9 A;  4XUA A;  4QSV A;  4Z93 A;  5C87 A;  1F68 A;  4LZ2 A;  4N4I A;  2GRC A;  4HXS A;  4YC9 A;  2D82 A;  4IR6 A;  5L96 A;  3D7C A;  4ZQL A;  5I80 A;  4YYG A;  4QST A;  4CUU A;  3G0L A;  4LYS A;  2H60 A;  2E7O A;  4J0R A;  1E6I A;  1PUO A;  2OSS A;  2DVR A;  2YQD A;  3UV2 A;  4CUR A;  5CFW A;  5CQA A;  4YH3 A;  2YYN A;  5A5R A;  2NXB A;  4NUC A;  4TU6 A;  5EA1 A;  4A9F A;  5AD2 A;  5BT3 A;  5A5P A;  4YYK A;  5CQ8 A;  5CUA A;  5FE9 A;  1N72 A;  4QSQ A;  3HME A;  4NRB A;  2E7N A;  4MEQ A;  3MUL A;  4TS8 A;  4QYL A;  5G4S A;  4BHW A;  3ONI A;  4O74 A;  4YBT A;  5FE1 A;  2YW5 A;  4YAX A;  5FH6 A;  2WP1 A;  3LXJ A;  4J1P A;  5LKT A;  4O75 A;  5ENH A;  3LQJ A;  5LKX A;  4N3W A;  2YEM A;  3K2J A;  3P5O A;  4O78 A;  3MXF A;  4O7C A;  4UIU A;  5ENJ A;  5A83 A;  5IBN A;  5EU1 A;  4BW1 A;  2YEK A;  5D26 A;  4YH4 A;  4CUP A;  5FFW A;  5J0D A;  4MR6 A;  4ALH A;  4HXL A;  4NUD A;  4IR5 A;  4J3I A;  4YAD A;  5FDZ A;  5I88 A;  5IGN A;  2KTB B;  2YEL A;  4NR4 A;  5CZG A;  4MEN A;  5E9L A;  4N4G A;  3RCW A;  5E9Y A;  4A9E A;  3SVH A;  4OUF A;  5L8U A;  5EK9 A;  1JM4 B;  5ENI A;  4YYM A;  5DKD A;  5D0C A;  5KU3 A;  4PCI A;  4QSR A;  5D3L A;  3GG3 A;  4QC3 A;  5A5O A;  3U5P A;  5FG6 A;  3S91 A;  3P1E A;  5EWV A;  5E73 A;  2R0Y A;  5HEM A;  4YYD A;  5TB6 A;  2R10 A;  5IGK A;  5IGL A;  5LVR A;  5CPE A;  4DON A;  5FE3 A;  4F3I A;  5CRM A;  5D25 A;  4HXO A;  3ZYU A;  4CUS A;  3QZV A;  2DVV A;  3O34 A;  5L8T A;  5EPS A;  4Z1Q A;  5H1U A;  2RNY A;  5FG5 A;  4QSW A;  5KTW A;  2FSA A;  4LR6 A;  4Z6H A;  4CFL A;  5D3P A;  5CQ5 A;  2MJV B;  5EIS A;  5A5Q A;  4ZW1 A;  5L97 A;  4TTE A;  4O7F A;  4QR3 A;  4AKH A;  3LQH A;  4NQN A;  5E9V A;  4NUE A;  3ERR A;  4YY4 A;  3FKM X;  4O7B A;  4WHW A;  2RS9 B;  5A82 A;  5LJ2 A;  4TQN A;  4O7A A;  5A7C A;  5E3D A;  2DKW A;  2RNW A;  4HXR A;  4UIV A;  5DFB A;  5E9I A;  4PKL A;  4NR7 A;  5FFV A;  1JSP B;  5D3J A;  4TYL A;  4N4F A;  4QSS A;  4O71 A;  5E3G A;  4GPJ A;  4QB3 A;  2D9E A;  5F62 A;  3MB3 A;  3SVF A;  4XUB A;  5CUD A;  5CUE A;  5I7X A;  4NYX A;  4O77 A;  3O37 A;  5KHM A;  4CUT A;  2WP2 A;  3JVJ A;  4NS5 A;  5LVQ A;  2I7K A;  5HEL A;  3HMH A;  2R0S A;  4QYD A;  5FE8 A;  3P1D A;  4Q0O A;  4MEP A;  5C4Q A;  4YYN A;  2F6N A;  4ALG A;  5EPB A;  4O70 A;  2OUO A;  4TT4 A;  5IG6 A;  5I89 A;  4YYI A;  4LYI A;  5EWH A;  4XY9 A;  4QZS A;  5F2P A;  4YAB A;  4WHU A;  5HQ5 A;  5L99 A;  5HCL A;  5LKZ A;  3VKG A;  5FB1 A;  4O76 A;  5FE6 