5F36A

Crystal structure of the bromodomain of human atad2 in complex with compound a12
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title To be pubulished
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 55
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5f36A00
4ALGA 4QEVA 4UYGA 5E9MA 5CUDA 4YY6A 2YEMA 2RNYA 4YABA 5D25A 5D26A 4NR4A 3U5MA 4NRCA 4O76A 4TQNA 4IR4A 4YH4A 4N3WA 3MQMA 2F6JA 4YBSA 4UYFB 4YYHA 3UV2A 4WHWA 3O36A 4YBTA 5AD2A 5HRXA 5EWHA 1N72A 3DWYA 5D3SA 1ZS5A 5CQ6A 5EPSA 3UV4A 5D3RA 5DBMA 5KTXA 5I86A 4O75A 5DY7A 5H85A 5F60A 5A5NA 2YELA 4QUTA 4MEQA 3K2JA 4YADA 5EV9A 4BW1A 5CRZA 5F2PA 5I88A 3Q2EA 2I7KA 4HXMA 4UIZA 5CQ7A 3AQAA 5L97A 4ZQLA 3DAIA 2RI7A 4QSWA 4IORA 5FFVA 3LJWA 4NUEA 4O70A 5FE1A 4O77A 4O7BA 4YH3A 4O7FA 3JVKA 4HBYA 2N9GA 5CS8A 4UIUA 4QYLA 5E9YA 5KU3A 4N4IA 5ENFA 4YYIA 4UYHA 5C4QA 5EWDA 5LKUA 4BJXA 4J0RA 4HBXA 4O74A 4A9KA 5CQ4A 2GRCA 4Z1QA 5DW1A 4TTEA 3I3JA 4ALHA 4IR5A 4J0SA 5ETDA 4Y03A 5A83A 5CQ8A 5A7CA 1WUGA 2F6NA 5EGUA 3P1FA 4A9FA 5HRVA 4QC1A 3O33A 4PCIA 4NYVA 5CQTA 5F25A 5F36A 4RVRA 5D3TA 3U5JA 4WIVA 5HJCA 4XY9A 4LYIA 3O37A 4QUUA 4N4HA 5AMFA 4YAXA 4NYWA 3SVGA 4YK0A 4CFKA 1JM4B 5LVQA 4TYLA 4XYAA 2E7OA 3MB3A 4TT6A 5FG5A 5HENA 5E9VA 4MR5A 5F62A 5D3HA 3FKMX 5HEMA 4HXRA 3UVXA 3P1DA 4YYMA 4QSPA 3S91A 4IOQA 5H1VA 4LZRA 4NQNA 5LKTA 4NR5A 5HLSA 5FFYA 2DVSA 5FE5A 5CRMA 1E6IA 4YC9A 5EWVA 5FE6A 5HRWA 3LQJA 3IU6A 4PKLA 3HMFA 4QR3A 4J1PA 2RNWA 3QZSA 2YYNA 5E9LA 5FE0A 5DYUA 4QR4A 5DLZA 4A9HA 5KO4A 4C66A 5TB6A 2L85A 5CUGA 5HM0A 3JVMA 5EA1A 4LC2A 5DYXA 4F3IA 2D9EA 4J3IA 5D7XA 5FFWA 5CQAA 4QSXA 4O72A 5FDZA 2R10A 4Q0NA 5EK9A 3U5KA 4IR3A 5CFWA 5DLXA 2R0VA 5A5QA 5FG4A 5G4RA 3QZVA 4UIWA 4CURA 5I1QA 2D82A 4ZW1A 5IBNA 5FH8A 2OUOA 4NUDA 4TT4A 3MB4A 5ENCA 4LZ2A 4MR6A 3JVLA 5LKZA 5L8TA 5ENEA 3AADA 3MUKA 5FE7A 4UYEA 5DW2A 5JI8A 4E96A 4CLBA 2WP1A 3NXBA 3UVYA 4CUUA 4CUTA 2LSPB 1WUMA 5H1TA 4A9NA 4TU4A 5AMEA 5A5OA 5A5SA 4KV4A 3U5LA 4MR4A 5I80A 4TT2A 4HXPA 2I8NA 2R0YA 5FH7A 3QZTA 4GPJA 5D24A 4QSSA 2OSSA 5E9KA 4CUPA 5HQ5A 5L99A 5G4SA 5C8GA 5L96A 4PTBA 5CGPA 5CUEA 5FE9A 4A9MA 2KTBB 4TS8A 3JVJA 2RFJA 5EICA 5I89A 2L5EA 3P1CA 4N4FA 5H1UA 5LJ2A 3UW9A 5E7DA 5EP7A 4NR7A 5E74A 3TLPA 5C85A 4NYXA 4NR9A 4UIVA 5I7YA 5ETBA 4OGIA 4OGJA 3RCWA 5LJ1A 5A82A 4HXLA 4C67A 5IGNA 5F1HA 4A9JA 3GG3A 5EQ1A 5HELA 5CP5A 4O7AA 5LVRA 4UITA 5C7NA 4QSQA 3U5NA 5IGMA 3O35A 4NQMA 5IIDA 2DVQA 4TU6A 5HCLA 4NRBA 4PCEA 1EQFA 4QSTA 2G4AA 2RO1A 4MEOA 4CUQA 3O34A 4YYKA 4QZSA 4CUSA 5DFDA 4UYDA 5F5ZA 5BT3A 4YATA 5DX4A 5II2A 4UIYA 4X2IA 3P5OA 4QNSA 4QSVA 4LDFA 3IU5A 4Q0OA 4HXOA 4UYFA 3UVDA 4YBMA 4KV1A 5BT5A 5D0CA 5E73A 2NXBA 5II1A 2L84A 5EPBA 5CPEA 2DKWA 4BHWA 4QEWA 4XUBA 5KTUA 5I29A 5LKXA 2OO1A 5DFBA 4PY6A 4TZ8A 5F63A 4N4GA 4NS5A 5FH6A 5CUBA 5FB0A 3MULA 4Z93A 5E9IA 3UVWA 5HQ7A 5A81A 2DVVA 5CTLA 5CY9A 5D3JA 2FSAA 2YQDA 4QC3A 5E3GA 4Z6HA 4MR3A 5DYAA 4NUCA 5KTWA 4Z6IA 4QSRA 2WP2A 5E0RA 4O71A 4AKNA 5AD3A 4FLPA 3ZYUA 4A9IA 4O78A 5L98A 2RS9B 3U5OA 5I83A 4Z1SA 2R0SA 4BW2A 5EPRA 2DATA 3G0LA 5C89A 4PS5A 3LXJA 5A5RA 5DFCA 3MXFA 3G0JA 4DONA 4LYWA 5EISA 2E7NA 3ONIA 4HXNA 5FE3A 5CQ5A 4OUFA 5D3NA 5DYCA 4QY4A 4A9LA 4KCXA 3U5PA 5ENJA 4MEPA 5CZGA 5FBXA 3P1EA 5FE8A 5CU8A 4NR6A 4QR5A 5JWMA 5LUUA 3HMEA 5BT4A 4LZSA 5EI4A 5D3PA 4ZC9A 2YEKA 1JSPB 3Q2FA 5A85A 5D3LA 5EM3A 5FE2A 5IG6A 5CUCA 5FB1A 4QEUA 4HXSA 4HBWA 5ENHA 5J0DA 5LJ0A 5DKHA 3SVHA 4XY8A 4IR6A 5HFQA 4TZ2A 4YY4A 2E3KA 2YW5A 4NXJA 5L8UA 3D7CA 4UIXA 2YDWA 4WHUA 5ENIA 5ACYA 4NRAA 4BW3A 5EWWA 4HXKA 4YYGA 4A9EA 5K29A 4QSUA 5IGLA 5I40A 1F68A 3UV5A 5I7XA 2DVRA 2MJVB 5CQ3A 5EWCA 4QBMA 4YYJA 5A5PA 3SVFA 4LYSA 2DWWA 3S92A 4BW4A 3LQHA 5HFRA 5HQ6A 5TCMA 1X0JA 3HMHA 5DKDA 2H60A 5EU1A 2RNXA 5FG6A 5FE4A 4O7EA 4QB3A 5IGKA 5C87A 4CL9A 5EVAA 4IOOA 4XUAA 5KHMA 4HBVA 4YYDA 4A9OA 5ENGA 4YYNA 4O7CA 4QYDA 5CUAA 5F3AA 5F1LA 5E3DA 4MENA 4CFLA 4LRGA 4NR8A 3LQIA 5COIA 5DKCA 5F61A 5ENBA 4LR6A
