5F36A

Crystal structure of the bromodomain of human atad2 in complex with compound a12
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ATPase family AAA domain-containing protein 2
publication title To be pubulished
rcsb
source organism Homo sapiens
total genus 55
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5f36A00
4YABA 4NR5A 4MEQA 5FFWA 5ACYA 5CGPA 4HBYA 3LJWA 4TS8A 4HXNA 5ENGA 5DYXA 5L8UA 4QSVA 5D0CA 4CL9A 4LZSA 2DVSA 5FE1A 5IGNA 4BHWA 4N4FA 2YELA 4UIWA 3U5OA 5AMEA 5ENBA 5E0RA 2OO1A 4O72A 2I8NA 4QYDA 4BW3A 3MUKA 4XY8A 4C67A 3S92A 5ENIA 5FE7A 4IOQA 4QSTA 4YBSA 5ENHA 4IR6A 5HRWA 3P1EA 5D25A 4NXJA 3HMFA 3D7CA 4A9FA 5FE5A 4NR6A 4YYIA 5I86A 5F63A 4TU6A 4NRAA 5L97A 5KHMA 4MR6A 4NR7A 5F25A 5E9KA 5HENA 5ENFA 4Z6HA 4YH4A 5FH7A 4MR5A 4O71A 4UYDA 4YYKA 2DWWA 3NXBA 5EU1A 5CPEA 4ZC9A 4QSSA 5C85A 3QZVA 4PKLA 4O74A 5ETBA 2R0SA 4QSXA 4LDFA 4A9KA 4YYHA 3GG3A 4CUPA 4N4HA 4KV4A 5EQ1A 4PCIA 4MR4A 2L85A 5CRMA 5A7CA 4N4GA 5C7NA 4O75A 2DVVA 4QC1A 5G4RA 5LVRA 2MJVB 3P1DA 4O7BA 4YBTA 4O7AA 3HMEA 3UV4A 4QR4A 4QC3A 1E6IA 4TTEA 5DW1A 5CQ7A 5DYUA 4CFKA 5LKXA 5KU3A 4ZW1A 4J3IA 4OGJA 5D7XA 3FKMX 4A9HA 5HRVA 5LKZA 4YBMA 5HFRA 2YEKA 2GRCA 5EISA 5DKDA 2R10A 4WIVA 4Q0OA 4YC9A 4PS5A 4TT4A 2R0YA 2OUOA 4N4IA 4QY4A 4UYEA 2L5EA 1ZS5A 4CUTA 4TZ2A 5TB6A 4PY6A 5CQ5A 4HXPA 4XYAA 5E9YA 5C4QA 5F3AA 2RNWA 5DKCA 5EWVA 4UIUA 3U5LA 1N72A 5F5ZA 4QEVA 2E7OA 4TT6A 5CY9A 5EPBA 5E3GA 4NR4A 5D3NA 4LYIA 5EWWA 3U5KA 4Z1SA 5BT3A 4CUUA 1JM4B 5FE8A 5A83A 5ENCA 3ZYUA 5A5SA 4LZ2A 4IR3A 4CURA 2RNXA 4YK0A 3UV2A 4HXOA 4QSPA 5CQ6A 4OUFA 3DWYA 5IG6A 4ALGA 3O37A 4UIVA 5CQAA 3P1CA 4KCXA 3JVJA 5CUAA 4YADA 3JVKA 5CQ8A 5F36A 5DYAA 1WUGA 2RI7A 3UVWA 4C66A 4J0SA 3UVYA 5EI4A 5FG4A 5J0DA 4CFLA 2DVQA 2OSSA 4X2IA 4MEOA 4WHUA 5II2A 5A85A 5D26A 1WUMA 4RVRA 2H60A 4A9EA 4HXRA 5FB1A 3RCWA 4MR3A 5EP7A 4QR5A 5H1TA 4QBMA 4MENA 4J1PA 4NYXA 4IOOA 2RS9B 5A81A 4Z6IA 5FE0A 5E7DA 5L8TA 4NUEA 4YATA 5IGKA 4O77A 5DLZA 5F1HA 3HMHA 5IIDA 5H1UA 5IBNA 5I80A 5LKUA 5ETDA 3K2JA 5I7YA 5F62A 5CFWA 4HBXA 4A9JA 5FG5A 4QUUA 4IR4A 3O36A 4AKNA 5EA1A 4WHWA 5A5RA 5TCMA 4XY9A 5FBXA 5BT4A 5E9LA 5D3JA 4A9OA 5HEMA 4IR5A 4YYJA 2RFJA 4TQNA 4QNSA 5EK9A 5KTXA 2DATA 4QR3A 4HXMA 3I3JA 4CUQA 5FB0A 2E7NA 5CUEA 5ENJA 3MULA 3G0JA 4NR8A 3IU6A 3JVMA 5EPSA 3SVHA 3ONIA 4NR9A 3MQMA 3IU5A 5II1A 3P5OA 4PCEA 3U5JA 4LR6A 3O33A 4NYWA 5DKHA 5D3SA 2KTBB 4UYHA 5HQ5A 4QB3A 5CUCA 2RNYA 5CQ3A 5FE6A 5FE4A 3TLPA 5I40A 5I83A 4YYGA 4NRCA 4BW2A 5A5OA 2F6JA 2WP1A 2NXBA 5C8GA 4FLPA 5E73A 4CUSA 3S91A 2E3KA 4LC2A 5CUGA 5CP5A 4HBWA 4UIXA 5DLXA 5F1LA 4YH3A 5JI8A 4QZSA 5LJ0A 3U5NA 5HRXA 5IGMA 3P1FA 2D82A 5D3HA 5DFDA 5CRZA 5KTWA 5BT5A 4QYLA 5HM0A 4QSRA 5G4SA 4NS5A 5E9MA 5I89A 2FSAA 5F61A 4XUBA 2DKWA 2N9GA 5DX4A 5EWCA 5ENEA 5AD3A 5EWDA 4DONA 2LSPB 4QEUA 5LVQA 4UYFB 4NQMA 3DAIA 5A5QA 4MEPA 4BJXA 3UVXA 3AQAA 3LQHA 5D3PA 4A9LA 4O70A 4HXLA 3UV5A 5FE2A 5LUUA 4NQNA 4UYGA 5A5NA 4OGIA 5EVAA 4N3WA 5HCLA 5I1QA 5DYCA 3G0LA 5E3DA 5K29A 4QEWA 4LRGA 5CUBA 5FG6A 2YQDA 5CS8A 4TU4A 4TYLA 5LKTA 4NRBA 4UITA 5D3LA 5FH6A 5DBMA 4IORA 5JWMA 4Z93A 4A9MA 5LJ1A 5A82A 2YDWA 4O7FA 5CU8A 1EQFA 3MXFA 5EICA 5HLSA 5H85A 4LZRA 5E9IA 4UYFA 5EPRA 5H1VA 5KO4A 4YYDA 5I29A 2R0VA 4TT2A 3LQJA 4QUTA 5IGLA 5D24A 5F60A 5L96A 3SVGA 5HFQA 5CUDA 5L98A 2YEMA 4KV1A 3UW9A 2G4AA 5EV9A 2YW5A 3JVLA 5HQ7A 4ALHA 4UIYA 4QSQA 5CQ4A 2WP2A 4J0RA 5DY7A 5EGUA 4HBVA 4GPJA 4QSUA 4XUAA 5D3TA 5DFCA 5DFBA 1F68A 3LXJA 4YYMA 5CZGA 3O34A 3UVDA 4BW1A 4PTBA 3O35A 4QSWA 4TZ8A 2F6NA 5A5PA 5E74A 3AADA 4A9IA 1JSPB 2RO1A 5LJ2A 4O76A 5COIA 4ZQLA 4LYWA 5I88A 4NYVA 4O7EA 3LQIA 5FFYA 3Q2FA 3MB4A 4CLBA 5EM3A 4BW4A 4UIZA 4LYSA 2DVRA 5HELA 3MB3A 5EWHA 3U5PA 3Q2EA 5AD2A 5C89A 4A9NA 5E9VA 4O7CA 4YAXA 4Q0NA 2D9EA 3QZSA 1X0JA 4Z1QA 2L84A 4NUDA 5KTUA 2I7KA 4NUCA 5FE9A 4O78A 4HXSA 5I7XA 4HXKA 5CTLA 4E96A 4YYNA 5CQTA 4YY6A 5HQ6A 3SVFA 2YYNA 4F3IA 4YY4A 5FH8A 3U5MA 4Y03A 5C87A 3QZTA 5F2PA 5L99A 5DW2A 5FDZA 5FE3A 5FFVA 5HJCA 5AMFA 5D3RA
