5I80A

Brd4 in complex with cpd2 (n,n-dimethyl-3-(6-methyl-7-oxo-6,7-dihydro-1h-pyrrolo[2,3-c]pyridin-4-yl)benzamide)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
126
structure length
126
Chain Sequence
b'STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 43
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i80A01
4CFKA 5CFWA 4LC2A 5I86A 5EU1A 5DFDA 3ONIA 3JVLA 5CRZA 4Y03A 5FE0A 5FG5A 3U5OA 3RCWA 4NUCA 4X2IA 5L8TA 5DYCA 4HXOA 5HELA 4A9FA 4C66A 4UIZA 5IGMA 4QUTA 4Z6HA 5F60A 4NR9A 4QBMA 3HMFA 5I7YA 3UV5A 3S91A 5DY7A 5EM3A 5A82A 5F25A 5F1LA 4IR3A 3D7CA 4DONA 4YYGA 5HQ7A 4UIVA 4NQMA 4O74A 5CP5A 5EPRA 3HMEA 4NYVA 5ETBA 5COIA 4O7CA 4BW2A 4BW4A 5EISA 4QEVA 3AQAA 4FLPA 4QR4A 4O7BA 3UV4A 4HBYA 4NQNA 5FE1A 5ENIA 5ENJA 4MR3A 5F1HA 5K29A 3S92A 5F36A 5D7XA 4XYAA 4TT2A 5H1TA 5D26A 1X0JA 4QZSA 4CFLA 4ALGA 4QR5A 1JSPB 3P1DA 4LZRA 4ZC9A 4N4IA 4QR3A 1ZS5A 3O35A 3QZTA 5BT3A 4N4GA 4YYJA 4QSRA 5I1QA 3G0JA 3P1FA 4YYIA 5DW2A 5CQ4A 2DKWA 5CUGA 4PCIA 5E9VA 5HQ6A 5ENEA 4YH3A 3SVHA 2E7OA 3UVDA 5DW1A 5HRWA 3U5MA 3LQIA 5F5ZA 2WP1A 1JM4B 5ETDA 4PS5A 5ENBA 5EQ1A 5FH6A 5HJCA 3U5NA 4E96A 5BT4A 5D3PA 2RNYA 4HBWA 5I40A 3Q2FA 4YAXA 4XY9A 4XUAA 4Z1QA 4YYNA 4NR8A 5KTWA 4NYWA 5KTUA 5F63A 2RI7A 5L8UA 4QYLA 2GRCA 5A7CA 5FB0A 3JVMA 5CUEA 5ENGA 4J3IA 2G4AA 4N3WA 4HBXA 5FFVA 4IORA 3UVYA 4YY6A 5A5PA 4A9MA 4O72A 4WIVA 4NR6A 5CPEA 5A5SA 4QB3A 5EPSA 5G4RA 4J1PA 3Q2EA 5L98A 5A85A 5DFBA 4YH4A 5DLXA 4NR7A 4TTEA 5A83A 4J0RA 4Q0OA 5FBXA 4CUSA 5HRVA 5CS8A 4CUTA 2RO1A 5L96A 3MB3A 4QSVA 5EK9A 5I89A 4CURA 4A9JA 5CUBA 2RNWA 4LZSA 4OGJA 4LRGA 3ZYUA 5EP7A 3AADA 5AD2A 3GG3A 4BJXA 5FFWA 4NRCA 5DKHA 5FG4A 3U5JA 3QZSA 5IG6A 3O37A 5EA1A 4TT4A 5D0CA 5FB1A 5J0DA 5AMFA 1WUGA 4O75A 4QSPA 4UYDA 3UW9A 4UITA 1F68A 3P1CA 3UVWA 5H1UA 5FG6A 5FDZA 3O36A 2YDWA 2E3KA 5E9KA 4CUUA 4IR4A 4QSXA 3HMHA 5E9MA 5I83A 5CQ7A 4A9HA 3UV2A 5JWMA 4WHUA 4O71A 3TLPA 4NYXA 4O76A 4CLBA 4UYFB 5HEMA 5AD3A 5FE6A 4QC1A 4CUPA 3UVXA 1WUMA 4TYLA 5CQ3A 4ZQLA 5E73A 4N4FA 4XY8A 4UYHA 2F6NA 4YYMA 5EI4A 4IOQA 3SVGA 5DFCA 2DVQA 2E7NA 5D24A 1E6IA 2OO1A 5CUCA 4YK0A 5HCLA 4QSSA 4O78A 4NUDA 4BW1A 4Q0NA 2DVVA 4RVRA 4N4HA 5DBMA 5DX4A 5E9YA 5EVAA 4A9IA 2D82A 3IU6A 4MR5A 2YEKA 2DWWA 5E0RA 4O7FA 4YATA 3MQMA 5C85A 4HBVA 4O77A 4OGIA 2OSSA 4QSTA 3DWYA 4Z93A 5DKDA 4QUUA 5D3HA 5EICA 5EWCA 4A9OA 4HXMA 4LDFA 4PTBA 4ALHA 5A81A 2R0SA 5H1VA 5LJ2A 4Z1SA 4BHWA 2YEMA 4YYKA 4TT6A 5EWVA 5EWHA 5E3DA 2L5EA 2MJVB 4MR6A 5ENCA 5D25A 2N9GA 4HXKA 5CY9A 5TB6A 5E3GA 4UYFA 2LSPB 4Z6IA 4YYHA 5LUUA 4UIYA 4OUFA 5EPBA 4F3IA 5CU8A 5IBNA 5FE8A 2R0YA 2WP2A 2YYNA 3MXFA 3SVFA 5HQ5A 5ACYA 4YBSA 4QY4A 4QYDA 5FE9A 5CGPA 2RNXA 3LJWA 4BW3A 5L97A 5L99A 4TU4A 2YQDA 5D3NA 4HXRA 4NS5A 5LVQA 4UYGA 5DYUA 4GPJA 2I8NA 2F6JA 3MUKA 4PKLA 3O33A 4MEQA 4NR4A 4QSUA 2RS9B 5TCMA 5IGLA 4PY6A 3LXJA 5C7NA 4IR6A 5F61A 5KHMA 4YBTA 5DKCA 4PCEA 3O34A 4YABA 4CL9A 5HLSA 4QEWA 5H85A 4ZW1A 2YELA 5E74A 2I7KA 4IR5A 4A9KA 5HM0A 5JI8A 5D3LA 4MR4A 4KCXA 4KV1A 5LVRA 4HXPA 5E7DA 5FFYA 5BT5A 3MULA 5LKUA 4LZ2A 5LKTA 2DATA 4NXJA 4QSWA 5FE3A 5FE4A 4A9NA 5CTLA 4TS8A 4YBMA 2L84A 5ENFA 4KV4A 5IIDA 3LQHA 5II1A 3P1EA 5D3JA 2FSAA 3P5OA 5EWDA 5DLZA 5FE7A 3IU5A 4AKNA 4A9EA 5HENA 4O7AA 4XUBA 5D3RA 5CQTA 5I7XA 3JVJA 4MEOA 5DYXA 4YYDA 5C8GA 4UIUA 2D9EA 5CUDA 5LKZA 3MB4A 4LYIA 5I88A 5KU3A 4O70A 2R10A 1EQFA 5IGKA 4LYWA 4QEUA 4UYEA 2DVSA 5LJ0A 5F2PA 5A5RA 2R0VA 4WHWA 4YY4A 3U5LA 5KTXA 4QNSA 2KTBB 5G4SA 3QZVA 4QC3A 4TZ8A 5DYAA 5FH8A 4LR6A 5CQ5A 5CZGA 5EWWA 5II2A 5D3TA 4A9LA 5KO4A 2L85A 5CQ6A 4QSQA 5C87A 5I29A 2NXBA 1N72A 5I80A 5CUAA 2OUOA 5LKXA 5CQAA 4MEPA 5F3AA 3DAIA 4NRBA 4MENA 4TZ2A 5CQ8A 5IGNA 5HFRA 5HFQA 4TQNA 5CRMA 4IOOA 2DVRA 4LYSA 5FE2A 4HXLA 5AMEA 5E9LA 4O7EA 3U5PA 4NR5A 3G0LA 5D3SA 4TU6A 4NRAA 5FE5A 3LQJA 4HXNA 5HRXA 4UIXA 5EGUA 5FH7A 3JVKA 4YADA 4C67A 2H60A 5F62A 4UIWA 4YC9A 4CUQA 5EV9A 5A5NA 5LJ1A 5ENHA 2YW5A 3NXBA 4NUEA 4J0SA 2RFJA 4HXSA 3FKMX 5C4QA 5E9IA 3U5KA 3I3JA 5A5OA 5C89A 5A5QA 3K2JA