chains in the Genus database with same CATH superfamily
4ALGA 4QEVA 4UYGA 3VKHA 5E9MA 5CUDA 4YY6A 2YEMA 2RNYA 4YABA 5D25A 5D26A 4NR4A 3U5MA 4NRCA 4O76A 4TQNA 4IR4A 4YH4A 4N3WA 3MQMA 2F6JA 4YBSA 4UYFB 4YYHA 3UV2A 4WHWA 3D1DA 3O36A 4YBTA 5AD2A 5HRXA 5EWHA 1N72A 3DWYA 5D3SA 1ZS5A 5CQ6A 5EPSA 3UV4A 5D3RA 5DBMA 5KTXA 5I86A 4O75A 5DY7A 5H85A 5F60A 5A5NA 2YELA 4QUTA 4MEQA 3K2JA 4YADA 5EV9A 4BW1A 5CRZA 5F2PA 5I88A 3Q2EA 2I7KA 4HXMA 4UIZA 5CQ7A 3AQAA 5L97A 4ZQLA 1ZKRA 3DAIA 2RI7A 4QSWA 4IORA 5FFVA 3LJWA 4NUEA 4O70A 5FE1A 4O77A 4O7BA 4YH3A 4O7FA 3JVKA 4HBYA 2N9GA 5CS8A 4UIUA 4QYLA 5E9YA 5KU3A 4N4IA 5ENFA 4YYIA 4UYHA 5C4QA 5EWDA 5LKUA 4BJXA 4J0RA 4HBXA 4O74A 4A9KA 5CQ4A 2GRCA 4Z1QA 5DW1A 4TTEA 3I3JA 4ALHA 4IR5A 4J0SA 5ETDA 4Y03A 5A83A 5CQ8A 5A7CA 1WUGA 2F6NA 5EGUA 3P1FA 4A9FA 5HRVA 4QC1A 3O33A 4PCIA 4NYVA 5CQTA 5F25A 5F36A 4RVRA 5D3TA 3U5JA 4WIVA 5HJCA 4XY9A 4LYIA 3O37A 4QUUA 4N4HA 5AMFA 4YAXA 4NYWA 3SVGA 4YK0A 4CFKA 1JM4B 5LVQA 4TYLA 4XYAA 3D1BA 2E7OA 3MB3A 4TT6A 5FG5A 5HENA 5E9VA 4MR5A 5F62A 5D3HA 3FKMX 5HEMA 4HXRA 3UVXA 3P1DA 4YYMA 4QSPA 3S91A 4IOQA 5H1VA 4LZRA 4NQNA 5LKTA 4NR5A 5HLSA 5FFYA 2DVSA 5FE5A 5CRMA 1E6IA 4YC9A 5EWVA 5FE6A 5HRWA 3LQJA 3IU6A 4PKLA 3HMFA 4QR3A 4J1PA 2RNWA 2EJNA 3QZSA 2YYNA 5E9LA 5FE0A 5DYUA 4QR4A 5DLZA 4A9HA 5KO4A 4C66A 5TB6A 2L85A 5CUGA 5HM0A 3JVMA 5EA1A 4LC2A 5DYXA 4F3IA 2D9EA 4J3IA 5D7XA 5FFWA 5CQAA 4QSXA 4O72A 5FDZA 2R10A 4Q0NA 5EK9A 3U5KA 4IR3A 5CFWA 5DLXA 2R0VA 5A5QA 5FG4A 5G4RA 3QZVA 4UIWA 4CURA 5I1QA 2D82A 4ZW1A 5IBNA 5FH8A 2OUOA 4NUDA 4TT4A 3MB4A 5ENCA 4LZ2A 4MR6A 3JVLA 5LKZA 5L8TA 5ENEA 3AADA 3MUKA 5FE7A 4UYEA 5DW2A 5JI8A 4AI6A 4E96A 4CLBA 2WP1A 3NXBA 3UVYA 4CUUA 4CUTA 2LSPB 1WUMA 5H1TA 4A9NA 4TU4A 5AMEA 5A5OA 5A5SA 4KV4A 3U5LA 4MR4A 5I80A 4TT2A 4HXPA 2I8NA 2R0YA 5FH7A 3QZTA 4GPJA 5D24A 4QSSA 2OSSA 5E9KA 4CUPA 5HQ5A 5L99A 5G4SA 5C8GA 5L96A 4PTBA 5CGPA 5CUEA 5FE9A 4A9MA 2KTBB 4TS8A 3JVJA 2RFJA 5EICA 5I89A 2L5EA 3P1CA 4N4FA 5H1UA 5LJ2A 3UW9A 3ERRA 5E7DA 5EP7A 4NR7A 5E74A 3TLPA 5C85A 4NYXA 4NR9A 4UIVA 5I7YA 5ETBA 4OGIA 4OGJA 3RCWA 5LJ1A 5A82A 4HXLA 4C67A 5IGNA 5F1HA 4A9JA 3GG3A 5EQ1A 5HELA 5CP5A 4O7AA 5LVRA 4UITA 5C7NA 4QSQA 3U5NA 5IGMA 3O35A 4NQMA 5IIDA 2DVQA 4TU6A 5HCLA 4NRBA 4PCEA 1EQFA 4QSTA 2G4AA 2RO1A 4MEOA 1PUOA 4CUQA 3O34A 4YYKA 4QZSA 4CUSA 5DFDA 4UYDA 5F5ZA 5BT3A 4YATA 5DX4A 5II2A 4UIYA 4X2IA 3P5OA 4QNSA 4QSVA 4LDFA 3IU5A 4Q0OA 4HXOA 4UYFA 3UVDA 4YBMA 4KV1A 5BT5A 5D0CA 5E73A 2NXBA 5II1A 2L84A 5EPBA 5CPEA 2DKWA 4BHWA 4QEWA 4XUBA 5KTUA 5I29A 5LKXA 2OO1A 5DFBA 4PY6A 4TZ8A 5F63A 4N4GA 4NS5A 5FH6A 5CUBA 5FB0A 3MULA 4Z93A 5E9IA 3UVWA 4AKIA 5HQ7A 5A81A 2DVVA 5CTLA 5CY9A 5D3JA 2FSAA 2YQDA 4QC3A 5E3GA 4Z6HA 4MR3A 5DYAA 4NUCA 5KTWA 4Z6IA 4QSRA 2WP2A 5E0RA 4O71A 4AKNA 5AD3A 4FLPA 3ZYUA 4A9IA 4O78A 5L98A 2RS9B 3U5OA 5I83A 4Z1SA 2R0SA 4BW2A 5EPRA 2DATA 3G0LA 5C89A 4PS5A 3LXJA 5A5RA 5DFCA 3MXFA 3G0JA 4DONA 4LYWA 5EISA 2E7NA 3ONIA 4HXNA 5FE3A 5CQ5A 4OUFA 5D3NA 5DYCA 4QY4A 4A9LA 4KCXA 3U5PA 5ENJA 4MEPA 5CZGA 5FBXA 3P1EA 5FE8A 5CU8A 4NR6A 4QR5A 5JWMA 5LUUA 3HMEA 