chains in the Genus database with same CATH superfamily
4YABA 4NR5A 4MEQA 5FFWA 5ACYA 5CGPA 4HBYA 3LJWA 4TS8A 4HXNA 5ENGA 5DYXA 5L8UA 4QSVA 5D0CA 4CL9A 4LZSA 2DVSA 5FE1A 5IGNA 4BHWA 4N4FA 2YELA 4UIWA 3U5OA 5AMEA 5ENBA 5E0RA 2OO1A 4O72A 2I8NA 4QYDA 4BW3A 3MUKA 4XY8A 4C67A 3S92A 5ENIA 5FE7A 4IOQA 4QSTA 4YBSA 5ENHA 4IR6A 5HRWA 3P1EA 5D25A 4NXJA 3HMFA 3D7CA 4A9FA 5FE5A 4NR6A 4YYIA 5I86A 5F63A 4TU6A 4NRAA 5L97A 5KHMA 4MR6A 4NR7A 5F25A 5E9KA 5HENA 5ENFA 4Z6HA 4YH4A 5FH7A 4MR5A 4O71A 4UYDA 4YYKA 2DWWA 3NXBA 5EU1A 5CPEA 4ZC9A 4QSSA 5C85A 3QZVA 4PKLA 4O74A 5ETBA 2R0SA 4QSXA 4LDFA 4A9KA 4YYHA 3GG3A 4CUPA 4N4HA 4KV4A 5EQ1A 4PCIA 4MR4A 2L85A 5CRMA 5A7CA 4N4GA 5C7NA 4O75A 2DVVA 4QC1A 5G4RA 5LVRA 2MJVB 3P1DA 4O7BA 4YBTA 4O7AA 3HMEA 3UV4A 4QR4A 4QC3A 1E6IA 4TTEA 5DW1A 5CQ7A 5DYUA 4CFKA 5LKXA 5KU3A 4ZW1A 4J3IA 4OGJA 4AKGA 5D7XA 3FKMX 4A9HA 5HRVA 5LKZA 4YBMA 5HFRA 2YEKA 2GRCA 5EISA 5DKDA 2R10A 4WIVA 4Q0OA 4YC9A 4PS5A 4TT4A 2R0YA 2OUOA 4N4IA 4QY4A 4UYEA 2L5EA 1ZS5A 4CUTA 4TZ2A 5TB6A 4PY6A 5CQ5A 4HXPA 4XYAA 5E9YA 5C4QA 5F3AA 2RNWA 5DKCA 5EWVA 4UIUA 3U5LA 1N72A 5F5ZA 4QEVA 2E7OA 4TT6A 5CY9A 5EPBA 5E3GA 4NR4A 5D3NA 1PUOA 4LYIA 5EWWA 3U5KA 4Z1SA 5BT3A 4CUUA 1JM4B 5FE8A 5A83A 5ENCA 3ZYUA 5A5SA 4LZ2A 4IR3A 4CURA 2RNXA 4YK0A 3UV2A 4HXOA 4QSPA 5CQ6A 4OUFA 3DWYA 5IG6A 4ALGA 3O37A 4UIVA 5CQAA 3P1CA 4KCXA 3JVJA 5CUAA 4YADA 3JVKA 5CQ8A 5F36A 5DYAA 1WUGA 2RI7A 3UVWA 4C66A 4J0SA 3UVYA 5EI4A 5FG4A 5J0DA 4CFLA 2DVQA 2OSSA 4X2IA 4MEOA 4WHUA 5II2A 5A85A 5D26A 1WUMA 4RVRA 2H60A 4A9EA 4HXRA 5FB1A 3RCWA 4MR3A 5EP7A 4QR5A 5H1TA 4QBMA 4MENA 4J1PA 4NYXA 4IOOA 4AI6A 2RS9B 5A81A 4Z6IA 5FE0A 5E7DA 5L8TA 4NUEA 4YATA 5IGKA 4O77A 5DLZA 5F1HA 3HMHA 5IIDA 5H1UA 5IBNA 5I80A 5LKUA 5ETDA 3K2JA 5I7YA 5F62A 5CFWA 4HBXA 4A9JA 5FG5A 4QUUA 4IR4A 3O36A 4AKNA 5EA1A 4WHWA 5A5RA 5TCMA 4XY9A 5FBXA 5BT4A 5E9LA 5D3JA 4A9OA 5HEMA 4IR5A 4YYJA 2RFJA 4TQNA 4QNSA 5EK9A 5KTXA 2DATA 4QR3A 4HXMA 3I3JA 4CUQA 5FB0A 2E7NA 5CUEA 3VKGA 5ENJA 3MULA 3G0JA 4NR8A 3IU6A 3JVMA 5EPSA 3SVHA 3ONIA 4NR9A 3MQMA 3D1BA 3IU5A 5II1A 3P5OA 4PCEA 3U5JA 4LR6A 3O33A 4NYWA 5DKHA 5D3SA 2KTBB 4UYHA 5HQ5A 4QB3A 5CUCA 2RNYA 5CQ3A 5FE6A 5FE4A 3TLPA 5I40A 5I83A 4YYGA 3VKHA 4NRCA 4BW2A 5A5OA 2F6JA 2WP1A 2NXBA 5C8GA 4FLPA 5E73A 4CUSA 3S91A 2E3KA 4LC2A 5CUGA 4AKHA 5CP5A 4HBWA 4UIXA 5DLXA 5F1LA 4YH3A 5JI8A 4QZSA 5LJ0A 3U5NA 5HRXA 5IGMA 3P1FA 2D82A 5D3HA 5DFDA 5CRZA 5KTWA 5BT5A 4QYLA 5HM0A 4QSRA 5G4SA 4NS5A 5E9MA 5I89A 2FSAA 5F61A 4XUBA 2DKWA 2N9GA 5DX4A 5EWCA 5ENEA 5AD3A 5EWDA 4DONA 2LSPB 4QEUA 5LVQA 4UYFB 4NQMA 3DAIA 5A5QA 4MEPA 4BJXA 3UVXA 3AQAA 3LQHA 5D3PA 4A9LA 4O70A 3ERRA 4HXLA 3UV5A 5FE2A 5LUUA 4NQNA 4UYGA 5A5NA 4OGIA 5EVAA 4N3WA 5HCLA 5I1QA 5DYCA 3G0LA 5E3DA 1ZKRA 5K29A 4QEWA 4LRGA 5CUBA 5FG6A 2YQDA 5CS8A 4TU4A 4TYLA 5LKTA 4NRBA 4UITA 5D3LA 5FH6A 5DBMA 4IORA 5JWMA 4Z93A 4A9MA 5LJ1A 5A82A 2YDWA 4O7FA 5CU8A 1EQFA 3MXFA 5EICA 5HLSA 5H85A 4LZRA 5E9IA 4UYFA 5EPRA 5H1VA 5KO4A 4YYDA 5I29A 2R0VA 4TT2A 3LQJA 4QUTA 5IGLA 5D24A 5F60A 5L96A 3SVGA 5HFQA 