chains in the Genus database with same CATH superfamily
4CFKA 5CFWA 4LC2A 5I86A 5EU1A 3D1BA 5DFDA 3ONIA 3JVLA 5CRZA 4Y03A 5FE0A 5FG5A 3U5OA 3RCWA 4NUCA 4X2IA 5L8TA 5DYCA 4HXOA 5HELA 4A9FA 4C66A 4UIZA 5IGMA 4QUTA 4Z6HA 5F60A 4NR9A 4QBMA 3HMFA 5I7YA 3UV5A 3S91A 5DY7A 5EM3A 5A82A 5F25A 5F1LA 4IR3A 3D7CA 4DONA 4YYGA 5HQ7A 4UIVA 4NQMA 4O74A 5CP5A 5EPRA 3HMEA 4NYVA 5ETBA 5COIA 4O7CA 4BW2A 1ZKRA 4BW4A 5EISA 4QEVA 3AQAA 4FLPA 4QR4A 4O7BA 3UV4A 4HBYA 4NQNA 5FE1A 5ENIA 5ENJA 4MR3A 5F1HA 5K29A 3S92A 5F36A 4XYAA 5D7XA 4TT2A 5H1TA 5D26A 1X0JA 4QZSA 4CFLA 4ALGA 4QR5A 1JSPB 3P1DA 4LZRA 4ZC9A 4N4IA 4QR3A 1ZS5A 3O35A 3QZTA 5BT3A 4N4GA 4YYJA 4QSRA 5I1QA 3G0JA 3P1FA 4YYIA 5DW2A 5CQ4A 2DKWA 5CUGA 4PCIA 5E9VA 5HQ6A 5ENEA 4YH3A 3SVHA 2E7OA 3UVDA 5DW1A 5HRWA 3U5MA 3LQIA 5F5ZA 2WP1A 1JM4B 5ETDA 4PS5A 5ENBA 5EQ1A 3ERRA 5FH6A 5HJCA 3U5NA 4E96A 5BT4A 5D3PA 2RNYA 4HBWA 5I40A 3Q2FA 4YAXA 4XY9A 4XUAA 4Z1QA 4YYNA 4NR8A 5KTWA 4NYWA 5KTUA 5F63A 2RI7A 5L8UA 4QYLA 2GRCA 5A7CA 5FB0A 3JVMA 5CUEA 5ENGA 4J3IA 2G4AA 4N3WA 4HBXA 5FFVA 4IORA 3UVYA 4YY6A 5A5PA 4A9MA 4O72A 4WIVA 4NR6A 5CPEA 5A5SA 4QB3A 5EPSA 5G4RA 4J1PA 3Q2EA 5L98A 5A85A 5DFBA 4YH4A 5DLXA 4NR7A 4TTEA 5A83A 4J0RA 4Q0OA 5FBXA 4CUSA 5HRVA 5CS8A 4CUTA 3VKHA 2RO1A 5L96A 3MB3A 4QSVA 5EK9A 5I89A 4CURA 4A9JA 5CUBA 2RNWA 4LZSA 4OGJA 4LRGA 3ZYUA 5EP7A 3AADA 5AD2A 3GG3A 4BJXA 5FFWA 4NRCA 5DKHA 5FG4A 3U5JA 3QZSA 5IG6A 3O37A 5EA1A 4TT4A 5D0CA 5FB1A 5J0DA 5AMFA 1WUGA 4O75A 4QSPA 4UYDA 3UW9A 4UITA 1F68A 3P1CA 3UVWA 5H1UA 5FG6A 5FDZA 3O36A 2YDWA 2E3KA 5E9KA 4CUUA 4IR4A 4QSXA 3HMHA 5E9MA 5I83A 5CQ7A 4A9HA 3UV2A 5JWMA 4WHUA 4O71A 3TLPA 4NYXA 4O76A 4CLBA 4UYFB 5HEMA 5AD3A 5FE6A 4QC1A 4CUPA 3UVXA 1WUMA 4TYLA 5CQ3A 4ZQLA 5E73A 4N4FA 4XY8A 4UYHA 2F6NA 4YYMA 5EI4A 4IOQA 3SVGA 5DFCA 2DVQA 2E7NA 5D24A 1E6IA 2OO1A 5CUCA 4YK0A 5HCLA 4QSSA 4O78A 4NUDA 4BW1A 4Q0NA 2DVVA 4RVRA 4N4HA 5DBMA 5DX4A 5E9YA 5EVAA 4A9IA 4AKGA 2D82A 3IU6A 4MR5A 2YEKA 2DWWA 5E0RA 4O7FA 4YATA 3MQMA 5C85A 4HBVA 4O77A 4OGIA 2OSSA 4QSTA 3DWYA 4Z93A 5DKDA 4QUUA 5D3HA 5EICA 5EWCA 4A9OA 4HXMA 4LDFA 4PTBA 4ALHA 5A81A 2R0SA 5H1VA 5LJ2A 4AI6A 4Z1SA 4BHWA 2YEMA 4YYKA 4TT6A 5EWVA 5EWHA 5E3DA 2L5EA 2MJVB 4MR6A 5ENCA 5D25A 2N9GA 4HXKA 5CY9A 5TB6A 5E3GA 4UYFA 2LSPB 4Z6IA 4YYHA 5LUUA 4UIYA 4OUFA 5EPBA 4F3IA 5CU8A 5IBNA 5FE8A 2R0YA 2WP2A 2YYNA 3MXFA 3SVFA 5HQ5A 5ACYA 4YBSA 4QY4A 4QYDA 5FE9A 5CGPA 2RNXA 3LJWA 4BW3A 5L97A 5L99A 4TU4A 2YQDA 5D3NA 4HXRA 4NS5A 5LVQA 4UYGA 5DYUA 4GPJA 2I8NA 2F6JA 3MUKA 4PKLA 3O33A 4MEQA 4NR4A 4QSUA 2RS9B 5TCMA 5IGLA 4PY6A 3LXJA 5C7NA 4IR6A 5F61A 5KHMA 4YBTA 5DKCA 4PCEA 3O34A 4YABA 4CL9A 5HLSA 4QEWA 5H85A 4ZW1A 2YELA 5E74A 2I7KA 4IR5A 4A9KA 5HM0A 5JI8A 5D3LA 4MR4A 4KCXA 4KV1A 5LVRA 4HXPA 5E7DA 5FFYA 5BT5A 3MULA 5LKUA 4LZ2A 5LKTA 2DATA 4NXJA 4QSWA 5FE3A 5FE4A 4A9NA 5CTLA 4TS8A 4YBMA 2L84A 3D1DA 5ENFA 4KV4A 5IIDA 3LQHA 5II1A 3P1EA 5D3JA 2FSAA 3P5OA 5EWDA 5DLZA 5FE7A 3IU5A 4AKNA 4A9EA 5HENA 4O7AA 4XUBA 5D3RA 5CQTA 5I7XA 3JVJA 4MEOA 5DYXA 4YYDA 5C8GA 4UIUA 2D9EA 5CUDA 