5BT4A 4LZSA 5EI4A 5D3PA 4ZC9A 2YEKA 1JSPB 3Q2FA 5A85A 5D3LA 5EM3A 5FE2A 5IG6A 5CUCA 5FB1A 4QEUA 4HXSA 4HBWA 5ENHA 5J0DA 5LJ0A 5DKHA 3SVHA 4XY8A 4IR6A 5HFQA 4TZ2A 4YY4A 2E3KA 2YW5A 4NXJA 5L8UA 3D7CA 4UIXA 4AKHA 2YDWA 4WHUA 5ENIA 5ACYA 4NRAA 4BW3A 5EWWA 4HXKA 4YYGA 4A9EA 5K29A 4QSUA 5IGLA 5I40A 1F68A 3UV5A 5I7XA 2DVRA 2MJVB 5CQ3A 5EWCA 4QBMA 4YYJA 5A5PA 3SVFA 4LYSA 2DWWA 3S92A 4BW4A 3LQHA 5HFRA 5HQ6A 5TCMA 1X0JA 3HMHA 5DKDA 2H60A 5EU1A 2RNXA 5FG6A 5FE4A 4O7EA 3VKGA 4AKGA 4QB3A 5IGKA 5C87A 4CL9A 5EVAA 4IOOA 4XUAA 5KHMA 4HBVA 4YYDA 4A9OA 5ENGA 4YYNA 4O7CA 4QYDA 5CUAA 5F3AA 5F1LA 5E3DA 4MENA 4CFLA 4LRGA 4NR8A 3LQIA 5COIA 5DKCA 5F61A 5ENBA 4LR6A
chains in the Genus database with same CATH topology
4ALGA 4QEVA 4UYGA 5E9MA 5CUDA 4YY6A 2YEMA 2RNYA 4YABA 5D25A 5D26A 4NR4A 3U5MA 4NRCA 4O76A 4TQNA 4IR4A 4YH4A 4N3WA 3MQMA 2F6JA 4YBSA 4UYFB 4YYHA 3UV2A 4WHWA 3O36A 4YBTA 5AD2A 5HRXA 5EWHA 1N72A 3DWYA 5D3SA 1ZS5A 5CQ6A 5EPSA 3UV4A 5D3RA 5DBMA 5KTXA 5I86A 4O75A 5DY7A 5H85A 5F60A 5A5NA 2YELA 4QUTA 4MEQA 3K2JA 4YADA 5EV9A 4BW1A 5CRZA 5F2PA 5I88A 3Q2EA 2I7KA 4HXMA 4UIZA 5CQ7A 3AQAA 5L97A 4ZQLA 3DAIA 2RI7A 4QSWA 4IORA 5FFVA 3LJWA 4NUEA 4O70A 5FE1A 4O77A 4O7BA 4YH3A 4O7FA 3JVKA 4HBYA 2N9GA 5CS8A 4UIUA 4QYLA 5E9YA 5KU3A 4N4IA 5ENFA 4YYIA 4UYHA 5C4QA 5EWDA 5LKUA 4BJXA 4J0RA 4HBXA 4O74A 4A9KA 5CQ4A 2GRCA 4Z1QA 5DW1A 4TTEA 3I3JA 4ALHA 4IR5A 4J0SA 5ETDA 4Y03A 5A83A 5CQ8A 5A7CA 1WUGA 2F6NA 5EGUA 3P1FA 4A9FA 5HRVA 4QC1A 3O33A 4PCIA 4NYVA 5CQTA 5F25A 5F36A 4RVRA 5D3TA 3U5JA 4WIVA 5HJCA 4XY9A 4LYIA 3O37A 4QUUA 4N4HA 5AMFA 4YAXA 4NYWA 3SVGA 4YK0A 4CFKA 1JM4B 5LVQA 4TYLA 4XYAA 2E7OA 3MB3A 4TT6A 5FG5A 5HENA 5E9VA 4MR5A 5F62A 5D3HA 3FKMX 5HEMA 4HXRA 3UVXA 3P1DA 4YYMA 4QSPA 3S91A 4IOQA 5H1VA 4LZRA 4NQNA 5LKTA 4NR5A 5HLSA 5FFYA 2DVSA 5FE5A 5CRMA 1E6IA 4YC9A 5EWVA 5FE6A 5HRWA 3LQJA 3IU6A 4PKLA 3HMFA 4QR3A 4J1PA 2RNWA 3QZSA 2YYNA 5E9LA 5FE0A 5DYUA 4QR4A 5DLZA 4A9HA 5KO4A 4C66A 5TB6A 2L85A 5CUGA 5HM0A 3JVMA 5EA1A 4LC2A 5DYXA 4F3IA 2D9EA 4J3IA 5D7XA 5FFWA 5CQAA 4QSXA 4O72A 5FDZA 2R10A 4Q0NA 5EK9A 3U5KA 4IR3A 5CFWA 5DLXA 2R0VA 5A5QA 5FG4A 5G4RA 3QZVA 4UIWA 4CURA 5I1QA 2D82A 4ZW1A 5IBNA 5FH8A 2OUOA 4NUDA 4TT4A 3MB4A 5ENCA 4LZ2A 4MR6A 3JVLA 5LKZA 5L8TA 5ENEA 3AADA 3MUKA 5FE7A 4UYEA 5DW2A 5JI8A 4E96A 4CLBA 2WP1A 3NXBA 3UVYA 4CUUA 4CUTA 2LSPB 1WUMA 5H1TA 4A9NA 4TU4A 5AMEA 5A5OA 5A5SA 4KV4A 3U5LA 4MR4A 5I80A 4TT2A 4HXPA 2I8NA 2R0YA 5FH7A 3QZTA 4GPJA 5D24A 4QSSA 2OSSA 5E9KA 4CUPA 5HQ5A 5L99A 5G4SA 5C8GA 5L96A 4PTBA 5CGPA 5CUEA 5FE9A 4A9MA 2KTBB 4TS8A 3JVJA 2RFJA 5EICA 5I89A 2L5EA 3P1CA 4N4FA 5H1UA 5LJ2A 3UW9A 5E7DA 5EP7A 4NR7A 5E74A 3TLPA 5C85A 4NYXA 4NR9A 4UIVA 5I7YA 5ETBA 4OGIA 4OGJA 3RCWA 5LJ1A 5A82A 4HXLA 4C67A 5IGNA 5F1HA 4A9JA 3GG3A 5EQ1A 5HELA 5CP5A 4O7AA 5LVRA 4UITA 5C7NA 4QSQA 3U5NA 5IGMA 3O35A 4NQMA 5IIDA 2DVQA 4TU6A 5HCLA 4NRBA 4PCEA 1EQFA 4QSTA 2G4AA 2RO1A 4MEOA 4CUQA 3O34A 4YYKA 4QZSA 4CUSA 5DFDA 4UYDA 5F5ZA 5BT3A 4YATA 5DX4A 5II2A 4UIYA 4X2IA 3P5OA 4QNSA 4QSVA 4LDFA 3IU5A 4Q0OA 4HXOA 4UYFA 3UVDA 4YBMA 4KV1A 5BT5A 5D0CA 5E73A 2NXBA 5II1A 2L84A 5EPBA 5CPEA 2DKWA 4BHWA 4QEWA 4XUBA 5KTUA 5I29A 5LKXA 2OO1A 5DFBA 4PY6A 4TZ8A 5F63A 4N4GA 4NS5A 5FH6A 5CUBA 5FB0A 3MULA 4Z93A 5E9IA 3UVWA 5HQ7A 5A81A 2DVVA 5CTLA 5CY9A 5D3JA 2FSAA 2YQDA 4QC3A 5E3GA 4Z6HA 4MR3A 5DYAA 4NUCA 5KTWA 4Z6IA 4QSRA 2WP2A 5E0RA 4O71A 4AKNA 5AD3A 4FLPA 3ZYUA 4A9IA 4O78A 5L98A 2RS9B 3U5OA 5I83A 4Z1SA 2R0SA 4BW2A 5EPRA 2DATA 3G0LA 5C89A 4PS5A 3LXJA 