5CUDA 5L98A 2YEMA 4AKIA 4KV1A 3UW9A 2G4AA 5EV9A 2YW5A 3JVLA 5HQ7A 4ALHA 4UIYA 4QSQA 5CQ4A 2WP2A 2EJNA 4J0RA 5DY7A 5EGUA 4HBVA 4GPJA 4QSUA 4XUAA 5D3TA 5DFCA 5DFBA 1F68A 3LXJA 4YYMA 5CZGA 3O34A 3UVDA 4BW1A 4PTBA 3O35A 4QSWA 4TZ8A 2F6NA 5A5PA 5E74A 3AADA 4A9IA 1JSPB 2RO1A 5LJ2A 4O76A 5COIA 4ZQLA 4LYWA 5I88A 4NYVA 4O7EA 3LQIA 5FFYA 3Q2FA 3MB4A 4CLBA 5EM3A 4BW4A 4UIZA 4LYSA 2DVRA 5HELA 3MB3A 5EWHA 3U5PA 3Q2EA 5AD2A 5C89A 4A9NA 5E9VA 4O7CA 4YAXA 4Q0NA 2D9EA 3QZSA 1X0JA 4Z1QA 2L84A 4NUDA 3D1DA 5KTUA 2I7KA 4NUCA 5FE9A 4O78A 4HXSA 5I7XA 4HXKA 5CTLA 4E96A 4YYNA 5CQTA 4YY6A 5HQ6A 3SVFA 2YYNA 4F3IA 4YY4A 5FH8A 3U5MA 4Y03A 5C87A 3QZTA 5F2PA 5L99A 5DW2A 5FDZA 5FE3A 5FFVA 5HJCA 5AMFA 5D3RA
chains in the Genus database with same CATH topology
4YABA 4NR5A 4MEQA 5FFWA 5ACYA 5CGPA 4HBYA 3LJWA 4TS8A 4HXNA 5ENGA 5DYXA 5L8UA 4QSVA 5D0CA 4CL9A 4LZSA 2DVSA 5FE1A 5IGNA 4BHWA 4N4FA 2YELA 4UIWA 3U5OA 5AMEA 5ENBA 5E0RA 2OO1A 4O72A 2I8NA 4QYDA 4BW3A 3MUKA 4XY8A 4C67A 3S92A 5ENIA 5FE7A 4IOQA 4QSTA 4YBSA 5ENHA 4IR6A 5HRWA 3P1EA 5D25A 4NXJA 3HMFA 3D7CA 4A9FA 5FE5A 4NR6A 4YYIA 5I86A 5F63A 4TU6A 4NRAA 5L97A 5KHMA 4MR6A 4NR7A 5F25A 5E9KA 5HENA 5ENFA 4Z6HA 4YH4A 5FH7A 4MR5A 4O71A 4UYDA 4YYKA 2DWWA 3NXBA 5EU1A 5CPEA 4ZC9A 4QSSA 5C85A 3QZVA 4PKLA 4O74A 5ETBA 2R0SA 4QSXA 4LDFA 4A9KA 4YYHA 3GG3A 4CUPA 4N4HA 4KV4A 5EQ1A 4PCIA 4MR4A 2L85A 5CRMA 5A7CA 4N4GA 5C7NA 4O75A 2DVVA 4QC1A 5G4RA 5LVRA 2MJVB 3P1DA 4O7BA 4YBTA 4O7AA 3HMEA 3UV4A 4QR4A 4QC3A 1E6IA 4TTEA 5DW1A 5CQ7A 5DYUA 4CFKA 5LKXA 5KU3A 4ZW1A 4J3IA 4OGJA 5D7XA 3FKMX 4A9HA 5HRVA 5LKZA 4YBMA 5HFRA 2YEKA 2GRCA 5EISA 5DKDA 2R10A 4WIVA 4Q0OA 4YC9A 4PS5A 4TT4A 2R0YA 2OUOA 4N4IA 4QY4A 4UYEA 2L5EA 1ZS5A 4CUTA 4TZ2A 5TB6A 4PY6A 5CQ5A 4HXPA 4XYAA 5E9YA 5C4QA 5F3AA 2RNWA 5DKCA 5EWVA 4UIUA 3U5LA 1N72A 5F5ZA 4QEVA 2E7OA 4TT6A 5CY9A 5EPBA 5E3GA 4NR4A 5D3NA 4LYIA 5EWWA 3U5KA 4Z1SA 5BT3A 4CUUA 1JM4B 5FE8A 5A83A 5ENCA 3ZYUA 5A5SA 4LZ2A 4IR3A 4CURA 2RNXA 4YK0A 3UV2A 4HXOA 4QSPA 5CQ6A 4OUFA 3DWYA 5IG6A 4ALGA 3O37A 4UIVA 5CQAA 3P1CA 4KCXA 3JVJA 5CUAA 4YADA 3JVKA 5CQ8A 5F36A 5DYAA 1WUGA 2RI7A 3UVWA 4C66A 4J0SA 3UVYA 5EI4A 5FG4A 5J0DA 4CFLA 2DVQA 2OSSA 4X2IA 4MEOA 4WHUA 5II2A 5A85A 5D26A 1WUMA 4RVRA 2H60A 4A9EA 4HXRA 5FB1A 3RCWA 4MR3A 5EP7A 4QR5A 5H1TA 4QBMA 4MENA 4J1PA 4NYXA 4IOOA 2RS9B 5A81A 4Z6IA 5FE0A 5E7DA 5L8TA 4NUEA 4YATA 5IGKA 4O77A 5DLZA 5F1HA 3HMHA 5IIDA 5H1UA 5IBNA 5I80A 5LKUA 5ETDA 3K2JA 5I7YA 5F62A 5CFWA 4HBXA 4A9JA 5FG5A 4QUUA 4IR4A 3O36A 4AKNA 5EA1A 4WHWA 5A5RA 5TCMA 4XY9A 5FBXA 5BT4A 5E9LA 5D3JA 4A9OA 5HEMA 4IR5A 4YYJA 2RFJA 4TQNA 4QNSA 5EK9A 5KTXA 2DATA 4QR3A 4HXMA 3I3JA 4CUQA 5FB0A 2E7NA 5CUEA 5ENJA 3MULA 3G0JA 4NR8A 3IU6A 3JVMA 5EPSA 3SVHA 3ONIA 4NR9A 3MQMA 3IU5A 5II1A 3P5OA 4PCEA 3U5JA 4LR6A 3O33A 4NYWA 5DKHA 5D3SA 2KTBB 4UYHA 5HQ5A 4QB3A 5CUCA 2RNYA 5CQ3A 5FE6A 5FE4A 3TLPA 5I40A 5I83A 4YYGA 4NRCA 4BW2A 5A5OA 2F6JA 2WP1A 2NXBA 5C8GA 4FLPA 5E73A 4CUSA 3S91A 2E3KA 4LC2A 5CUGA 5CP5A 4HBWA 4UIXA 5DLXA 5F1LA 4YH3A 5JI8A 4QZSA 5LJ0A 3U5NA 5HRXA 5IGMA 3P1FA 2D82A 5D3HA 5DFDA 5CRZA 5KTWA 5BT5A 4QYLA 5HM0A 4QSRA 5G4SA 4NS5A 5E9MA 5I89A 2FSAA 5F61A 4XUBA 2DKWA 2N9GA 5DX4A 5EWCA 5ENEA 5AD3A 5EWDA 4DONA 2LSPB 4QEUA 5LVQA 4UYFB 4NQMA 3DAIA 5A5QA 4MEPA 4BJXA 3UVXA 3AQAA 3LQHA 5D3PA 4A9LA 4O70A 4HXLA 3UV5A 5FE2A 5LUUA 4NQNA 4UYGA 5A5NA 4OGIA 5EVAA 4N3WA 5HCLA 5I1QA 5DYCA 3G0LA 5E3DA 5K29A 4QEWA 4LRGA 5CUBA 5FG6A 2YQDA 5CS8A 4TU4A 4TYLA 5LKTA 4NRBA 4UITA 5D3LA 5FH6A 5DBMA 4IORA 5JWMA 