5LKZA 3MB4A 4LYIA 5I88A 5KU3A 4O70A 2R10A 1EQFA 5IGKA 4LYWA 4QEUA 4UYEA 2DVSA 5LJ0A 5F2PA 5A5RA 2R0VA 4WHWA 4YY4A 3U5LA 5KTXA 4QNSA 2KTBB 4AKIA 5G4SA 3QZVA 4QC3A 4TZ8A 5DYAA 5FH8A 4LR6A 5CQ5A 5CZGA 5EWWA 5II2A 1PUOA 5D3TA 4A9LA 5KO4A 2L85A 5CQ6A 4QSQA 5C87A 5I29A 2NXBA 1N72A 5I80A 5CUAA 2OUOA 5LKXA 5CQAA 4MEPA 5F3AA 3DAIA 4NRBA 4MENA 4TZ2A 5CQ8A 5IGNA 3VKGA 5HFRA 5HFQA 4TQNA 5CRMA 4IOOA 2DVRA 4LYSA 5FE2A 4HXLA 5AMEA 5E9LA 4O7EA 3U5PA 4NR5A 3G0LA 5D3SA 2EJNA 4TU6A 4NRAA 5FE5A 3LQJA 4HXNA 5HRXA 4UIXA 5EGUA 5FH7A 3JVKA 4YADA 4C67A 2H60A 5F62A 4UIWA 4YC9A 4CUQA 5EV9A 5A5NA 5LJ1A 5ENHA 2YW5A 3NXBA 4NUEA 4J0SA 2RFJA 4HXSA 3FKMX 5C4QA 5E9IA 3U5KA 3I3JA 5A5OA 5C89A 4AKHA 5A5QA 3K2JA
chains in the Genus database with same CATH topology
4CFKA 5CFWA 4LC2A 5I86A 5EU1A 5DFDA 3ONIA 3JVLA 5CRZA 4Y03A 5FE0A 5FG5A 3U5OA 3RCWA 4NUCA 4X2IA 5L8TA 5DYCA 4HXOA 5HELA 4A9FA 4C66A 4UIZA 5IGMA 4QUTA 4Z6HA 5F60A 4NR9A 4QBMA 3HMFA 5I7YA 3UV5A 3S91A 5DY7A 5EM3A 5A82A 5F25A 5F1LA 4IR3A 3D7CA 4DONA 4YYGA 5HQ7A 4UIVA 4NQMA 4O74A 5CP5A 5EPRA 3HMEA 4NYVA 5ETBA 5COIA 4O7CA 4BW2A 4BW4A 5EISA 4QEVA 3AQAA 4FLPA 4QR4A 4O7BA 3UV4A 4HBYA 4NQNA 5FE1A 5ENIA 5ENJA 4MR3A 5F1HA 5K29A 3S92A 5F36A 5D7XA 4XYAA 4TT2A 5H1TA 5D26A 1X0JA 4QZSA 4CFLA 4ALGA 4QR5A 1JSPB 3P1DA 4LZRA 4ZC9A 4N4IA 4QR3A 1ZS5A 3O35A 3QZTA 5BT3A 4N4GA 4YYJA 4QSRA 5I1QA 3G0JA 3P1FA 4YYIA 5DW2A 5CQ4A 2DKWA 5CUGA 4PCIA 5E9VA 5HQ6A 5ENEA 4YH3A 3SVHA 2E7OA 3UVDA 5DW1A 5HRWA 3U5MA 3LQIA 5F5ZA 2WP1A 1JM4B 5ETDA 4PS5A 5ENBA 5EQ1A 5FH6A 5HJCA 3U5NA 4E96A 5BT4A 5D3PA 2RNYA 4HBWA 5I40A 3Q2FA 4YAXA 4XY9A 4XUAA 4Z1QA 4YYNA 4NR8A 5KTWA 4NYWA 5KTUA 5F63A 2RI7A 5L8UA 4QYLA 2GRCA 5A7CA 5FB0A 3JVMA 5CUEA 5ENGA 4J3IA 2G4AA 4N3WA 4HBXA 5FFVA 4IORA 3UVYA 4YY6A 5A5PA 4A9MA 4O72A 4WIVA 4NR6A 5CPEA 5A5SA 4QB3A 5EPSA 5G4RA 4J1PA 3Q2EA 5L98A 5A85A 5DFBA 4YH4A 5DLXA 4NR7A 4TTEA 5A83A 4J0RA 4Q0OA 5FBXA 4CUSA 5HRVA 5CS8A 4CUTA 2RO1A 5L96A 3MB3A 4QSVA 5EK9A 5I89A 4CURA 4A9JA 5CUBA 2RNWA 4LZSA 4OGJA 4LRGA 3ZYUA 5EP7A 3AADA 5AD2A 3GG3A 4BJXA 5FFWA 4NRCA 5DKHA 5FG4A 3U5JA 3QZSA 5IG6A 3O37A 5EA1A 4TT4A 5D0CA 5FB1A 5J0DA 5AMFA 1WUGA 4O75A 4QSPA 4UYDA 3UW9A 4UITA 1F68A 3P1CA 3UVWA 5H1UA 5FG6A 5FDZA 3O36A 2YDWA 2E3KA 5E9KA 4CUUA 4IR4A 4QSXA 3HMHA 5E9MA 5I83A 5CQ7A 4A9HA 3UV2A 5JWMA 4WHUA 4O71A 3TLPA 4NYXA 4O76A 4CLBA 4UYFB 5HEMA 5AD3A 5FE6A 4QC1A 4CUPA 3UVXA 1WUMA 4TYLA 5CQ3A 4ZQLA 5E73A 4N4FA 4XY8A 4UYHA 2F6NA 4YYMA 5EI4A 4IOQA 3SVGA 5DFCA 2DVQA 2E7NA 5D24A 1E6IA 2OO1A 5CUCA 4YK0A 5HCLA 4QSSA 4O78A 4NUDA 4BW1A 4Q0NA 2DVVA 4RVRA 4N4HA 5DBMA 5DX4A 5E9YA 5EVAA 4A9IA 2D82A 3IU6A 4MR5A 2YEKA 2DWWA 5E0RA 4O7FA 4YATA 3MQMA 5C85A 4HBVA 4O77A 4OGIA 2OSSA 4QSTA 3DWYA 4Z93A 5DKDA 4QUUA 5D3HA 5EICA 5EWCA 4A9OA 4HXMA 4LDFA 4PTBA 4ALHA 5A81A 2R0SA 5H1VA 5LJ2A 4Z1SA 4BHWA 2YEMA 4YYKA 4TT6A 5EWVA 5EWHA 5E3DA 2L5EA 2MJVB 4MR6A 5ENCA 5D25A 2N9GA 4HXKA 5CY9A 5TB6A 5E3GA 4UYFA 2LSPB 4Z6IA 4YYHA 5LUUA 4UIYA 4OUFA 5EPBA 4F3IA 5CU8A 5IBNA 5FE8A 2R0YA 2WP2A 2YYNA 3MXFA 3SVFA 5HQ5A 5ACYA 4YBSA 4QY4A 4QYDA 5FE9A 5CGPA 2RNXA 3LJWA 4BW3A 5L97A 5L99A 4TU4A 2YQDA 5D3NA 4HXRA 4NS5A 5LVQA 4UYGA 5DYUA 4GPJA 2I8NA 2F6JA 3MUKA 4PKLA 3O33A 4MEQA 4NR4A 4QSUA 2RS9B 5TCMA 5IGLA 4PY6A 3LXJA 5C7NA 4IR6A 5F61A 5KHMA 4YBTA 5DKCA 4PCEA 3O34A 4YABA 4CL9A 5HLSA 4QEWA 5H85A 4ZW1A 2YELA 5E74A 2I7KA 4IR5A 4A9KA 5HM0A 5JI8A 5D3LA 4MR4A 4KCXA 4KV1A 5LVRA 4HXPA 5E7DA 5FFYA 5BT5A 3MULA 5LKUA 4LZ2A 5LKTA 2DATA 4NXJA 4QSWA 5FE3A 5FE4A 4A9NA 