5A5RA 5DFCA 3MXFA 3G0JA 4DONA 4LYWA 5EISA 2E7NA 3ONIA 4HXNA 5FE3A 5CQ5A 4OUFA 5D3NA 5DYCA 4QY4A 4A9LA 4KCXA 3U5PA 5ENJA 4MEPA 5CZGA 5FBXA 3P1EA 5FE8A 5CU8A 4NR6A 4QR5A 5JWMA 5LUUA 3HMEA 5BT4A 4LZSA 5EI4A 5D3PA 4ZC9A 2YEKA 1JSPB 3Q2FA 5A85A 5D3LA 5EM3A 5FE2A 5IG6A 5CUCA 5FB1A 4QEUA 4HXSA 4HBWA 5ENHA 5J0DA 5LJ0A 5DKHA 3SVHA 4XY8A 4IR6A 5HFQA 4TZ2A 4YY4A 2E3KA 2YW5A 4NXJA 5L8UA 3D7CA 4UIXA 2YDWA 4WHUA 5ENIA 5ACYA 4NRAA 4BW3A 5EWWA 4HXKA 4YYGA 4A9EA 5K29A 4QSUA 5IGLA 5I40A 1F68A 3UV5A 5I7XA 2DVRA 2MJVB 5CQ3A 5EWCA 4QBMA 4YYJA 5A5PA 3SVFA 4LYSA 2DWWA 3S92A 4BW4A 3LQHA 5HFRA 5HQ6A 5TCMA 1X0JA 3HMHA 5DKDA 2H60A 5EU1A 2RNXA 5FG6A 5FE4A 4O7EA 4QB3A 5IGKA 5C87A 4CL9A 5EVAA 4IOOA 4XUAA 5KHMA 4HBVA 4YYDA 4A9OA 5ENGA 4YYNA 4O7CA 4QYDA 5CUAA 5F3AA 5F1LA 5E3DA 4MENA 4CFLA 4LRGA 4NR8A 3LQIA 5COIA 5DKCA 5F61A 5ENBA 4LR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ALG A;  4QEV A;  4UYG A;  5E9M A;  5CUD A;  4YY6 A;  2YEM A;  2RNY A;  4YAB A;  5D25 A;  5D26 A;  4NR4 A;  3U5M A;  4NRC A;  4O76 A;  4TQN A;  4IR4 A;  4YH4 A;  4N3W A;  3MQM A;  2F6J A;  4YBS A;  4UYF B;  4YYH A;  3UV2 A;  4WHW A;  3O36 A;  4YBT A;  5AD2 A;  5HRX A;  5EWH A;  1N72 A;  3DWY A;  5D3S A;  1ZS5 A;  5CQ6 A;  5EPS A;  3UV4 A;  5D3R A;  5DBM A;  5KTX A;  5I86 A;  4O75 A;  5DY7 A;  5H85 A;  5F60 A;  5A5N A;  2YEL A;  4QUT A;  4MEQ A;  3K2J A;  4YAD A;  5EV9 A;  4BW1 A;  5CRZ A;  5F2P A;  5I88 A;  3Q2E A;  2I7K A;  4HXM A;  4UIZ A;  5CQ7 A;  3AQA A;  5L97 A;  4ZQL A;  3DAI A;  2RI7 A;  4QSW A;  4IOR A;  5FFV A;  3LJW A;  4NUE A;  4O70 A;  5FE1 A;  4O77 A;  4O7B A;  4YH3 A;  4O7F A;  3JVK A;  4HBY A;  2N9G A;  5CS8 A;  4UIU A;  4QYL A;  5E9Y A;  5KU3 A;  4N4I A;  5ENF A;  4YYI A;  4UYH A;  5C4Q A;  5EWD A;  5LKU A;  4BJX A;  4J0R A;  4HBX A;  4O74 A;  4A9K A;  5CQ4 A;  2GRC A;  4Z1Q A;  5DW1 A;  4TTE A;  3I3J A;  4ALH A;  4IR5 A;  4J0S A;  5ETD A;  4Y03 A;  5A83 A;  5CQ8 A;  5A7C A;  1WUG A;  2F6N A;  5EGU A;  3P1F A;  4A9F A;  5HRV A;  4QC1 A;  3O33 A;  4PCI A;  4NYV A;  5CQT A;  5F25 A;  5F36 A;  4RVR A;  5D3T A;  3U5J A;  4WIV A;  5HJC A;  4XY9 A;  4LYI A;  3O37 A;  4QUU A;  4N4H A;  5AMF A;  4YAX A;  4NYW A;  3SVG A;  4YK0 A;  4CFK A;  1JM4 B;  5LVQ A;  4TYL A;  4XYA A;  2E7O A;  3MB3 A;  4TT6 A;  5FG5 A;  5HEN A;  5E9V A;  4MR5 A;  5F62 A;  5D3H A;  3FKM X;  5HEM A;  4HXR A;  3UVX A;  3P1D A;  4YYM A;  4QSP A;  3S91 A;  4IOQ A;  5H1V A;  4LZR A;  4NQN A;  5LKT A;  4NR5 A;  5HLS A;  5FFY A;  2DVS A;  5FE5 A;  5CRM A;  1E6I A;  4YC9 A;  5EWV A;  5FE6 A;  5HRW A;  3LQJ A;  3IU6 A;  4PKL A;  3HMF A;  4QR3 A;  4J1P A;  2RNW A;  3QZS A;  2YYN A;  5E9L A;  5FE0 A;  5DYU A;  4QR4 A;  5DLZ A;  4A9H A;  5KO4 A;  4C66 A;  5TB6 A;  2L85 A;  5CUG A;  5HM0 A;  3JVM A;  5EA1 A;  4LC2 A;  5DYX A;  4F3I A;  2D9E A;  4J3I A;  5D7X A;  5FFW A;  5CQA A;  4QSX A;  4O72 A;  5FDZ A;  2R10 A;  4Q0N A;  5EK9 A;  3U5K A;  4IR3 A;  5CFW A;  5DLX A;  2R0V A;  5A5Q A;  5FG4 A;  5G4R A;  3QZV A;  4UIW A;  4CUR A;  5I1Q A;  2D82 A;  4ZW1 A;  5IBN A;  5FH8 A;  2OUO A;  4NUD A;  4TT4 A;  3MB4 A;  5ENC A;  4LZ2 A;  4MR6 A;  3JVL A;  5LKZ A;  5L8T A;  5ENE A;  3AAD A;  3MUK A;  5FE7 A;  4UYE A;  5DW2 A;  5JI8 A;  4E96 A;  4CLB A;  2WP1 A;  3NXB A;  3UVY A;  4CUU A;  4CUT A;  2LSP B;  1WUM A;  5H1T A;  4A9N A;  4TU4 A;  5AME A;  5A5O A;  5A5S A;  4KV4 A;  3U5L A;  4MR4 A;  5I80 A;  4TT2 A;  4HXP A;  2I8N A;  2R0Y A;  5FH7 A;  3QZT A;  4GPJ A;  