4Z93A 4A9MA 5LJ1A 5A82A 2YDWA 4O7FA 5CU8A 1EQFA 3MXFA 5EICA 5HLSA 5H85A 4LZRA 5E9IA 4UYFA 5EPRA 5H1VA 5KO4A 4YYDA 5I29A 2R0VA 4TT2A 3LQJA 4QUTA 5IGLA 5D24A 5F60A 5L96A 3SVGA 5HFQA 5CUDA 5L98A 2YEMA 4KV1A 3UW9A 2G4AA 5EV9A 2YW5A 3JVLA 5HQ7A 4ALHA 4UIYA 4QSQA 5CQ4A 2WP2A 4J0RA 5DY7A 5EGUA 4HBVA 4GPJA 4QSUA 4XUAA 5D3TA 5DFCA 5DFBA 1F68A 3LXJA 4YYMA 5CZGA 3O34A 3UVDA 4BW1A 4PTBA 3O35A 4QSWA 4TZ8A 2F6NA 5A5PA 5E74A 3AADA 4A9IA 1JSPB 2RO1A 5LJ2A 4O76A 5COIA 4ZQLA 4LYWA 5I88A 4NYVA 4O7EA 3LQIA 5FFYA 3Q2FA 3MB4A 4CLBA 5EM3A 4BW4A 4UIZA 4LYSA 2DVRA 5HELA 3MB3A 5EWHA 3U5PA 3Q2EA 5AD2A 5C89A 4A9NA 5E9VA 4O7CA 4YAXA 4Q0NA 2D9EA 3QZSA 1X0JA 4Z1QA 2L84A 4NUDA 5KTUA 2I7KA 4NUCA 5FE9A 4O78A 4HXSA 5I7XA 4HXKA 5CTLA 4E96A 4YYNA 5CQTA 4YY6A 5HQ6A 3SVFA 2YYNA 4F3IA 4YY4A 5FH8A 3U5MA 4Y03A 5C87A 3QZTA 5F2PA 5L99A 5DW2A 5FDZA 5FE3A 5FFVA 5HJCA 5AMFA 5D3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YAB A;  4NR5 A;  4MEQ A;  5FFW A;  5ACY A;  5CGP A;  4HBY A;  3LJW A;  4TS8 A;  4HXN A;  5ENG A;  5DYX A;  5L8U A;  4QSV A;  5D0C A;  4CL9 A;  4LZS A;  2DVS A;  5FE1 A;  5IGN A;  4BHW A;  4N4F A;  2YEL A;  4UIW A;  3U5O A;  5AME A;  5ENB A;  5E0R A;  2OO1 A;  4O72 A;  2I8N A;  4QYD A;  4BW3 A;  3MUK A;  4XY8 A;  4C67 A;  3S92 A;  5ENI A;  5FE7 A;  4IOQ A;  4QST A;  4YBS A;  5ENH A;  4IR6 A;  5HRW A;  3P1E A;  5D25 A;  4NXJ A;  3HMF A;  3D7C A;  4A9F A;  5FE5 A;  4NR6 A;  4YYI A;  5I86 A;  5F63 A;  4TU6 A;  4NRA A;  5L97 A;  5KHM A;  4MR6 A;  4NR7 A;  5F25 A;  5E9K A;  5HEN A;  5ENF A;  4Z6H A;  4YH4 A;  5FH7 A;  4MR5 A;  4O71 A;  4UYD A;  4YYK A;  2DWW A;  3NXB A;  5EU1 A;  5CPE A;  4ZC9 A;  4QSS A;  5C85 A;  3QZV A;  4PKL A;  4O74 A;  5ETB A;  2R0S A;  4QSX A;  4LDF A;  4A9K A;  4YYH A;  3GG3 A;  4CUP A;  4N4H A;  4KV4 A;  5EQ1 A;  4PCI A;  4MR4 A;  2L85 A;  5CRM A;  5A7C A;  4N4G A;  5C7N A;  4O75 A;  2DVV A;  4QC1 A;  5G4R A;  5LVR A;  2MJV B;  3P1D A;  4O7B A;  4YBT A;  4O7A A;  3HME A;  3UV4 A;  4QR4 A;  4QC3 A;  1E6I A;  4TTE A;  5DW1 A;  5CQ7 A;  5DYU A;  4CFK A;  5LKX A;  5KU3 A;  4ZW1 A;  4J3I A;  4OGJ A;  5D7X A;  3FKM X;  4A9H A;  5HRV A;  5LKZ A;  4YBM A;  5HFR A;  2YEK A;  2GRC A;  5EIS A;  5DKD A;  2R10 A;  4WIV A;  4Q0O A;  4YC9 A;  4PS5 A;  4TT4 A;  2R0Y A;  2OUO A;  4N4I A;  4QY4 A;  4UYE A;  2L5E A;  1ZS5 A;  4CUT A;  4TZ2 A;  5TB6 A;  4PY6 A;  5CQ5 A;  4HXP A;  4XYA A;  5E9Y A;  5C4Q A;  5F3A A;  2RNW A;  5DKC A;  5EWV A;  4UIU A;  3U5L A;  1N72 A;  5F5Z A;  4QEV A;  2E7O A;  4TT6 A;  5CY9 A;  5EPB A;  5E3G A;  4NR4 A;  5D3N A;  4LYI A;  5EWW A;  3U5K A;  4Z1S A;  5BT3 A;  4CUU A;  1JM4 B;  5FE8 A;  5A83 A;  5ENC A;  3ZYU A;  5A5S A;  4LZ2 A;  4IR3 A;  4CUR A;  2RNX A;  4YK0 A;  3UV2 A;  4HXO A;  4QSP A;  5CQ6 A;  4OUF A;  3DWY A;  5IG6 A;  4ALG A;  3O37 A;  4UIV A;  5CQA A;  3P1C A;  4KCX A;  3JVJ A;  5CUA A;  4YAD A;  3JVK A;  5CQ8 A;  5F36 A;  5DYA A;  1WUG A;  2RI7 A;  3UVW A;  4C66 A;  4J0S A;  3UVY A;  5EI4 A;  5FG4 A;  5J0D A;  4CFL A;  2DVQ A;  2OSS A;  4X2I A;  4MEO A;  4WHU A;  5II2 A;  5A85 A;  5D26 A;  1WUM A;  4RVR A;  2H60 A;  4A9E A;  4HXR A;  5FB1 A;  3RCW A;  4MR3 A;  5EP7 A;  4QR5 A;  5H1T A;  4QBM A;  4MEN A;  4J1P A;  4NYX A;  4IOO A;  2RS9 B;  5A81 A;  4Z6I A;  5FE0 A;  5E7D A;  5L8T A;  4NUE A;  4YAT A;  5IGK A;  4O77 A;  5DLZ A;  5F1H A;  3HMH A;  5IID A;  5H1U A;  5IBN A;  5I80 A;  5LKU A;  5ETD A;  3K2J A;  5I7Y A;  5F62 A;  5CFW A;  4HBX A;  4A9J A;  