5CTLA 4TS8A 4YBMA 2L84A 5ENFA 4KV4A 5IIDA 3LQHA 5II1A 3P1EA 5D3JA 2FSAA 3P5OA 5EWDA 5DLZA 5FE7A 3IU5A 4AKNA 4A9EA 5HENA 4O7AA 4XUBA 5D3RA 5CQTA 5I7XA 3JVJA 4MEOA 5DYXA 4YYDA 5C8GA 4UIUA 2D9EA 5CUDA 5LKZA 3MB4A 4LYIA 5I88A 5KU3A 4O70A 2R10A 1EQFA 5IGKA 4LYWA 4QEUA 4UYEA 2DVSA 5LJ0A 5F2PA 5A5RA 2R0VA 4WHWA 4YY4A 3U5LA 5KTXA 4QNSA 2KTBB 5G4SA 3QZVA 4QC3A 4TZ8A 5DYAA 5FH8A 4LR6A 5CQ5A 5CZGA 5EWWA 5II2A 5D3TA 4A9LA 5KO4A 2L85A 5CQ6A 4QSQA 5C87A 5I29A 2NXBA 1N72A 5I80A 5CUAA 2OUOA 5LKXA 5CQAA 4MEPA 5F3AA 3DAIA 4NRBA 4MENA 4TZ2A 5CQ8A 5IGNA 5HFRA 5HFQA 4TQNA 5CRMA 4IOOA 2DVRA 4LYSA 5FE2A 4HXLA 5AMEA 5E9LA 4O7EA 3U5PA 4NR5A 3G0LA 5D3SA 4TU6A 4NRAA 5FE5A 3LQJA 4HXNA 5HRXA 4UIXA 5EGUA 5FH7A 3JVKA 4YADA 4C67A 2H60A 5F62A 4UIWA 4YC9A 4CUQA 5EV9A 5A5NA 5LJ1A 5ENHA 2YW5A 3NXBA 4NUEA 4J0SA 2RFJA 4HXSA 3FKMX 5C4QA 5E9IA 3U5KA 3I3JA 5A5OA 5C89A 5A5QA 3K2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFK A;  5CFW A;  4LC2 A;  5I86 A;  5EU1 A;  5DFD A;  3ONI A;  3JVL A;  5CRZ A;  4Y03 A;  5FE0 A;  5FG5 A;  3U5O A;  3RCW A;  4NUC A;  4X2I A;  5L8T A;  5DYC A;  4HXO A;  5HEL A;  4A9F A;  4C66 A;  4UIZ A;  5IGM A;  4QUT A;  4Z6H A;  5F60 A;  4NR9 A;  4QBM A;  3HMF A;  5I7Y A;  3UV5 A;  3S91 A;  5DY7 A;  5EM3 A;  5A82 A;  5F25 A;  5F1L A;  4IR3 A;  3D7C A;  4DON A;  4YYG A;  5HQ7 A;  4UIV A;  4NQM A;  4O74 A;  5CP5 A;  5EPR A;  3HME A;  4NYV A;  5ETB A;  5COI A;  4O7C A;  4BW2 A;  4BW4 A;  5EIS A;  4QEV A;  3AQA A;  4FLP A;  4QR4 A;  4O7B A;  3UV4 A;  4HBY A;  4NQN A;  5FE1 A;  5ENI A;  5ENJ A;  4MR3 A;  5F1H A;  5K29 A;  3S92 A;  5F36 A;  5D7X A;  4XYA A;  4TT2 A;  5H1T A;  5D26 A;  1X0J A;  4QZS A;  4CFL A;  4ALG A;  4QR5 A;  1JSP B;  3P1D A;  4LZR A;  4ZC9 A;  4N4I A;  4QR3 A;  1ZS5 A;  3O35 A;  3QZT A;  5BT3 A;  4N4G A;  4YYJ A;  4QSR A;  5I1Q A;  3G0J A;  3P1F A;  4YYI A;  5DW2 A;  5CQ4 A;  2DKW A;  5CUG A;  4PCI A;  5E9V A;  5HQ6 A;  5ENE A;  4YH3 A;  3SVH A;  2E7O A;  3UVD A;  5DW1 A;  5HRW A;  3U5M A;  3LQI A;  5F5Z A;  2WP1 A;  1JM4 B;  5ETD A;  4PS5 A;  5ENB A;  5EQ1 A;  5FH6 A;  5HJC A;  3U5N A;  4E96 A;  5BT4 A;  5D3P A;  2RNY A;  4HBW A;  5I40 A;  3Q2F A;  4YAX A;  4XY9 A;  4XUA A;  4Z1Q A;  4YYN A;  4NR8 A;  5KTW A;  4NYW A;  5KTU A;  5F63 A;  2RI7 A;  5L8U A;  4QYL A;  2GRC A;  5A7C A;  5FB0 A;  3JVM A;  5CUE A;  5ENG A;  4J3I A;  2G4A A;  4N3W A;  4HBX A;  5FFV A;  4IOR A;  3UVY A;  4YY6 A;  5A5P A;  4A9M A;  4O72 A;  4WIV A;  4NR6 A;  5CPE A;  5A5S A;  4QB3 A;  5EPS A;  5G4R A;  4J1P A;  3Q2E A;  5L98 A;  5A85 A;  5DFB A;  4YH4 A;  5DLX A;  4NR7 A;  4TTE A;  5A83 A;  4J0R A;  4Q0O A;  5FBX A;  4CUS A;  5HRV A;  5CS8 A;  4CUT A;  2RO1 A;  5L96 A;  3MB3 A;  4QSV A;  5EK9 A;  5I89 A;  4CUR A;  4A9J A;  5CUB A;  2RNW A;  4LZS A;  4OGJ A;  4LRG A;  3ZYU A;  5EP7 A;  3AAD A;  5AD2 A;  3GG3 A;  4BJX A;  5FFW A;  4NRC A;  5DKH A;  5FG4 A;  3U5J A;  3QZS A;  5IG6 A;  3O37 A;  5EA1 A;  4TT4 A;  5D0C A;  5FB1 A;  5J0D A;  5AMF A;  1WUG A;  4O75 A;  4QSP A;  4UYD A;  3UW9 A;  4UIT A;  1F68 A;  3P1C A;  3UVW A;  5H1U A;  5FG6 A;  5FDZ A;  3O36 A;  2YDW A;  2E3K A;  5E9K A;  4CUU A;  4IR4 A;  4QSX A;  3HMH A;  5E9M A;  5I83 A;  5CQ7 A;  4A9H A;  3UV2 A;  5JWM A;  4WHU A;  4O71 A;  3TLP A;  4NYX A;  4O76 A;  4CLB A;  4UYF B;  5HEM A;  5AD3 A;  5FE6 A;  4QC1 A;  4CUP A;  3UVX A;  1WUM A;  4TYL A;  5CQ3 A;  4ZQL A;  5E73 A;  4N4F A;  4XY8 A;  4UYH A;  2F6N A;  4YYM A;  5EI4 A;  4IOQ A;  3SVG A;  