5D24 A;  4QSS A;  2OSS A;  5E9K A;  4CUP A;  5HQ5 A;  5L99 A;  5G4S A;  5C8G A;  5L96 A;  4PTB A;  5CGP A;  5CUE A;  5FE9 A;  4A9M A;  2KTB B;  4TS8 A;  3JVJ A;  2RFJ A;  5EIC A;  5I89 A;  2L5E A;  3P1C A;  4N4F A;  5H1U A;  5LJ2 A;  3UW9 A;  5E7D A;  5EP7 A;  4NR7 A;  5E74 A;  3TLP A;  5C85 A;  4NYX A;  4NR9 A;  4UIV A;  5I7Y A;  5ETB A;  4OGI A;  4OGJ A;  3RCW A;  5LJ1 A;  5A82 A;  4HXL A;  4C67 A;  5IGN A;  5F1H A;  4A9J A;  3GG3 A;  5EQ1 A;  5HEL A;  5CP5 A;  4O7A A;  5LVR A;  4UIT A;  5C7N A;  4QSQ A;  3U5N A;  5IGM A;  3O35 A;  4NQM A;  5IID A;  2DVQ A;  4TU6 A;  5HCL A;  4NRB A;  4PCE A;  1EQF A;  4QST A;  2G4A A;  2RO1 A;  4MEO A;  4CUQ A;  3O34 A;  4YYK A;  4QZS A;  4CUS A;  5DFD A;  4UYD A;  5F5Z A;  5BT3 A;  4YAT A;  5DX4 A;  5II2 A;  4UIY A;  4X2I A;  3P5O A;  4QNS A;  4QSV A;  4LDF A;  3IU5 A;  4Q0O A;  4HXO A;  4UYF A;  3UVD A;  4YBM A;  4KV1 A;  5BT5 A;  5D0C A;  5E73 A;  2NXB A;  5II1 A;  2L84 A;  5EPB A;  5CPE A;  2DKW A;  4BHW A;  4QEW A;  4XUB A;  5KTU A;  5I29 A;  5LKX A;  2OO1 A;  5DFB A;  4PY6 A;  4TZ8 A;  5F63 A;  4N4G A;  4NS5 A;  5FH6 A;  5CUB A;  5FB0 A;  3MUL A;  4Z93 A;  5E9I A;  3UVW A;  5HQ7 A;  5A81 A;  2DVV A;  5CTL A;  5CY9 A;  5D3J A;  2FSA A;  2YQD A;  4QC3 A;  5E3G A;  4Z6H A;  4MR3 A;  5DYA A;  4NUC A;  5KTW A;  4Z6I A;  4QSR A;  2WP2 A;  5E0R A;  4O71 A;  4AKN A;  5AD3 A;  4FLP A;  3ZYU A;  4A9I A;  4O78 A;  5L98 A;  2RS9 B;  3U5O A;  5I83 A;  4Z1S A;  2R0S A;  4BW2 A;  5EPR A;  2DAT A;  3G0L A;  5C89 A;  4PS5 A;  3LXJ A;  5A5R A;  5DFC A;  3MXF A;  3G0J A;  4DON A;  4LYW A;  5EIS A;  2E7N A;  3ONI A;  4HXN A;  5FE3 A;  5CQ5 A;  4OUF A;  5D3N A;  5DYC A;  4QY4 A;  4A9L A;  4KCX A;  3U5P A;  5ENJ A;  4MEP A;  5CZG A;  5FBX A;  3P1E A;  5FE8 A;  5CU8 A;  4NR6 A;  4QR5 A;  5JWM A;  5LUU A;  3HME A;  5BT4 A;  4LZS A;  5EI4 A;  5D3P A;  4ZC9 A;  2YEK A;  1JSP B;  3Q2F A;  5A85 A;  5D3L A;  5EM3 A;  5FE2 A;  5IG6 A;  5CUC A;  5FB1 A;  4QEU A;  4HXS A;  4HBW A;  5ENH A;  5J0D A;  5LJ0 A;  5DKH A;  3SVH A;  4XY8 A;  4IR6 A;  5HFQ A;  4TZ2 A;  4YY4 A;  2E3K A;  2YW5 A;  4NXJ A;  5L8U A;  3D7C A;  4UIX A;  2YDW A;  4WHU A;  5ENI A;  5ACY A;  4NRA A;  4BW3 A;  5EWW A;  4HXK A;  4YYG A;  4A9E A;  5K29 A;  4QSU A;  5IGL A;  5I40 A;  1F68 A;  3UV5 A;  5I7X A;  2DVR A;  2MJV B;  5CQ3 A;  5EWC A;  4QBM A;  4YYJ A;  5A5P A;  3SVF A;  4LYS A;  2DWW A;  3S92 A;  4BW4 A;  3LQH A;  5HFR A;  5HQ6 A;  5TCM A;  1X0J A;  3HMH A;  5DKD A;  2H60 A;  5EU1 A;  2RNX A;  5FG6 A;  5FE4 A;  4O7E A;  4QB3 A;  5IGK A;  5C87 A;  4CL9 A;  5EVA A;  4IOO A;  4XUA A;  5KHM A;  4HBV A;  4YYD A;  4A9O A;  5ENG A;  4YYN A;  4O7C A;  4QYD A;  5CUA A;  5F3A A;  5F1L A;  5E3D A;  4MEN A;  4CFL A;  4LRG A;  4NR8 A;  3LQI A;  5COI A;  5DKC A;  5F61 A;  5ENB A;  4LR6 A; 
#chains in the Genus database with same CATH topology
 4ALG A;  4QEV A;  4UYG A;  3VKH A;  5E9M A;  5CUD A;  4YY6 A;  2YEM A;  2RNY A;  4YAB A;  5D25 A;  5D26 A;  4NR4 A;  3U5M A;  4NRC A;  4O76 A;  4TQN A;  4IR4 A;  4YH4 A;  4N3W A;  3MQM A;  2F6J A;  4YBS A;  4UYF B;  4YYH A;  3UV2 A;  4WHW A;  3D1D A;  3O36 A;  4YBT A;  5AD2 A;  5HRX A;  5EWH A;  1N72 A;  3DWY A;  5D3S A;  1ZS5 A;  5CQ6 A;  5EPS A;  3UV4 A;  5D3R A;  5DBM A;  5KTX A;  5I86 A;  4O75 A;  5DY7 A;  5H85 A;  5F60 A;  5A5N A;  2YEL A;  4QUT A;  4MEQ A;  3K2J A;  4YAD A;  5EV9 A;  4BW1 A;  5CRZ A;  5F2P A;  5I88 A;  3Q2E A;  2I7K A;  4HXM A;  4UIZ A;  