A;  4WIV A;  5ENC A;  5KTX A;  5D3T A;  5DFC A;  5CGP A;  5FB0 A;  5DYU A;  4TU4 A;  4A9L A;  4A9O A;  5HJC A;  4N4H A;  4MR5 A;  4YY6 A;  3UVD A;  3JVK A;  5C8G A;  1WUM A;  3SVG A;  3UV5 A;  4UYF A;  3UVY A;  4PS5 A;  5ENE A;  5IID A;  5BT5 A;  2DWW A;  4MEO A;  4HXK A;  3O35 A;  4LYW A;  2R0V A;  4NYV A;  3U5L A;  3AQA A;  4CUQ A;  4HBV A;  3U5M A;  5EGU A;  5AD3 A;  5IGM A;  5ENB A;  5EM3 A;  4QR5 A;  5H1V A;  2RFJ A;  5DW1 A;  5CTL A;  5DFD A;  5EWW A;  4NRA A;  5ETD A;  4YK0 A;  4X2I A;  3DWY A;  3TLP A;  4NQM A;  5CRZ A;  4QUU A;  5CS8 A;  4ZC9 A;  5DLZ A;  5JI8 A;  3HMF A;  3JVL A;  5COI A;  5F5Z A;  4HXN A;  4O72 A;  4Y03 A;  5EWD A;  4O7E A;  5EWC A;  4UYD A;  5E7D A;  4E96 A;  5LJ1 A;  4XY8 A;  4C66 A;  4C67 A;  5LJ0 A;  5F36 A;  5ACY A;  5L98 A;  3UVX A;  3MUK A;  4LC2 A;  4NR9 A;  5FFY A;  4A9M A;  3LQI A;  3S92 A;  4HBY A;  5I86 A;  4KCX A;  5DY7 A;  4BW2 A;  4NR5 A;  5HQ6 A;  4HBW A;  5DLX A;  5I1Q A;  4PY6 A;  5LUU A;  2RI7 A;  4UIX A;  5HRW A;  3IU6 A;  5DBM A;  5EPR A;  5DX4 A;  4BW3 A;  4MR3 A;  4CL9 A;  1X0J A;  5E9M A;  1ZKR A;  3VKH A;  1WUG A;  5D24 A;  4UYG A;  5KTU A;  3QZS A;  5CQ4 A;  5D3S A;  2E3K A;  2N9G A;  4OGI A;  4UYF B;  5ENG A;  4A9J A;  5F63 A;  5HEN A;  5HRV A;  4QSU A;  4CLB A;  5FH8 A;  3AAD A;  5EVA A;  4HXP A;  5DW2 A;  3U5O A;  3NXB A;  4XYA A;  3UV4 A;  3MQM A;  4HBX A;  4YAT A;  3U5J A;  3QZT A;  4UIZ A;  4UIW A;  5JWM A;  4QSP A;  3LJW A;  5K29 A;  2RO1 A;  5ETB A;  5FE2 A;  3U5K A;  5CUC A;  3P1F A;  5EQ1 A;  5AME A;  3Q2F A;  4LDF A;  5C85 A;  4PCE A;  4IR3 A;  4AKN A;  2F6J A;  4IOQ A;  5A81 A;  4TZ8 A;  3U5N A;  5DYX A;  5DKC A;  2G4A A;  3G0J A;  4AKG A;  4IOO A;  4YYH A;  4NR6 A;  5HLS A;  5HM0 A;  5F1H A;  4Q0N A;  1ZS5 A;  5E74 A;  5EI4 A;  5F61 A;  3I3J A;  4QEU A;  5I7Y A;  5HFR A;  5FE7 A;  5C89 A;  4A9K A;  5I83 A;  5HFQ A;  4PTB A;  4J0S A;  5D7X A;  5F1L A; 
#chains in the Genus database with same CATH homology
 3O33 A;  4BW4 A;  4QY4 A;  5F25 A;  4TT6 A;  4QUT A;  5D3R A;  4LZS A;  4A9I A;  5C7N A;  4QNS A;  3JVM A;  5AMF A;  5D3H A;  4RVR A;  5A85 A;  4LZR A;  5EP7 A;  4IR4 A;  4NYW A;  5II2 A;  2DAT A;  4UIY A;  5TCM A;  5F60 A;  4QSX A;  5D3N A;  4KV4 A;  5DYC A;  4QEW A;  5KO4 A;  3DAI A;  2L85 A;  5CUG A;  5H1T A;  5A5N A;  5FE0 A;  5CY9 A;  3P1C A;  2DVQ A;  4KV1 A;  2YDW A;  4UYH A;  4QEV A;  4UYE A;  5G4R A;  5CP5 A;  5FE4 A;  5DYA A;  5ENF A;  3UW9 A;  4UIT A;  5CUB