5DFC A;  2DVQ A;  2E7N A;  5D24 A;  1E6I A;  2OO1 A;  5CUC A;  4YK0 A;  5HCL A;  4QSS A;  4O78 A;  4NUD A;  4BW1 A;  4Q0N A;  2DVV A;  4RVR A;  4N4H A;  5DBM A;  5DX4 A;  5E9Y A;  5EVA A;  4A9I A;  2D82 A;  3IU6 A;  4MR5 A;  2YEK A;  2DWW A;  5E0R A;  4O7F A;  4YAT A;  3MQM A;  5C85 A;  4HBV A;  4O77 A;  4OGI A;  2OSS A;  4QST A;  3DWY A;  4Z93 A;  5DKD A;  4QUU A;  5D3H A;  5EIC A;  5EWC A;  4A9O A;  4HXM A;  4LDF A;  4PTB A;  4ALH A;  5A81 A;  2R0S A;  5H1V A;  5LJ2 A;  4Z1S A;  4BHW A;  2YEM A;  4YYK A;  4TT6 A;  5EWV A;  5EWH A;  5E3D A;  2L5E A;  2MJV B;  4MR6 A;  5ENC A;  5D25 A;  2N9G A;  4HXK A;  5CY9 A;  5TB6 A;  5E3G A;  4UYF A;  2LSP B;  4Z6I A;  4YYH A;  5LUU A;  4UIY A;  4OUF A;  5EPB A;  4F3I A;  5CU8 A;  5IBN A;  5FE8 A;  2R0Y A;  2WP2 A;  2YYN A;  3MXF A;  3SVF A;  5HQ5 A;  5ACY A;  4YBS A;  4QY4 A;  4QYD A;  5FE9 A;  5CGP A;  2RNX A;  3LJW A;  4BW3 A;  5L97 A;  5L99 A;  4TU4 A;  2YQD A;  5D3N A;  4HXR A;  4NS5 A;  5LVQ A;  4UYG A;  5DYU A;  4GPJ A;  2I8N A;  2F6J A;  3MUK A;  4PKL A;  3O33 A;  4MEQ A;  4NR4 A;  4QSU A;  2RS9 B;  5TCM A;  5IGL A;  4PY6 A;  3LXJ A;  5C7N A;  4IR6 A;  5F61 A;  5KHM A;  4YBT A;  5DKC A;  4PCE A;  3O34 A;  4YAB A;  4CL9 A;  5HLS A;  4QEW A;  5H85 A;  4ZW1 A;  2YEL A;  5E74 A;  2I7K A;  4IR5 A;  4A9K A;  5HM0 A;  5JI8 A;  5D3L A;  4MR4 A;  4KCX A;  4KV1 A;  5LVR A;  4HXP A;  5E7D A;  5FFY A;  5BT5 A;  3MUL A;  5LKU A;  4LZ2 A;  5LKT A;  2DAT A;  4NXJ A;  4QSW A;  5FE3 A;  5FE4 A;  4A9N A;  5CTL A;  4TS8 A;  4YBM A;  2L84 A;  5ENF A;  4KV4 A;  5IID A;  3LQH A;  5II1 A;  3P1E A;  5D3J A;  2FSA A;  3P5O A;  5EWD A;  5DLZ A;  5FE7 A;  3IU5 A;  4AKN A;  4A9E A;  5HEN A;  4O7A A;  4XUB A;  5D3R A;  5CQT A;  5I7X A;  3JVJ A;  4MEO A;  5DYX A;  4YYD A;  5C8G A;  4UIU A;  2D9E A;  5CUD A;  5LKZ A;  3MB4 A;  4LYI A;  5I88 A;  5KU3 A;  4O70 A;  2R10 A;  1EQF A;  5IGK A;  4LYW A;  4QEU A;  4UYE A;  2DVS A;  5LJ0 A;  5F2P A;  5A5R A;  2R0V A;  4WHW A;  4YY4 A;  3U5L A;  5KTX A;  4QNS A;  2KTB B;  5G4S A;  3QZV A;  4QC3 A;  4TZ8 A;  5DYA A;  5FH8 A;  4LR6 A;  5CQ5 A;  5CZG A;  5EWW A;  5II2 A;  5D3T A;  4A9L A;  5KO4 A;  2L85 A;  5CQ6 A;  4QSQ A;  5C87 A;  5I29 A;  2NXB A;  1N72 A;  5I80 A;  5CUA A;  2OUO A;  5LKX A;  5CQA A;  4MEP A;  5F3A A;  3DAI A;  4NRB A;  4MEN A;  4TZ2 A;  5CQ8 A;  5IGN A;  5HFR A;  5HFQ A;  4TQN A;  5CRM A;  4IOO A;  2DVR A;  4LYS A;  5FE2 A;  4HXL A;  5AME A;  5E9L A;  4O7E A;  3U5P A;  4NR5 A;  3G0L A;  5D3S A;  4TU6 A;  4NRA A;  5FE5 A;  3LQJ A;  4HXN A;  5HRX A;  4UIX A;  5EGU A;  5FH7 A;  3JVK A;  4YAD A;  4C67 A;  2H60 A;  5F62 A;  4UIW A;  4YC9 A;  4CUQ A;  5EV9 A;  5A5N A;  5LJ1 A;  5ENH A;  2YW5 A;  3NXB A;  4NUE A;  4J0S A;  2RFJ A;  4HXS A;  3FKM X;  5C4Q A;  5E9I A;  3U5K A;  3I3J A;  5A5O A;  5C89 A;  5A5Q A;  3K2J A; 
#chains in the Genus database with same CATH topology
 4CFK A;  5CFW A;  4LC2 A;  5I86 A;  5EU1 A;  3D1B A;  5DFD A;  3ONI A;  3JVL A;  5CRZ A;  4Y03 A;  5FE0 A;  5FG5 A;  3U5O A;  3RCW A;  4NUC A;  4X2I A;  5L8T A;  5DYC A;  4HXO A;  5HEL A;  4A9F A;  4C66 A;  4UIZ A;  5IGM A;  4QUT A;  4Z6H A;  5F60 A;  4NR9 A;  4QBM A;  3HMF A;  5I7Y A;  3UV5 A;  3S91 A;  5DY7 A;  5EM3 A;  5A82 A;  5F25 A;  5F1L A;  4IR3 A;  3D7C A;  4DON A;  4YYG A;  5HQ7 A;  4UIV A;  4NQM A;  4O74 A;  5CP5 A;  5EPR A;  3HME A;  4NYV A;  5ETB A;  5COI A;  4O7C A;  4BW2 A;  1ZKR A;  4BW4 A;  5EIS A;  4QEV A;  3AQA A;  4FLP A;  