5CQ7 A;  3AQA A;  5L97 A;  4ZQL A;  1ZKR A;  3DAI A;  2RI7 A;  4QSW A;  4IOR A;  5FFV A;  3LJW A;  4NUE A;  4O70 A;  5FE1 A;  4O77 A;  4O7B A;  4YH3 A;  4O7F A;  3JVK A;  4HBY A;  2N9G A;  5CS8 A;  4UIU A;  4QYL A;  5E9Y A;  5KU3 A;  4N4I A;  5ENF A;  4YYI A;  4UYH A;  5C4Q A;  5EWD A;  5LKU A;  4BJX A;  4J0R A;  4HBX A;  4O74 A;  4A9K A;  5CQ4 A;  2GRC A;  4Z1Q A;  5DW1 A;  4TTE A;  3I3J A;  4ALH A;  4IR5 A;  4J0S A;  5ETD A;  4Y03 A;  5A83 A;  5CQ8 A;  5A7C A;  1WUG A;  2F6N A;  5EGU A;  3P1F A;  4A9F A;  5HRV A;  4QC1 A;  3O33 A;  4PCI A;  4NYV A;  5CQT A;  5F25 A;  5F36 A;  4RVR A;  5D3T A;  3U5J A;  4WIV A;  5HJC A;  4XY9 A;  4LYI A;  3O37 A;  4QUU A;  4N4H A;  5AMF A;  4YAX A;  4NYW A;  3SVG A;  4YK0 A;  4CFK A;  1JM4 B;  5LVQ A;  4TYL A;  4XYA A;  3D1B A;  2E7O A;  3MB3 A;  4TT6 A;  5FG5 A;  5HEN A;  5E9V A;  4MR5 A;  5F62 A;  5D3H A;  3FKM X;  5HEM A;  4HXR A;  3UVX A;  3P1D A;  4YYM A;  4QSP A;  3S91 A;  4IOQ A;  5H1V A;  4LZR A;  4NQN A;  5LKT A;  4NR5 A;  5HLS A;  5FFY A;  2DVS A;  5FE5 A;  5CRM A;  1E6I A;  4YC9 A;  5EWV A;  5FE6 A;  5HRW A;  3LQJ A;  3IU6 A;  4PKL A;  3HMF A;  4QR3 A;  4J1P A;  2RNW A;  2EJN A;  3QZS A;  2YYN A;  5E9L A;  5FE0 A;  5DYU A;  4QR4 A;  5DLZ A;  4A9H A;  5KO4 A;  4C66 A;  5TB6 A;  2L85 A;  5CUG A;  5HM0 A;  3JVM A;  5EA1 A;  4LC2 A;  5DYX A;  4F3I A;  2D9E A;  4J3I A;  5D7X A;  5FFW A;  5CQA A;  4QSX A;  4O72 A;  5FDZ A;  2R10 A;  4Q0N A;  5EK9 A;  3U5K A;  4IR3 A;  5CFW A;  5DLX A;  2R0V A;  5A5Q A;  5FG4 A;  5G4R A;  3QZV A;  4UIW A;  4CUR A;  5I1Q A;  2D82 A;  4ZW1 A;  5IBN A;  5FH8 A;  2OUO A;  4NUD A;  4TT4 A;  3MB4 A;  5ENC A;  4LZ2 A;  4MR6 A;  3JVL A;  5LKZ A;  5L8T A;  5ENE A;  3AAD A;  3MUK A;  5FE7 A;  4UYE A;  5DW2 A;  5JI8 A;  4AI6 A;  4E96 A;  4CLB A;  2WP1 A;  3NXB A;  3UVY A;  4CUU A;  4CUT A;  2LSP B;  1WUM A;  5H1T A;  4A9N A;  4TU4 A;  5AME A;  5A5O A;  5A5S A;  4KV4 A;  3U5L A;  4MR4 A;  5I80 A;  4TT2 A;  4HXP A;  2I8N A;  2R0Y A;  5FH7 A;  3QZT A;  4GPJ A;  5D24 A;  4QSS A;  2OSS A;  5E9K A;  4CUP A;  5HQ5 A;  5L99 A;  5G4S A;  5C8G A;  5L96 A;  4PTB A;  5CGP A;  5CUE A;  5FE9 A;  4A9M A;  2KTB B;  4TS8 A;  3JVJ A;  2RFJ A;  5EIC A;  5I89 A;  2L5E A;  3P1C A;  4N4F A;  5H1U A;  5LJ2 A;  3UW9 A;  3ERR A;  5E7D A;  5EP7 A;  4NR7 A;  5E74 A;  3TLP A;  5C85 A;  4NYX A;  4NR9 A;  4UIV A;  5I7Y A;  5ETB A;  4OGI A;  4OGJ A;  3RCW A;  5LJ1 A;  5A82 A;  4HXL A;  4C67 A;  5IGN A;  5F1H A;  4A9J A;  3GG3 A;  5EQ1 A;  5HEL A;  5CP5 A;  4O7A A;  5LVR A;  4UIT A;  5C7N A;  4QSQ A;  3U5N A;  5IGM A;  3O35 A;  4NQM A;  5IID A;  2DVQ A;  4TU6 A;  5HCL A;  4NRB A;  4PCE A;  1EQF A;  4QST A;  2G4A A;  2RO1 A;  4MEO A;  1PUO A;  4CUQ A;  3O34 A;  4YYK A;  4QZS A;  4CUS A;  5DFD A;  4UYD A;  5F5Z A;  5BT3 A;  4YAT A;  5DX4 A;  5II2 A;  4UIY A;  4X2I A;  3P5O A;  4QNS A;  4QSV A;  4LDF A;  3IU5 A;  4Q0O A;  4HXO A;  4UYF A;  3UVD A;  4YBM A;  4KV1 A;  5BT5 A;  5D0C A;  5E73 A;  2NXB A;  5II1 A;  2L84 A;  5EPB A;  5CPE A;  2DKW A;  4BHW A;  4QEW A;  4XUB A;  5KTU A;  5I29 A;  5LKX A;  2OO1 A;  5DFB A;  4PY6 A;  4TZ8 A;  5F63 A;  4N4G A;  4NS5 A;  5FH6 A;  5CUB A;  5FB0 A;  3MUL A;  4Z93 A;  5E9I A;  3UVW A;  4AKI A;  5HQ7 A;  5A81 A;  2DVV A;  5CTL A;  5CY9 A;  5D3J A;  2FSA A;  2YQD A;  4QC3 A;  5E3G A;  4Z6H A;  4MR3 A;  5DYA A;  4NUC A;  5KTW A;  4Z6I A;  4QSR A;  2WP2 A;  5E0R A;  4O71 A;  4AKN A;  5AD3 A;  4FLP A;  3ZYU A;  