5FG5 A;  4QUU A;  4IR4 A;  3O36 A;  4AKN A;  5EA1 A;  4WHW A;  5A5R A;  5TCM A;  4XY9 A;  5FBX A;  5BT4 A;  5E9L A;  5D3J A;  4A9O A;  5HEM A;  4IR5 A;  4YYJ A;  2RFJ A;  4TQN A;  4QNS A;  5EK9 A;  5KTX A;  2DAT A;  4QR3 A;  4HXM A;  3I3J A;  4CUQ A;  5FB0 A;  2E7N A;  5CUE A;  5ENJ A;  3MUL A;  3G0J A;  4NR8 A;  3IU6 A;  3JVM A;  5EPS A;  3SVH A;  3ONI A;  4NR9 A;  3MQM A;  3IU5 A;  5II1 A;  3P5O A;  4PCE A;  3U5J A;  4LR6 A;  3O33 A;  4NYW A;  5DKH A;  5D3S A;  2KTB B;  4UYH A;  5HQ5 A;  4QB3 A;  5CUC A;  2RNY A;  5CQ3 A;  5FE6 A;  5FE4 A;  3TLP A;  5I40 A;  5I83 A;  4YYG A;  4NRC A;  4BW2 A;  5A5O A;  2F6J A;  2WP1 A;  2NXB A;  5C8G A;  4FLP A;  5E73 A;  4CUS A;  3S91 A;  2E3K A;  4LC2 A;  5CUG A;  5CP5 A;  4HBW A;  4UIX A;  5DLX A;  5F1L A;  4YH3 A;  5JI8 A;  4QZS A;  5LJ0 A;  3U5N A;  5HRX A;  5IGM A;  3P1F A;  2D82 A;  5D3H A;  5DFD A;  5CRZ A;  5KTW A;  5BT5 A;  4QYL A;  5HM0 A;  4QSR A;  5G4S A;  4NS5 A;  5E9M A;  5I89 A;  2FSA A;  5F61 A;  4XUB A;  2DKW A;  2N9G A;  5DX4 A;  5EWC A;  5ENE A;  5AD3 A;  5EWD A;  4DON A;  2LSP B;  4QEU A;  5LVQ A;  4UYF B;  4NQM A;  3DAI A;  5A5Q A;  4MEP A;  4BJX A;  3UVX A;  3AQA A;  3LQH A;  5D3P A;  4A9L A;  4O70 A;  4HXL A;  3UV5 A;  5FE2 A;  5LUU A;  4NQN A;  4UYG A;  5A5N A;  4OGI A;  5EVA A;  4N3W A;  5HCL A;  5I1Q A;  5DYC A;  3G0L A;  5E3D A;  5K29 A;  4QEW A;  4LRG A;  5CUB A;  5FG6 A;  2YQD A;  5CS8 A;  4TU4 A;  4TYL A;  5LKT A;  4NRB A;  4UIT A;  5D3L A;  5FH6 A;  5DBM A;  4IOR A;  5JWM A;  4Z93 A;  4A9M A;  5LJ1 A;  5A82 A;  2YDW A;  4O7F A;  5CU8 A;  1EQF A;  3MXF A;  5EIC A;  5HLS A;  5H85 A;  4LZR A;  5E9I A;  4UYF A;  5EPR A;  5H1V A;  5KO4 A;  4YYD A;  5I29 A;  2R0V A;  4TT2 A;  3LQJ A;  4QUT A;  5IGL A;  5D24 A;  5F60 A;  5L96 A;  3SVG A;  5HFQ A;  5CUD A;  5L98 A;  2YEM A;  4KV1 A;  3UW9 A;  2G4A A;  5EV9 A;  2YW5 A;  3JVL A;  5HQ7 A;  4ALH A;  4UIY A;  4QSQ A;  5CQ4 A;  2WP2 A;  4J0R A;  5DY7 A;  5EGU A;  4HBV A;  4GPJ A;  4QSU A;  4XUA A;  5D3T A;  5DFC A;  5DFB A;  1F68 A;  3LXJ A;  4YYM A;  5CZG A;  3O34 A;  3UVD A;  4BW1 A;  4PTB A;  3O35 A;  4QSW A;  4TZ8 A;  2F6N A;  5A5P A;  5E74 A;  3AAD A;  4A9I A;  1JSP B;  2RO1 A;  5LJ2 A;  4O76 A;  5COI A;  4ZQL A;  4LYW A;  5I88 A;  4NYV A;  4O7E A;  3LQI A;  5FFY A;  3Q2F A;  3MB4 A;  4CLB A;  5EM3 A;  4BW4 A;  4UIZ A;  4LYS A;  2DVR A;  5HEL A;  3MB3 A;  5EWH A;  3U5P A;  3Q2E A;  5AD2 A;  5C89 A;  4A9N A;  5E9V A;  4O7C A;  4YAX A;  4Q0N A;  2D9E A;  3QZS A;  1X0J A;  4Z1Q A;  2L84 A;  4NUD A;  5KTU A;  2I7K A;  4NUC A;  5FE9 A;  4O78 A;  4HXS A;  5I7X A;  4HXK A;  5CTL A;  4E96 A;  4YYN A;  5CQT A;  4YY6 A;  5HQ6 A;  3SVF A;  2YYN A;  4F3I A;  4YY4 A;  5FH8 A;  3U5M A;  4Y03 A;  5C87 A;  3QZT A;  5F2P A;  5L99 A;  5DW2 A;  5FDZ A;  5FE3 A;  5FFV A;  5HJC A;  5AMF A;  5D3R A; 
#chains in the Genus database with same CATH topology
 4YAB A;  4NR5 A;  4MEQ A;  5FFW A;  5ACY A;  5CGP A;  4HBY A;  3LJW A;  4TS8 A;  4HXN A;  5ENG A;  5DYX A;  5L8U A;  4QSV A;  5D0C A;  4CL9 A;  4LZS A;  2DVS A;  5FE1 A;  5IGN A;  4BHW A;  4N4F A;  2YEL A;  4UIW A;  3U5O A;  5AME A;  5ENB A;  5E0R A;  2OO1 A;  4O72 A;  2I8N A;  4QYD A;  4BW3 A;  3MUK A;  4XY8 A;  4C67 A;  3S92 A;  5ENI A;  5FE7 A;  4IOQ A;  4QST A;  4YBS A;  5ENH A;  4IR6 A;  5HRW A;  3P1E A;  5D25 A;  4NXJ A;  3HMF A;  3D7C A;  4A9F A;  5FE5 A;  4NR6 A;  4YYI A;  5I86 A;  5F63 A;  4TU6 A;  4NRA A;  5L97 A;  5KHM A;  4MR6 A;  