A;  3Q2E A;  4YBS A;  4A9H A;  5LKU A;  5BT4 A;  4Z6I A;  4TZ2 A;  5CQ3 A;  4HXM A;  5CQT A;  5HRX A;  2L5E A;  4MR4 A;  4IOR A;  4NXJ A;  2LSP B;  5FE5 A;  2L84 A;  4QBM A;  5DKH A;  4NRC A;  2OO1 A;  2DVS A;  5FBX A;  4LRG A;  4YBM A;  4BJX A;  3O36 A;  5H85 A;  4YYJ A;  5CU8 A;  4QR4 A;  5I29 A;  4NR8 A;  2RNX A;  4TT2 A;  3UVW A;  4Z1S A;  5HQ7 A;  5EIC A;  5E0R A;  4A9N A;  5II1 A;  5I40 A;  3IU5 A;  4FLP A;  5CQ7 A;  5FG4 A;  4QC1 A;  5E9K A;  5CQ6 A;  4OGJ A;  4CFK A;  2I8N A;  3MB4 A;  5A5S A;  5FH7 A;  5F3A A;  1EQF A;  5EV9 A;  4XUA A;  4QSV A;  4Z93 A;  5C87 A;  1F68 A;  4LZ2 A;  4N4I A;  2GRC A;  4HXS A;  4YC9 A;  2D82 A;  4IR6 A;  5L96 A;  3D7C A;  4ZQL A;  5I80 A;  4YYG A;  4QST A;  4CUU A;  3G0L A;  4LYS A;  2H60 A;  2E7O A;  4J0R A;  1E6I A;  2OSS A;  2DVR A;  2YQD A;  3UV2 A;  4CUR A;  5CFW A;  5CQA A;  4YH3 A;  2YYN A;  5A5R A;  2NXB A;  4NUC A;  4TU6 A;  5EA1 A;  4A9F A;  5AD2 A;  5BT3 A;  5A5P A;  4YYK A;  5CQ8 A;  5CUA A;  5FE9 A;  1N72 A;  4QSQ A;  3HME A;  4NRB A;  2E7N A;  4MEQ A;  3MUL A;  4TS8 A;  4QYL A;  5G4S A;  4BHW A;  3ONI A;  4O74 A;  4YBT A;  5FE1 A;  2YW5 A;  4YAX A;  5FH6 A;  2WP1 A;  3LXJ A;  4J1P A;  5LKT A;  4O75 A;  5ENH A;  3LQJ A;  5LKX A;  4N3W A;  2YEM A;  3K2J A;  3P5O A;  4O78 A;  3MXF A;  4O7C A;  4UIU A;  5ENJ A;  5A83 A;  5IBN A;  5EU1 A;  4BW1 A;  2YEK A;  5D26 A;  4YH4 A;  4CUP A;  5FFW A;  5J0D A;  4MR6 A;  4ALH A;  4HXL A;  4NUD A;  4IR5 A;  4J3I A;  4YAD A;  5FDZ A;  5I88 A;  5IGN A;  2KTB B;  2YEL A;  4NR4 A;  5CZG A;  4MEN A;  5E9L A;  4N4G A;  3RCW A;  5E9Y A;  4A9E A;  3SVH A;  4OUF A;  5L8U A;  5EK9 A;  1JM4 B;  5ENI A;  4YYM A;  5DKD A;  5D0C A;  5KU3 A;  4PCI A;  4QSR A;  5D3L A;  3GG3 A;  4QC3 A;  5A5O A;  3U5P A;  5FG6 A;  3S91 A;  3P1E A;  5EWV A;  5E73 A;  2R0Y A;  5HEM A;  4YYD A;  5TB6 A;  2R10 A;  5IGK A;  5IGL A;  5LVR A;  5CPE A;  4DON A;  5FE3 A;  4F3I A;  5CRM A;  5D25 A;  4HXO A;  3ZYU A;  4CUS A;  3QZV A;  2DVV A;  3O34 A;  5L8T A;  5EPS A;  4Z1Q A;  5H1U A;  2RNY A;  5FG5 A;  4QSW A;  5KTW A;  2FSA A;  4LR6 A;  4Z6H A;  4CFL A;  5D3P A;  5CQ5 A;  2MJV B;  5EIS A;  5A5Q A;  4ZW1 A;  5L97 A;  4TTE A;  4O7F A;  4QR3 A;  3LQH A;  4NQN A;  5E9V A;  4NUE A;  4YY4 A;  3FKM X;  4O7B A;  4WHW A;  2RS9 B;  5A82 A;  5LJ2 A;  4TQN A;  4O7A A;  5A7C A;  5E3D A;  2DKW A;  2RNW A;  4HXR A;  4UIV A;  5DFB A;  5E9I A;  4PKL A;  4NR7 A;  5FFV A;  1JSP B;  5D3J A;  4TYL A;  4N4F