4A9I A;  4O78 A;  5L98 A;  2RS9 B;  3U5O A;  5I83 A;  4Z1S A;  2R0S A;  4BW2 A;  5EPR A;  2DAT A;  3G0L A;  5C89 A;  4PS5 A;  3LXJ A;  5A5R A;  5DFC A;  3MXF A;  3G0J A;  4DON A;  4LYW A;  5EIS A;  2E7N A;  3ONI A;  4HXN A;  5FE3 A;  5CQ5 A;  4OUF A;  5D3N A;  5DYC A;  4QY4 A;  4A9L A;  4KCX A;  3U5P A;  5ENJ A;  4MEP A;  5CZG A;  5FBX A;  3P1E A;  5FE8 A;  5CU8 A;  4NR6 A;  4QR5 A;  5JWM A;  5LUU A;  3HME A;  5BT4 A;  4LZS A;  5EI4 A;  5D3P A;  4ZC9 A;  2YEK A;  1JSP B;  3Q2F A;  5A85 A;  5D3L A;  5EM3 A;  5FE2 A;  5IG6 A;  5CUC A;  5FB1 A;  4QEU A;  4HXS A;  4HBW A;  5ENH A;  5J0D A;  5LJ0 A;  5DKH A;  3SVH A;  4XY8 A;  4IR6 A;  5HFQ A;  4TZ2 A;  4YY4 A;  2E3K A;  2YW5 A;  4NXJ A;  5L8U A;  3D7C A;  4UIX A;  4AKH A;  2YDW A;  4WHU A;  5ENI A;  5ACY A;  4NRA A;  4BW3 A;  5EWW A;  4HXK A;  4YYG A;  4A9E A;  5K29 A;  4QSU A;  5IGL A;  5I40 A;  1F68 A;  3UV5 A;  5I7X A;  2DVR A;  2MJV B;  5CQ3 A;  5EWC A;  4QBM A;  4YYJ A;  5A5P A;  3SVF A;  4LYS A;  2DWW A;  3S92 A;  4BW4 A;  3LQH A;  5HFR A;  5HQ6 A;  5TCM A;  1X0J A;  3HMH A;  5DKD A;  2H60 A;  5EU1 A;  2RNX A;  5FG6 A;  5FE4 A;  4O7E A;  3VKG A;  4AKG A;  4QB3 A;  5IGK A;  5C87 A;  4CL9 A;  5EVA A;  4IOO A;  4XUA A;  5KHM A;  4HBV A;  4YYD A;  4A9O A;  5ENG A;  4YYN A;  4O7C A;  4QYD A;  5CUA A;  5F3A A;  5F1L A;  5E3D A;  4MEN A;  4CFL A;  4LRG A;  4NR8 A;  3LQI A;  5COI A;  5DKC A;  5F61 A;  5ENB A;  4LR6 A; 
#chains in the Genus database with same CATH homology
 4ALG A;  4QEV A;  4UYG A;  5E9M A;  5CUD A;  4YY6 A;  2YEM A;  2RNY A;  4YAB A;  5D25 A;  5D26 A;  4NR4 A;  3U5M A;  4NRC A;  4O76 A;  4TQN A;  4IR4 A;  4YH4 A;  4N3W A;  3MQM A;  2F6J A;  4YBS A;  4UYF B;  4YYH A;  3UV2 A;  4WHW A;  3O36 A;  4YBT A;  5AD2 A;  5HRX A;  5EWH A;  1N72 A;  3DWY A;  5D3S A;  1ZS5 A;  5CQ6 A;  5EPS A;  3UV4 A;  5D3R A;  5DBM A;  5KTX A;  5I86 A;  4O75 A;  5DY7 A;  5H85 A;  5F60 A;  5A5N A;  2YEL A;  4QUT A;  4MEQ A;  3K2J A;  4YAD A;  5EV9 A;  4BW1 A;  5CRZ A;  5F2P A;  5I88 A;  3Q2E A;  2I7K A;  4HXM A;  4UIZ A;  5CQ7 A;  3AQA A;  5L97 A;  4ZQL A;  3DAI A;  2RI7 A;  4QSW A;  4IOR A;  5FFV A;  3LJW A;  4NUE A;  4O70 A;  5FE1 A;  4O77 A;  4O7B A;  4YH3 A;  4O7F A;  3JVK A;  4HBY A;  2N9G A;  5CS8 A;  4UIU A;  4QYL A;  5E9Y A;  5KU3 A;  4N4I A;  5ENF A;  4YYI A;  4UYH A;  5C4Q A;  5EWD A;  5LKU A;  4BJX A;  4J0R A;  4HBX A;  4O74 A;  4A9K A;  5CQ4 A;  2GRC A;  4Z1Q A;  5DW1 A;  4TTE A;  3I3J A;  4ALH A;  4IR5 A;  4J0S A;  5ETD A;  4Y03 A;  5A83 A;  5CQ8 A;  5A7C A;  1WUG A;  2F6N A;  5EGU A;  3P1F A;  4A9F A;  5HRV A;  4QC1 A;  3O33 A;  4PCI A;  4NYV A;  5CQT A;  5F25 A;  5F36 A;  4RVR A;  5D3T A;  3U5J A;  4WIV A;  5HJC A;  4XY9 A;  4LYI A;  3O37 A;  4QUU A;  4N4H A;  5AMF A;  4YAX A;  4NYW A;  3SVG A;  4YK0 A;  4CFK A;  1JM4 B;  5LVQ A;  4TYL A;  4XYA A;  2E7O A;  3MB3 A;  4TT6 A;  5FG5 A;  5HEN A;  5E9V A;  4MR5 A;  5F62 A;  5D3H A;  3FKM X;  5HEM A;  4HXR A;  3UVX A;  3P1D A;  4YYM A;  4QSP A;  3S91 A;  4IOQ A;  5H1V A;  4LZR A;  4NQN A;  5LKT A;  4NR5 A;  5HLS A;  5FFY A;  2DVS A;  5FE5 A;  5CRM A;  1E6I A;  4YC9 A;  5EWV A;  5FE6 A;  5HRW A;  3LQJ A;  3IU6 A;  4PKL A;  3HMF A;  4QR3 A;  4J1P A;  2RNW A;  3QZS A;  2YYN A;  5E9L A;  5FE0 A;  5DYU A;  4QR4 A;  5DLZ A;  4A9H A;  5KO4 A;  4C66 A;  5TB6 A;  2L85 A;  5CUG A;  5HM0 A;  3JVM A;  5EA1 A;  4LC2 A;  5DYX A;  4F3I A;  2D9E A;  4J3I A;  5D7X A;  5FFW A;  5CQA A;  4QSX A;  4O72 