4NR7 A;  5F25 A;  5E9K A;  5HEN A;  5ENF A;  4Z6H A;  4YH4 A;  5FH7 A;  4MR5 A;  4O71 A;  4UYD A;  4YYK A;  2DWW A;  3NXB A;  5EU1 A;  5CPE A;  4ZC9 A;  4QSS A;  5C85 A;  3QZV A;  4PKL A;  4O74 A;  5ETB A;  2R0S A;  4QSX A;  4LDF A;  4A9K A;  4YYH A;  3GG3 A;  4CUP A;  4N4H A;  4KV4 A;  5EQ1 A;  4PCI A;  4MR4 A;  2L85 A;  5CRM A;  5A7C A;  4N4G A;  5C7N A;  4O75 A;  2DVV A;  4QC1 A;  5G4R A;  5LVR A;  2MJV B;  3P1D A;  4O7B A;  4YBT A;  4O7A A;  3HME A;  3UV4 A;  4QR4 A;  4QC3 A;  1E6I A;  4TTE A;  5DW1 A;  5CQ7 A;  5DYU A;  4CFK A;  5LKX A;  5KU3 A;  4ZW1 A;  4J3I A;  4OGJ A;  4AKG A;  5D7X A;  3FKM X;  4A9H A;  5HRV A;  5LKZ A;  4YBM A;  5HFR A;  2YEK A;  2GRC A;  5EIS A;  5DKD A;  2R10 A;  4WIV A;  4Q0O A;  4YC9 A;  4PS5 A;  4TT4 A;  2R0Y A;  2OUO A;  4N4I A;  4QY4 A;  4UYE A;  2L5E A;  1ZS5 A;  4CUT A;  4TZ2 A;  5TB6 A;  4PY6 A;  5CQ5 A;  4HXP A;  4XYA A;  5E9Y A;  5C4Q A;  5F3A A;  2RNW A;  5DKC A;  5EWV A;  4UIU A;  3U5L A;  1N72 A;  5F5Z A;  4QEV A;  2E7O A;  4TT6 A;  5CY9 A;  5EPB A;  5E3G A;  4NR4 A;  5D3N A;  1PUO A;  4LYI A;  5EWW A;  3U5K A;  4Z1S A;  5BT3 A;  4CUU A;  1JM4 B;  5FE8 A;  5A83 A;  5ENC A;  3ZYU A;  5A5S A;  4LZ2 A;  4IR3 A;  4CUR A;  2RNX A;  4YK0 A;  3UV2 A;  4HXO A;  4QSP A;  5CQ6 A;  4OUF A;  3DWY A;  5IG6 A;  4ALG A;  3O37 A;  4UIV A;  5CQA A;  3P1C A;  4KCX A;  3JVJ A;  5CUA A;  4YAD A;  3JVK A;  5CQ8 A;  5F36 A;  5DYA A;  1WUG A;  2RI7 A;  3UVW A;  4C66 A;  4J0S A;  3UVY A;  5EI4 A;  5FG4 A;  5J0D A;  4CFL A;  2DVQ A;  2OSS A;  4X2I A;  4MEO A;  4WHU A;  5II2 A;  5A85 A;  5D26 A;  1WUM A;  4RVR A;  2H60 A;  4A9E A;  4HXR A;  5FB1 A;  3RCW A;  4MR3 A;  5EP7 A;  4QR5 A;  5H1T A;  4QBM A;  4MEN A;  4J1P A;  4NYX A;  4IOO A;  4AI6 A;  2RS9 B;  5A81 A;  4Z6I A;  5FE0 A;  5E7D A;  5L8T A;  4NUE A;  4YAT A;  5IGK A;  4O77 A;  5DLZ A;  5F1H A;  3HMH A;  5IID A;  5H1U A;  5IBN A;  5I80 A;  5LKU A;  5ETD A;  3K2J A;  5I7Y A;  5F62 A;  5CFW A;  4HBX A;  4A9J A;  5FG5 A;  4QUU A;  4IR4 A;  3O36 A;  4AKN A;  5EA1 A;  4WHW A;  5A5R A;  5TCM A;  4XY9 A;  5FBX A;  5BT4 A;  5E9L A;  5D3J A;  4A9O A;  5HEM A;  4IR5 A;  4YYJ A;  2RFJ A;  4TQN A;  4QNS A;  5EK9 A;  5KTX A;  2DAT A;  4QR3 A;  4HXM A;  3I3J A;  4CUQ A;  5FB0 A;  2E7N A;  5CUE A;  3VKG A;  5ENJ A;  3MUL A;  3G0J A;  4NR8 A;  3IU6 A;  3JVM A;  5EPS A;  3SVH A;  3ONI A;  4NR9 A;  3MQM A;  3D1B A;  3IU5 A;  5II1 A;  3P5O A;  4PCE A;  3U5J A;  4LR6 A;  3O33 A;  4NYW A;  5DKH A;  5D3S A;  2KTB B;  4UYH A;  5HQ5 A;  4QB3 A;  5CUC A;  2RNY A;  5CQ3 A;  5FE6 A;  5FE4 A;  3TLP A;  5I40 A;  5I83 A;  4YYG A;  3VKH A;  4NRC A;  4BW2 A;  5A5O A;  2F6J A;  2WP1 A;  2NXB A;  5C8G A;  4FLP A;  5E73 A;  4CUS A;  3S91 A;  2E3K A;  4LC2 A;  5CUG A;  4AKH A;  5CP5 A;  4HBW A;  4UIX A;  5DLX A;  5F1L A;  4YH3 A;  5JI8 A;  4QZS A;  5LJ0 A;  3U5N A;  5HRX A;  5IGM A;  3P1F A;  2D82 A;  5D3H A;  5DFD A;  5CRZ A;  5KTW A;  5BT5 A;  4QYL A;  5HM0 A;  4QSR A;  5G4S A;  4NS5 A;  5E9M A;  5I89 A;  2FSA A;  5F61 A;  4XUB A;  2DKW A;  2N9G A;  5DX4 A;  5EWC A;  5ENE A;  5AD3 A;  5EWD A;  4DON A;  2LSP B;  4QEU A;  5LVQ A;  4UYF B;  4NQM A;  3DAI A;  5A5Q A;  4MEP A;  4BJX A;  3UVX A;  3AQA A;  3LQH A;  5D3P A;  4A9L A;  4O70 A;  3ERR A;  4HXL A;  3UV5 A;  5FE2 A;  5LUU A;  4NQN A;  4UYG A;  5A5N A;  4OGI A;  5EVA A;  4N3W A;  5HCL A;  5I1Q A;  5DYC A;  3G0L A;  5E3D A;  1ZKR A;  5K29 A;  4QEW A;  4LRG A;  5CUB A;  5FG6 A;  2YQD A;  