A;  4QSS A;  4O71 A;  5E3G A;  4GPJ A;  4QB3 A;  2D9E A;  5F62 A;  3MB3 A;  3SVF A;  4XUB A;  5CUD A;  5CUE A;  5I7X A;  4NYX A;  4O77 A;  3O37 A;  5KHM A;  4CUT A;  2WP2 A;  3JVJ A;  4NS5 A;  5LVQ A;  2I7K A;  5HEL A;  3HMH A;  2R0S A;  4QYD A;  5FE8 A;  3P1D A;  4Q0O A;  4MEP A;  5C4Q A;  4YYN A;  2F6N A;  4ALG A;  5EPB A;  4O70 A;  2OUO A;  4TT4 A;  5IG6 A;  5I89 A;  4YYI A;  4LYI A;  5EWH A;  4XY9 A;  4QZS A;  5F2P A;  4YAB A;  4WHU A;  5HQ5 A;  5L99 A;  5HCL A;  5LKZ A;  5FB1 A;  4O76 A;  5FE6 A;  4WIV A;  5ENC A;  5KTX A;  5D3T A;  5DFC A;  5CGP A;  5FB0 A;  5DYU A;  4TU4 A;  4A9L A;  4A9O A;  5HJC A;  4N4H A;  4MR5 A;  4YY6 A;  3UVD A;  3JVK A;  5C8G A;  1WUM A;  3SVG A;  3UV5 A;  4UYF A;  3UVY A;  4PS5 A;  5ENE A;  5IID A;  5BT5 A;  2DWW A;  4MEO A;  4HXK A;  3O35 A;  4LYW A;  2R0V A;  4NYV A;  3U5L A;  3AQA A;  4CUQ A;  4HBV A;  3U5M A;  5EGU A;  5AD3 A;  5IGM A;  5ENB A;  5EM3 A;  4QR5 A;  5H1V A;  2RFJ A;  5DW1 A;  5CTL A;  5DFD A;  5EWW A;  4NRA A;  5ETD A;  4YK0 A;  4X2I A;  3DWY A;  3TLP A;  4NQM A;  5CRZ A;  4QUU A;  5CS8 A;  4ZC9 A;  5DLZ A;  5JI8 A;  3HMF A;  3JVL A;  5COI A;  5F5Z A;  4HXN A;  4O72 A;  4Y03 A;  5EWD A;  4O7E A;  5EWC A;  4UYD A;  5E7D A;  4E96 A;  5LJ1 A;  4XY8 A;  4C66 A;  4C67 A;  5LJ0 A;  5F36 A;  5ACY A;  5L98 A;  3UVX A;  3MUK A;  4LC2 A;  4NR9 A;  5FFY A;  4A9M A;  3LQI A;  3S92 A;  4HBY A;  5I86 A;  4KCX A;  5DY7 A;  4BW2 A;  4NR5 A;  5HQ6 A;  4HBW A;  5DLX A;  5I1Q A;  4PY6 A;  5LUU A;  2RI7 A;  4UIX A;  5HRW A;  3IU6 A;  5DBM A;  5EPR A;  5DX4 A;  4BW3 A;  4MR3 A;  4CL9 A;  1X0J A;  5E9M A;  1WUG A;  5D24 A;  4UYG A;  5KTU A;  3QZS A;  5CQ4 A;  5D3S A;  2E3K A;  2N9G A;  4OGI A;  4UYF B;  5ENG A;  4A9J A;  5F63 A;  5HEN A;  5HRV A;  4QSU A;  4CLB A;  5FH8 A;  3AAD A;  5EVA A;  4HXP A;  5DW2 A;  3U5O A;  3NXB A;  4XYA A;  3UV4 A;  3MQM A;  4HBX A;  4YAT A;  3U5J A;  3QZT A;  4UIZ A;  4UIW A;  5JWM A;  4QSP A;  3LJW A;  5K29 A;  2RO1 A;  5ETB A;  5FE2 A;  3U5K A;  5CUC A;  3P1F A;  5EQ1 A;  5AME A;  3Q2F A;  4LDF A;  5C85 A;  4PCE A;  4IR3 A;  4AKN A;  2F6J A;  4IOQ A;  5A81 A;  4TZ8 A;  3U5N A;  5DYX A;  5DKC A;  2G4A A;  3G0J A;  4IOO A;  4YYH A;  4NR6 A;  5HLS A;  5HM0 A;  5F1H A;  4Q0N A;  1ZS5 A;  5E74 A;  5EI4 A;  5F61 A;  3I3J A;  4QEU A;  5I7Y A;  5HFR A;  5FE7 A;  5C89 A;  4A9K A;  5I83 A;  5HFQ A;  4PTB A;  4J0S A;  5D7X A;  5F1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...