4QR4 A;  4O7B A;  3UV4 A;  4HBY A;  4NQN A;  5FE1 A;  5ENI A;  5ENJ A;  4MR3 A;  5F1H A;  5K29 A;  3S92 A;  5F36 A;  4XYA A;  5D7X A;  4TT2 A;  5H1T A;  5D26 A;  1X0J A;  4QZS A;  4CFL A;  4ALG A;  4QR5 A;  1JSP B;  3P1D A;  4LZR A;  4ZC9 A;  4N4I A;  4QR3 A;  1ZS5 A;  3O35 A;  3QZT A;  5BT3 A;  4N4G A;  4YYJ A;  4QSR A;  5I1Q A;  3G0J A;  3P1F A;  4YYI A;  5DW2 A;  5CQ4 A;  2DKW A;  5CUG A;  4PCI A;  5E9V A;  5HQ6 A;  5ENE A;  4YH3 A;  3SVH A;  2E7O A;  3UVD A;  5DW1 A;  5HRW A;  3U5M A;  3LQI A;  5F5Z A;  2WP1 A;  1JM4 B;  5ETD A;  4PS5 A;  5ENB A;  5EQ1 A;  3ERR A;  5FH6 A;  5HJC A;  3U5N A;  4E96 A;  5BT4 A;  5D3P A;  2RNY A;  4HBW A;  5I40 A;  3Q2F A;  4YAX A;  4XY9 A;  4XUA A;  4Z1Q A;  4YYN A;  4NR8 A;  5KTW A;  4NYW A;  5KTU A;  5F63 A;  2RI7 A;  5L8U A;  4QYL A;  2GRC A;  5A7C A;  5FB0 A;  3JVM A;  5CUE A;  5ENG A;  4J3I A;  2G4A A;  4N3W A;  4HBX A;  5FFV A;  4IOR A;  3UVY A;  4YY6 A;  5A5P A;  4A9M A;  4O72 A;  4WIV A;  4NR6 A;  5CPE A;  5A5S A;  4QB3 A;  5EPS A;  5G4R A;  4J1P A;  3Q2E A;  5L98 A;  5A85 A;  5DFB A;  4YH4 A;  5DLX A;  4NR7 A;  4TTE A;  5A83 A;  4J0R A;  4Q0O A;  5FBX A;  4CUS A;  5HRV A;  5CS8 A;  4CUT A;  3VKH A;  2RO1 A;  5L96 A;  3MB3 A;  4QSV A;  5EK9 A;  5I89 A;  4CUR A;  4A9J A;  5CUB A;  2RNW A;  4LZS A;  4OGJ A;  4LRG A;  3ZYU A;  5EP7 A;  3AAD A;  5AD2 A;  3GG3 A;  4BJX A;  5FFW A;  4NRC A;  5DKH A;  5FG4 A;  3U5J A;  3QZS A;  5IG6 A;  3O37 A;  5EA1 A;  4TT4 A;  5D0C A;  5FB1 A;  5J0D A;  5AMF A;  1WUG A;  4O75 A;  4QSP A;  4UYD A;  3UW9 A;  4UIT A;  1F68 A;  3P1C A;  3UVW A;  5H1U A;  5FG6 A;  5FDZ A;  3O36 A;  2YDW A;  2E3K A;  5E9K A;  4CUU A;  4IR4 A;  4QSX A;  3HMH A;  5E9M A;  5I83 A;  5CQ7 A;  4A9H A;  3UV2 A;  5JWM A;  4WHU A;  4O71 A;  3TLP A;  4NYX A;  4O76 A;  4CLB A;  4UYF B;  5HEM A;  5AD3 A;  5FE6 A;  4QC1 A;  4CUP A;  3UVX A;  1WUM A;  4TYL A;  5CQ3 A;  4ZQL A;  5E73 A;  4N4F A;  4XY8 A;  4UYH A;  2F6N A;  4YYM A;  5EI4 A;  4IOQ A;  3SVG A;  5DFC A;  2DVQ A;  2E7N A;  5D24 A;  1E6I A;  2OO1 A;  5CUC A;  4YK0 A;  5HCL A;  4QSS A;  4O78 A;  4NUD A;  4BW1 A;  4Q0N A;  2DVV A;  4RVR A;  4N4H A;  5DBM A;  5DX4 A;  5E9Y A;  5EVA A;  4A9I A;  4AKG A;  2D82 A;  3IU6 A;  4MR5 A;  2YEK A;  2DWW A;  5E0R A;  4O7F A;  4YAT A;  3MQM A;  5C85 A;  4HBV A;  4O77 A;  4OGI A;  2OSS A;  4QST A;  3DWY A;  4Z93 A;  5DKD A;  4QUU A;  5D3H A;  5EIC A;  5EWC A;  4A9O A;  4HXM A;  4LDF A;  4PTB A;  4ALH A;  5A81 A;  2R0S A;  5H1V A;  5LJ2 A;  4AI6 A;  4Z1S A;  4BHW A;  2YEM A;  4YYK A;  4TT6 A;  5EWV A;  5EWH A;  5E3D A;  2L5E A;  2MJV B;  4MR6 A;  5ENC A;  5D25 A;  2N9G A;  4HXK A;  5CY9 A;  5TB6 A;  5E3G A;  4UYF A;  2LSP B;  4Z6I A;  4YYH A;  5LUU A;  4UIY A;  4OUF A;  5EPB A;  4F3I A;  5CU8 A;  5IBN A;  5FE8 A;  2R0Y A;  2WP2 A;  2YYN A;  3MXF A;  3SVF A;  5HQ5 A;  5ACY A;  4YBS A;  4QY4 A;  4QYD A;  5FE9 A;  5CGP A;  2RNX A;  3LJW A;  4BW3 A;  5L97 A;  5L99 A;  4TU4 A;  2YQD A;  5D3N A;  4HXR A;  4NS5 A;  5LVQ A;  4UYG A;  5DYU A;  4GPJ A;  2I8N A;  2F6J A;  3MUK A;  4PKL A;  3O33 A;  4MEQ A;  4NR4 A;  4QSU A;  2RS9 B;  5TCM A;  5IGL A;  4PY6 A;  3LXJ A;  5C7N A;  4IR6 A;  5F61 A;  5KHM A;  4YBT A;  5DKC A;  4PCE A;  3O34 A;  4YAB A;  4CL9 A;  5HLS A;  4QEW A;  5H85 A;  4ZW1 A;  2YEL A;  5E74 A;  2I7K A;  4IR5 A;  4A9K A;  5HM0 A;  5JI8 A;  5D3L A;  4MR4 A;  4KCX A;  4KV1 A;  5LVR A;  4HXP A;  5E7D A;  5FFY A;  5BT5 A;  3MUL A;  5LKU A;  4LZ2 A;  