A;  5FDZ A;  2R10 A;  4Q0N A;  5EK9 A;  3U5K A;  4IR3 A;  5CFW A;  5DLX A;  2R0V A;  5A5Q A;  5FG4 A;  5G4R A;  3QZV A;  4UIW A;  4CUR A;  5I1Q A;  2D82 A;  4ZW1 A;  5IBN A;  5FH8 A;  2OUO A;  4NUD A;  4TT4 A;  3MB4 A;  5ENC A;  4LZ2 A;  4MR6 A;  3JVL A;  5LKZ A;  5L8T A;  5ENE A;  3AAD A;  3MUK A;  5FE7 A;  4UYE A;  5DW2 A;  5JI8 A;  4E96 A;  4CLB A;  2WP1 A;  3NXB A;  3UVY A;  4CUU A;  4CUT A;  2LSP B;  1WUM A;  5H1T A;  4A9N A;  4TU4 A;  5AME A;  5A5O A;  5A5S A;  4KV4 A;  3U5L A;  4MR4 A;  5I80 A;  4TT2 A;  4HXP A;  2I8N A;  2R0Y A;  5FH7 A;  3QZT A;  4GPJ A;  5D24 A;  4QSS A;  2OSS A;  5E9K A;  4CUP A;  5HQ5 A;  5L99 A;  5G4S A;  5C8G A;  5L96 A;  4PTB A;  5CGP A;  5CUE A;  5FE9 A;  4A9M A;  2KTB B;  4TS8 A;  3JVJ A;  2RFJ A;  5EIC A;  5I89 A;  2L5E A;  3P1C A;  4N4F A;  5H1U A;  5LJ2 A;  3UW9 A;  5E7D A;  5EP7 A;  4NR7 A;  5E74 A;  3TLP A;  5C85 A;  4NYX A;  4NR9 A;  4UIV A;  5I7Y A;  5ETB A;  4OGI A;  4OGJ A;  3RCW A;  5LJ1 A;  5A82 A;  4HXL A;  4C67 A;  5IGN A;  5F1H A;  4A9J A;  3GG3 A;  5EQ1 A;  5HEL A;  5CP5 A;  4O7A A;  5LVR A;  4UIT A;  5C7N A;  4QSQ A;  3U5N A;  5IGM A;  3O35 A;  4NQM A;  5IID A;  2DVQ A;  4TU6 A;  5HCL A;  4NRB A;  4PCE A;  1EQF A;  4QST A;  2G4A A;  2RO1 A;  4MEO A;  4CUQ A;  3O34 A;  4YYK A;  4QZS A;  4CUS A;  5DFD A;  4UYD A;  5F5Z A;  5BT3 A;  4YAT A;  5DX4 A;  5II2 A;  4UIY A;  4X2I A;  3P5O A;  4QNS A;  4QSV A;  4LDF A;  3IU5 A;  4Q0O A;  4HXO A;  4UYF A;  3UVD A;  4YBM A;  4KV1 A;  5BT5 A;  5D0C A;  5E73 A;  2NXB A;  5II1 A;  2L84 A;  5EPB A;  5CPE A;  2DKW A;  4BHW A;  4QEW A;  4XUB A;  5KTU A;  5I29 A;  5LKX A;  2OO1 A;  5DFB A;  4PY6 A;  4TZ8 A;  5F63 A;  4N4G A;  4NS5 A;  5FH6 A;  5CUB A;  5FB0 A;  3MUL A;  4Z93 A;  5E9I A;  3UVW A;  5HQ7 A;  5A81 A;  2DVV A;  5CTL A;  5CY9 A;  5D3J A;  2FSA A;  2YQD A;  4QC3 A;  5E3G A;  4Z6H A;  4MR3 A;  5DYA A;  4NUC A;  5KTW A;  4Z6I A;  4QSR A;  2WP2 A;  5E0R A;  4O71 A;  4AKN A;  5AD3 A;  4FLP A;  3ZYU A;  4A9I A;  4O78 A;  5L98 A;  2RS9 B;  3U5O A;  5I83 A;  4Z1S A;  2R0S A;  4BW2 A;  5EPR A;  2DAT A;  3G0L A;  5C89 A;  4PS5 A;  3LXJ A;  5A5R A;  5DFC A;  3MXF A;  3G0J A;  4DON A;  4LYW A;  5EIS A;  2E7N A;  3ONI A;  4HXN A;  5FE3 A;  5CQ5 A;  4OUF A;  5D3N A;  5DYC A;  4QY4 A;  4A9L A;  4KCX A;  3U5P A;  5ENJ A;  4MEP A;  5CZG A;  5FBX A;  3P1E A;  5FE8 A;  5CU8 A;  4NR6 A;  4QR5 A;  5JWM A;  5LUU A;  3HME A;  5BT4 A;  4LZS A;  5EI4 A;  5D3P A;  4ZC9 A;  2YEK A;  1JSP B;  3Q2F A;  5A85 A;  5D3L A;  5EM3 A;  5FE2 A;  5IG6 A;  5CUC A;  5FB1 A;  4QEU A;  4HXS A;  4HBW A;  5ENH A;  5J0D A;  5LJ0 A;  5DKH A;  3SVH A;  4XY8 A;  4IR6 A;  5HFQ A;  4TZ2 A;  4YY4 A;  2E3K A;  2YW5 A;  4NXJ A;  5L8U A;  3D7C A;  4UIX A;  2YDW A;  4WHU A;  5ENI A;  5ACY A;  4NRA A;  4BW3 A;  5EWW A;  4HXK A;  4YYG A;  4A9E A;  5K29 A;  4QSU A;  5IGL A;  5I40 A;  1F68 A;  3UV5 A;  5I7X A;  2DVR A;  2MJV B;  5CQ3 A;  5EWC A;  4QBM A;  4YYJ A;  5A5P A;  3SVF A;  4LYS A;  2DWW A;  3S92 A;  4BW4 A;  3LQH A;  5HFR A;  5HQ6 A;  5TCM A;  1X0J A;  3HMH A;  5DKD A;  2H60 A;  5EU1 A;  2RNX A;  5FG6 A;  5FE4 A;  4O7E A;  4QB3 A;  5IGK A;  5C87 A;  4CL9 A;  5EVA A;  4IOO A;  4XUA A;  5KHM A;  4HBV A;  4YYD A;  4A9O A;  5ENG A;  4YYN A;  4O7C A;  4QYD A;  5CUA A;  5F3A A;  5F1L A;  5E3D A;  4MEN A;  4CFL A;  4LRG A;  4NR8 A;  3LQI A;  5COI A;  5DKC A;  5F61 A;  5ENB A;  4LR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...