5CS8 A;  4TU4 A;  4TYL A;  5LKT A;  4NRB A;  4UIT A;  5D3L A;  5FH6 A;  5DBM A;  4IOR A;  5JWM A;  4Z93 A;  4A9M A;  5LJ1 A;  5A82 A;  2YDW A;  4O7F A;  5CU8 A;  1EQF A;  3MXF A;  5EIC A;  5HLS A;  5H85 A;  4LZR A;  5E9I A;  4UYF A;  5EPR A;  5H1V A;  5KO4 A;  4YYD A;  5I29 A;  2R0V A;  4TT2 A;  3LQJ A;  4QUT A;  5IGL A;  5D24 A;  5F60 A;  5L96 A;  3SVG A;  5HFQ A;  5CUD A;  5L98 A;  2YEM A;  4AKI A;  4KV1 A;  3UW9 A;  2G4A A;  5EV9 A;  2YW5 A;  3JVL A;  5HQ7 A;  4ALH A;  4UIY A;  4QSQ A;  5CQ4 A;  2WP2 A;  2EJN A;  4J0R A;  5DY7 A;  5EGU A;  4HBV A;  4GPJ A;  4QSU A;  4XUA A;  5D3T A;  5DFC A;  5DFB A;  1F68 A;  3LXJ A;  4YYM A;  5CZG A;  3O34 A;  3UVD A;  4BW1 A;  4PTB A;  3O35 A;  4QSW A;  4TZ8 A;  2F6N A;  5A5P A;  5E74 A;  3AAD A;  4A9I A;  1JSP B;  2RO1 A;  5LJ2 A;  4O76 A;  5COI A;  4ZQL A;  4LYW A;  5I88 A;  4NYV A;  4O7E A;  3LQI A;  5FFY A;  3Q2F A;  3MB4 A;  4CLB A;  5EM3 A;  4BW4 A;  4UIZ A;  4LYS A;  2DVR A;  5HEL A;  3MB3 A;  5EWH A;  3U5P A;  3Q2E A;  5AD2 A;  5C89 A;  4A9N A;  5E9V A;  4O7C A;  4YAX A;  4Q0N A;  2D9E A;  3QZS A;  1X0J A;  4Z1Q A;  2L84 A;  4NUD A;  3D1D A;  5KTU A;  2I7K A;  4NUC A;  5FE9 A;  4O78 A;  4HXS A;  5I7X A;  4HXK A;  5CTL A;  4E96 A;  4YYN A;  5CQT A;  4YY6 A;  5HQ6 A;  3SVF A;  2YYN A;  4F3I A;  4YY4 A;  5FH8 A;  3U5M A;  4Y03 A;  5C87 A;  3QZT A;  5F2P A;  5L99 A;  5DW2 A;  5FDZ A;  5FE3 A;  5FFV A;  5HJC A;  5AMF A;  5D3R A; 
#chains in the Genus database with same CATH homology
 4YAB A;  4NR5 A;  4MEQ A;  5FFW A;  5ACY A;  5CGP A;  4HBY A;  3LJW A;  4TS8 A;  4HXN A;  5ENG A;  5DYX A;  5L8U A;  4QSV A;  5D0C A;  4CL9 A;  4LZS A;  2DVS A;  5FE1 A;  5IGN A;  4BHW A;  4N4F A;  2YEL A;  4UIW A;  3U5O A;  5AME A;  5ENB A;  5E0R A;  2OO1 A;  4O72 A;  2I8N A;  4QYD A;  4BW3 A;  3MUK A;  4XY8 A;  4C67 A;  3S92 A;  5ENI A;  5FE7 A;  4IOQ A;  4QST A;  4YBS A;  5ENH A;  4IR6 A;  5HRW A;  3P1E A;  5D25 A;  4NXJ A;  3HMF A;  3D7C A;  4A9F A;  5FE5 A;  4NR6 A;  4YYI A;  5I86 A;  5F63 A;  4TU6 A;  4NRA A;  5L97 A;  5KHM A;  4MR6 A;  4NR7 A;  5F25 A;  5E9K A;  5HEN A;  5ENF A;  4Z6H A;  4YH4 A;  5FH7 A;  4MR5 A;  4O71 A;  4UYD A;  4YYK A;  2DWW A;  3NXB A;  5EU1 A;  5CPE A;  4ZC9 A;  4QSS A;  5C85 A;  3QZV A;  4PKL A;  4O74 A;  5ETB A;  2R0S A;  4QSX A;  4LDF A;  4A9K A;  4YYH A;  3GG3 A;  4CUP A;  4N4H A;  4KV4 A;  5EQ1 A;  4PCI A;  4MR4 A;  2L85 A;  5CRM A;  5A7C A;  4N4G A;  5C7N A;  4O75 A;  2DVV A;  4QC1 A;  5G4R A;  5LVR A;  2MJV B;  3P1D A;  4O7B A;  4YBT A;  4O7A A;  3HME A;  3UV4 A;  4QR4 A;  4QC3 A;  1E6I A;  4TTE A;  5DW1 A;  5CQ7 A;  5DYU A;  4CFK A;  5LKX A;  5KU3 A;  4ZW1 A;  4J3I A;  4OGJ A;  5D7X A;  3FKM X;  4A9H A;  5HRV A;  5LKZ A;  4YBM A;  5HFR A;  2YEK A;  2GRC A;  5EIS A;  5DKD A;  2R10 A;  4WIV A;  4Q0O A;  4YC9 A;  4PS5 A;  4TT4 A;  2R0Y A;  2OUO A;  4N4I A;  4QY4 A;  4UYE A;  2L5E A;  1ZS5 A;  4CUT A;  4TZ2 A;  5TB6 A;  4PY6 A;  5CQ5 A;  4HXP A;  4XYA A;  5E9Y A;  5C4Q A;  5F3A A;  2RNW A;  5DKC A;  5EWV A;  4UIU A;  3U5L A;  1N72 A;  5F5Z A;  4QEV A;  2E7O A;  4TT6 A;  5CY9 A;  5EPB A;  5E3G A;  4NR4 A;  5D3N A;  4LYI A;  5EWW A;  3U5K A;  4Z1S A;  5BT3 A;  4CUU A;  1JM4 B;  5FE8 A;  5A83 A;  5ENC A;  3ZYU A;  5A5S A;  4LZ2 A;  4IR3 A;  4CUR A;  2RNX A;  4YK0 A;  3UV2 A;  4HXO A;  4QSP A;  5CQ6 A;  4OUF A;  3DWY A;  5IG6 A;  4ALG A;  3O37 A;  4UIV A;  5CQA A;  3P1C A;  4KCX A;  3JVJ A;  5CUA A;  4YAD A;  3JVK A;  5CQ8 