5LKT A;  2DAT A;  4NXJ A;  4QSW A;  5FE3 A;  5FE4 A;  4A9N A;  5CTL A;  4TS8 A;  4YBM A;  2L84 A;  3D1D A;  5ENF A;  4KV4 A;  5IID A;  3LQH A;  5II1 A;  3P1E A;  5D3J A;  2FSA A;  3P5O A;  5EWD A;  5DLZ A;  5FE7 A;  3IU5 A;  4AKN A;  4A9E A;  5HEN A;  4O7A A;  4XUB A;  5D3R A;  5CQT A;  5I7X A;  3JVJ A;  4MEO A;  5DYX A;  4YYD A;  5C8G A;  4UIU A;  2D9E A;  5CUD A;  5LKZ A;  3MB4 A;  4LYI A;  5I88 A;  5KU3 A;  4O70 A;  2R10 A;  1EQF A;  5IGK A;  4LYW A;  4QEU A;  4UYE A;  2DVS A;  5LJ0 A;  5F2P A;  5A5R A;  2R0V A;  4WHW A;  4YY4 A;  3U5L A;  5KTX A;  4QNS A;  2KTB B;  4AKI A;  5G4S A;  3QZV A;  4QC3 A;  4TZ8 A;  5DYA A;  5FH8 A;  4LR6 A;  5CQ5 A;  5CZG A;  5EWW A;  5II2 A;  1PUO A;  5D3T A;  4A9L A;  5KO4 A;  2L85 A;  5CQ6 A;  4QSQ A;  5C87 A;  5I29 A;  2NXB A;  1N72 A;  5I80 A;  5CUA A;  2OUO A;  5LKX A;  5CQA A;  4MEP A;  5F3A A;  3DAI A;  4NRB A;  4MEN A;  4TZ2 A;  5CQ8 A;  5IGN A;  3VKG A;  5HFR A;  5HFQ A;  4TQN A;  5CRM A;  4IOO A;  2DVR A;  4LYS A;  5FE2 A;  4HXL A;  5AME A;  5E9L A;  4O7E A;  3U5P A;  4NR5 A;  3G0L A;  5D3S A;  2EJN A;  4TU6 A;  4NRA A;  5FE5 A;  3LQJ A;  4HXN A;  5HRX A;  4UIX A;  5EGU A;  5FH7 A;  3JVK A;  4YAD A;  4C67 A;  2H60 A;  5F62 A;  4UIW A;  4YC9 A;  4CUQ A;  5EV9 A;  5A5N A;  5LJ1 A;  5ENH A;  2YW5 A;  3NXB A;  4NUE A;  4J0S A;  2RFJ A;  4HXS A;  3FKM X;  5C4Q A;  5E9I A;  3U5K A;  3I3J A;  5A5O A;  5C89 A;  4AKH A;  5A5Q A;  3K2J A; 
#chains in the Genus database with same CATH homology
 4CFK A;  5CFW A;  4LC2 A;  5I86 A;  5EU1 A;  5DFD A;  3ONI A;  3JVL A;  5CRZ A;  4Y03 A;  5FE0 A;  5FG5 A;  3U5O A;  3RCW A;  4NUC A;  4X2I A;  5L8T A;  5DYC A;  4HXO A;  5HEL A;  4A9F A;  4C66 A;  4UIZ A;  5IGM A;  4QUT A;  4Z6H A;  5F60 A;  4NR9 A;  4QBM A;  3HMF A;  5I7Y A;  3UV5 A;  3S91 A;  5DY7 A;  5EM3 A;  5A82 A;  5F25 A;  5F1L A;  4IR3 A;  3D7C A;  4DON A;  4YYG A;  5HQ7 A;  4UIV A;  4NQM A;  4O74 A;  5CP5 A;  5EPR A;  3HME A;  4NYV A;  5ETB A;  5COI A;  4O7C A;  4BW2 A;  4BW4 A;  5EIS A;  4QEV A;  3AQA A;  4FLP A;  4QR4 A;  4O7B A;  3UV4 A;  4HBY A;  4NQN A;  5FE1 A;  5ENI A;  5ENJ A;  4MR3 A;  5F1H A;  5K29 A;  3S92 A;  5F36 A;  5D7X A;  4XYA A;  4TT2 A;  5H1T A;  5D26 A;  1X0J A;  4QZS A;  4CFL A;  4ALG A;  4QR5 A;  1JSP B;  3P1D A;  4LZR A;  4ZC9 A;  4N4I A;  4QR3 A;  1ZS5 A;  3O35 A;  3QZT A;  5BT3 A;  4N4G A;  4YYJ A;  4QSR A;  5I1Q A;  3G0J A;  3P1F A;  4YYI A;  5DW2 A;  5CQ4 A;  2DKW A;  5CUG A;  4PCI A;  5E9V A;  5HQ6 A;  5ENE A;  4YH3 A;  3SVH A;  2E7O A;  3UVD A;  5DW1 A;  5HRW A;  3U5M A;  3LQI A;  5F5Z A;  2WP1 A;  1JM4 B;  5ETD A;  4PS5 A;  5ENB A;  5EQ1 A;  5FH6 A;  5HJC A;  3U5N A;  4E96 A;  5BT4 A;  5D3P A;  2RNY A;  4HBW A;  5I40 A;  3Q2F A;  4YAX A;  4XY9 A;  4XUA A;  4Z1Q A;  4YYN A;  4NR8 A;  5KTW A;  4NYW A;  5KTU A;  5F63 A;  2RI7 A;  5L8U A;  4QYL A;  2GRC A;  5A7C A;  5FB0 A;  3JVM A;  5CUE A;  5ENG A;  4J3I A;  2G4A A;  4N3W A;  4HBX A;  5FFV A;  4IOR A;  3UVY A;  4YY6 A;  5A5P A;  4A9M A;  4O72 A;  4WIV A;  4NR6 A;  5CPE A;  5A5S A;  4QB3 A;  5EPS A;  5G4R A;  4J1P A;  3Q2E A;  5L98 A;  5A85 A;  5DFB A;  4YH4 A;  5DLX A;  4NR7 A;  4TTE A;  5A83 A;  4J0R A;  4Q0O A;  5FBX A;  4CUS A;  5HRV A;  5CS8 A;  4CUT A;  2RO1 A;  5L96 A;  3MB3 A;  4QSV A;  5EK9 A;  5I89 A;  4CUR A;  4A9J A;  5CUB A;  2RNW A;  4LZS A;  4OGJ A;  4LRG A;  3ZYU A;  5EP7 A;  3AAD A;  5AD2 A;  3GG3 A;  4BJX A;  5FFW A;  4NRC A;  5DKH A;  5FG4 A;  3U5J A;  3QZS A;  5IG6 A;  3O37 A;  5EA1 A;  4TT4 A;  5D0C A;  5FB1 A;  5J0D A;  5AMF A;  1WUG A;  4O75 A;  4QSP A;  4UYD A;  3UW9 A;  4UIT A;  1F68 A;  3P1C A;  3UVW A;  5H1U A;  5FG6 A;  5FDZ A;  3O36 A;  2YDW A;  2E3K A;  5E9K A;  4CUU A;  4IR4 A;  4QSX A;  3HMH A;  5E9M A;  5I83 A;  5CQ7 A;  4A9H A;  3UV2 A;  5JWM A;  4WHU A;  4O71 A;  3TLP A;  4NYX A;  4O76 A;  4CLB A;  4UYF B;  5HEM A;  5AD3 A;  5FE6 A;  4QC1 A;  4CUP A;  3UVX A;  1WUM A;  4TYL A;  5CQ3 A;  4ZQL A;  5E73 A;  4N4F A;  4XY8 A;  4UYH A;  2F6N A;  4YYM A;  5EI4 A;  4IOQ A;  3SVG A;  5DFC A;  2DVQ A;  2E7N A;  5D24 A;  1E6I A;  2OO1 A;  5CUC A;  4YK0 A;  5HCL A;  4QSS A;  4O78 A;  4NUD A;  4BW1 A;  4Q0N A;  2DVV A;  4RVR A;  4N4H A;  5DBM A;  5DX4 A;  5E9Y A;  5EVA A;  4A9I A;  2D82 A;  3IU6 A;  4MR5 A;  2YEK A;  2DWW A;  5E0R A;  4O7F A;  4YAT A;  3MQM A;  5C85 A;  4HBV A;  4O77 A;  4OGI A;  2OSS A;  4QST A;  3DWY A;  4Z93 A;  5DKD A;  4QUU A;  5D3H A;  5EIC A;  5EWC A;  4A9O A;  4HXM A;  4LDF A;  4PTB A;  4ALH A;  5A81 A;  2R0S A;  5H1V A;  5LJ2 A;  4Z1S A;  4BHW A;  2YEM A;  4YYK A;  4TT6 A;  5EWV A;  5EWH A;  5E3D A;  2L5E A;  2MJV B;  4MR6 A;  5ENC A;  5D25 A;  2N9G A;  4HXK A;  5CY9 A;  5TB6 A;  5E3G A;  4UYF A;  2LSP B;  4Z6I A;  4YYH A;  5LUU A;  4UIY A;  4OUF A;  5EPB A;  4F3I A;  5CU8 A;  5IBN A;  5FE8 A;  2R0Y A;  2WP2 A;  2YYN A;  3MXF A;  3SVF A;  5HQ5 A;  5ACY A;  4YBS A;  4QY4 A;  4QYD A;  5FE9 A;  5CGP A;  2RNX A;  3LJW A;  4BW3 A;  5L97 A;  5L99 A;  4TU4 A;  2YQD A;  5D3N A;  4HXR A;  4NS5 A;  5LVQ A;  4UYG A;  5DYU A;  4GPJ A;  2I8N A;  2F6J A;  3MUK A;  4PKL A;  3O33 A;  4MEQ A;  4NR4 A;  4QSU A;  2RS9 B;  5TCM A;  5IGL A;  4PY6 A;  3LXJ A;  5C7N A;  4IR6 A;  5F61 A;  5KHM A;  4YBT A;  5DKC A;  4PCE A;  3O34 A;  4YAB A;  4CL9 A;  5HLS A;  4QEW A;  5H85 A;  4ZW1 A;  2YEL A;  5E74 A;  2I7K A;  4IR5 A;  4A9K A;  5HM0 A;  5JI8 A;  5D3L A;  4MR4 A;  4KCX A;  4KV1 A;  5LVR A;  4HXP A;  5E7D A;  5FFY A;  5BT5 A;  3MUL A;  5LKU A;  4LZ2 A;  5LKT A;  2DAT A;  4NXJ A;  4QSW A;  5FE3 A;  5FE4 A;  4A9N A;  5CTL A;  4TS8 A;  4YBM A;  2L84 A;  5ENF A;  4KV4 A;  5IID A;  3LQH A;  5II1 A;  3P1E A;  5D3J A;  2FSA A;  3P5O A;  5EWD A;  5DLZ A;  5FE7 A;  3IU5 A;  4AKN A;  4A9E A;  5HEN A;  4O7A A;  4XUB A;  5D3R A;  5CQT A;  5I7X A;  3JVJ A;  4MEO A;  5DYX A;  4YYD A;  5C8G A;  4UIU A;  2D9E A;  5CUD A;  5LKZ A;  3MB4 A;  4LYI A;  5I88 A;  5KU3 A;  4O70 A;  2R10 A;  1EQF A;  5IGK A;  4LYW A;  4QEU A;  4UYE A;  2DVS A;  5LJ0 A;  5F2P A;  5A5R A;  2R0V A;  4WHW A;  4YY4 A;  3U5L A;  5KTX A;  4QNS A;  2KTB B;  5G4S A;  3QZV A;  4QC3 A;  4TZ8 A;  5DYA A;  5FH8 A;  4LR6 A;  5CQ5 A;  5CZG A;  5EWW A;  5II2 A;  5D3T A;  4A9L A;  5KO4 A;  2L85 A;  5CQ6 A;  4QSQ A;  5C87 A;  5I29 A;  2NXB A;  1N72 A;  5I80 A;  5CUA A;  2OUO A;  5LKX A;  5CQA A;  4MEP A;  5F3A A;  3DAI A;  4NRB A;  4MEN A;  4TZ2 A;  5CQ8 A;  5IGN A;  5HFR A;  5HFQ A;  4TQN A;  5CRM A;  4IOO A;  2DVR A;  4LYS A;  5FE2 A;  4HXL A;  5AME A;  5E9L A;  4O7E A;  3U5P A;  4NR5 A;  3G0L A;  5D3S A;  4TU6 A;  4NRA A;  5FE5 A;  3LQJ A;  4HXN A;  5HRX A;  4UIX A;  5EGU A;  5FH7 A;  3JVK A;  4YAD A;  4C67 A;  2H60 A;  5F62 A;  4UIW A;  4YC9 A;  4CUQ A;  5EV9 A;  5A5N A;  5LJ1 A;  5ENH A;  2YW5 A;  3NXB A;  4NUE A;  4J0S A;  2RFJ A;  4HXS A;  3FKM X;  5C4Q A;  5E9I A;  3U5K A;  3I3J A;  5A5O A;  5C89 A;  5A5Q A;  3K2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...