A;  5F36 A;  5DYA A;  1WUG A;  2RI7 A;  3UVW A;  4C66 A;  4J0S A;  3UVY A;  5EI4 A;  5FG4 A;  5J0D A;  4CFL A;  2DVQ A;  2OSS A;  4X2I A;  4MEO A;  4WHU A;  5II2 A;  5A85 A;  5D26 A;  1WUM A;  4RVR A;  2H60 A;  4A9E A;  4HXR A;  5FB1 A;  3RCW A;  4MR3 A;  5EP7 A;  4QR5 A;  5H1T A;  4QBM A;  4MEN A;  4J1P A;  4NYX A;  4IOO A;  2RS9 B;  5A81 A;  4Z6I A;  5FE0 A;  5E7D A;  5L8T A;  4NUE A;  4YAT A;  5IGK A;  4O77 A;  5DLZ A;  5F1H A;  3HMH A;  5IID A;  5H1U A;  5IBN A;  5I80 A;  5LKU A;  5ETD A;  3K2J A;  5I7Y A;  5F62 A;  5CFW A;  4HBX A;  4A9J A;  5FG5 A;  4QUU A;  4IR4 A;  3O36 A;  4AKN A;  5EA1 A;  4WHW A;  5A5R A;  5TCM A;  4XY9 A;  5FBX A;  5BT4 A;  5E9L A;  5D3J A;  4A9O A;  5HEM A;  4IR5 A;  4YYJ A;  2RFJ A;  4TQN A;  4QNS A;  5EK9 A;  5KTX A;  2DAT A;  4QR3 A;  4HXM A;  3I3J A;  4CUQ A;  5FB0 A;  2E7N A;  5CUE A;  5ENJ A;  3MUL A;  3G0J A;  4NR8 A;  3IU6 A;  3JVM A;  5EPS A;  3SVH A;  3ONI A;  4NR9 A;  3MQM A;  3IU5 A;  5II1 A;  3P5O A;  4PCE A;  3U5J A;  4LR6 A;  3O33 A;  4NYW A;  5DKH A;  5D3S A;  2KTB B;  4UYH A;  5HQ5 A;  4QB3 A;  5CUC A;  2RNY A;  5CQ3 A;  5FE6 A;  5FE4 A;  3TLP A;  5I40 A;  5I83 A;  4YYG A;  4NRC A;  4BW2 A;  5A5O A;  2F6J A;  2WP1 A;  2NXB A;  5C8G A;  4FLP A;  5E73 A;  4CUS A;  3S91 A;  2E3K A;  4LC2 A;  5CUG A;  5CP5 A;  4HBW A;  4UIX A;  5DLX A;  5F1L A;  4YH3 A;  5JI8 A;  4QZS A;  5LJ0 A;  3U5N A;  5HRX A;  5IGM A;  3P1F A;  2D82 A;  5D3H A;  5DFD A;  5CRZ A;  5KTW A;  5BT5 A;  4QYL A;  5HM0 A;  4QSR A;  5G4S A;  4NS5 A;  5E9M A;  5I89 A;  2FSA A;  5F61 A;  4XUB A;  2DKW A;  2N9G A;  5DX4 A;  5EWC A;  5ENE A;  5AD3 A;  5EWD A;  4DON A;  2LSP B;  4QEU A;  5LVQ A;  4UYF B;  4NQM A;  3DAI A;  5A5Q A;  4MEP A;  4BJX A;  3UVX A;  3AQA A;  3LQH A;  5D3P A;  4A9L A;  4O70 A;  4HXL A;  3UV5 A;  5FE2 A;  5LUU A;  4NQN A;  4UYG A;  5A5N A;  4OGI A;  5EVA A;  4N3W A;  5HCL A;  5I1Q A;  5DYC A;  3G0L A;  5E3D A;  5K29 A;  4QEW A;  4LRG A;  5CUB A;  5FG6 A;  2YQD A;  5CS8 A;  4TU4 A;  4TYL A;  5LKT A;  4NRB A;  4UIT A;  5D3L A;  5FH6 A;  5DBM A;  4IOR A;  5JWM A;  4Z93 A;  4A9M A;  5LJ1 A;  5A82 A;  2YDW A;  4O7F A;  5CU8 A;  1EQF A;  3MXF A;  5EIC A;  5HLS A;  5H85 A;  4LZR A;  5E9I A;  4UYF A;  5EPR A;  5H1V A;  5KO4 A;  4YYD A;  5I29 A;  2R0V A;  4TT2 A;  3LQJ A;  4QUT A;  5IGL A;  5D24 A;  5F60 A;  5L96 A;  3SVG A;  5HFQ A;  5CUD A;  5L98 A;  2YEM A;  4KV1 A;  3UW9 A;  2G4A A;  5EV9 A;  2YW5 A;  3JVL A;  5HQ7 A;  4ALH A;  4UIY A;  4QSQ A;  5CQ4 A;  2WP2 A;  4J0R A;  5DY7 A;  5EGU A;  4HBV A;  4GPJ A;  4QSU A;  4XUA A;  5D3T A;  5DFC A;  5DFB A;  1F68 A;  3LXJ A;  4YYM A;  5CZG A;  3O34 A;  3UVD A;  4BW1 A;  4PTB A;  3O35 A;  4QSW A;  4TZ8 A;  2F6N A;  5A5P A;  5E74 A;  3AAD A;  4A9I A;  1JSP B;  2RO1 A;  5LJ2 A;  4O76 A;  5COI A;  4ZQL A;  4LYW A;  5I88 A;  4NYV A;  4O7E A;  3LQI A;  5FFY A;  3Q2F A;  3MB4 A;  4CLB A;  5EM3 A;  4BW4 A;  4UIZ A;  4LYS A;  2DVR A;  5HEL A;  3MB3 A;  5EWH A;  3U5P A;  3Q2E A;  5AD2 A;  5C89 A;  4A9N A;  5E9V A;  4O7C A;  4YAX A;  4Q0N A;  2D9E A;  3QZS A;  1X0J A;  4Z1Q A;  2L84 A;  4NUD A;  5KTU A;  2I7K A;  4NUC A;  5FE9 A;  4O78 A;  4HXS A;  5I7X A;  4HXK A;  5CTL A;  4E96 A;  4YYN A;  5CQT A;  4YY6 A;  5HQ6 A;  3SVF A;  2YYN A;  4F3I A;  4YY4 A;  5FH8 A;  3U5M A;  4Y03 A;  5C87 A;  3QZT A;  5F2P A;  5L99 A;  5DW2 A;  5FDZ A;  5FE3 A;  5FFV A;  5HJC A;  5AMF A;  5D3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...