5I80A

Brd4 in complex with cpd2 (n,n-dimethyl-3-(6-methyl-7-oxo-6,7-dihydro-1h-pyrrolo[2,3-c]pyridin-4-yl)benzamide)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
126
structure length
126
Chain Sequence
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 4
publication title Diving into the Water: Inducible Binding Conformations for BRD4, TAF1(2), BRD9, and CECR2 Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5i80A01
4O72A 4HXNA 4QEWA 5LKTA 5CY9A 4Z1SA 5F62A 4YH3A 5EWDA 5CQ4A 3RCWA 4NRBA 2RNWA 5E9YA 4WHWA 5LVRA 2N9GA 5ETBA 5FFYA 5TB6A 4IR3A 3UVWA 5D0CA 5CQ5A 5A85A 4YADA 3JVMA 2D82A 5C8GA 5IGNA 4J1PA 5KHMA 4O75A 2H60A 5EP7A 4CUQA 4C67A 5F61A 4A9LA 5EPRA 5CRZA 5EK9A 5CQ7A 5HLSA 4YYMA 5EV9A 2OSSA 4MEOA 3S91A 5LJ2A 4J0RA 4Z6IA 3MQMA 5A81A 3U5PA 4PY6A 4N4GA 3U5JA 4HBXA 4QSUA 4LDFA 5EQ1A 5E3GA 4QSSA 5A83A 4NUCA 5FG4A 5AD3A 4NR9A 5BT5A 4J0SA 4NR8A 4YK0A 5EISA 5D3PA 4CUPA 4UIZA 4CLBA 5CUAA 5LJ1A 2F6NA 5DW1A 3U5NA 4YYJA 4BW1A 4NQMA 4UYFA 5FE0A 4BW2A 4IORA 5D26A 5I80A 4TU6A 3D7CA 2I7KA 2DKWA 4XY9A 2YEMA 5F1LA 2RO1A 4LYIA 4KV4A 4DONA 4QEUA 5CUEA 4LRGA 5DLZA 3NXBA 5D3TA 4IR4A 5ENFA 4XY8A 2RS9B 5KTXA 3FKMX 3HMEA 5F2PA 5FG5A 3G0JA 5FFVA 5I88A 5EI4A 2L5EA 5II2A 2WP1A 2FSAA 4NYXA 5ENHA 4A9KA 4QYLA 3UVXA 4OGIA 1JSPB 5ACYA 4X2IA 4CL9A 5EICA 4XYAA 5IBNA 5FE1A 4N4HA 5HENA 5A5NA 5FB1A 4AKNA 4HXOA 3TLPA 2DVRA 4IOOA 5A5PA 3U5KA 4UYDA 5CUDA 5ENGA 4NYVA 5CTLA 5KTWA 4UYHA 4XUAA 1JM4B 5DYCA 5C7NA 5H1VA 4CUTA 4IR5A 4LR6A 4QSVA 3DWYA 5D3SA 4NXJA 4TZ8A 2D9EA 4YH4A 5F3AA 2YDWA 3U5LA 4HXMA 3UVDA 4PS5A 4YC9A 5L98A 5CQ6A 4QNSA 4YATA 2I8NA 4NUDA 5E74A 4HXKA 4YYIA 4NRCA 4NQNA 5IIDA 4MENA 5G4SA 3GG3A 4LZRA 4N4FA 3Q2EA 2G4AA 5A82A 5IGKA 4HXLA 4LC2A 5HCLA 5H1TA 4BJXA 4UIVA 3K2JA 3Q2FA 5E9KA 5ENBA 4PCIA 5II1A 5CQTA 4UYGA 5L99A 4GPJA 5A5SA 4LZ2A 5EWHA 5FH6A 2YELA 5E9VA 5I83A 4WHUA 4O7FA 5DX4A 4C66A 3JVKA 5DFDA 4O7AA 1X0JA 4TS8A 4NS5A 4UIUA 4QSRA 2YEKA 5FH7A 5L96A 4KV1A 4QC3A 5EM3A 4QR4A 5HELA 5C85A 5FBXA 5HQ7A 2R10A 5LJ0A 5I86A 5F1HA 5EU1A 3UW9A 4QY4A 2E3KA 4YYGA 4UIWA 5HFRA 4OGJA 5D7XA 5F5ZA 2YW5A 5E0RA 5COIA 3UV5A 4A9HA 4NR5A 5C89A 4O77A 5CZGA 5A5RA 4ZQLA 4Q0OA 5I7XA 4NR4A 5CP5A 4UYFB 4QYDA 5LVQA 3SVHA 4UIYA 4A9FA 4A9IA 5FG6A 5C4QA 3IU6A 4NRAA 5HFQA 5HEMA 5D3HA 5IGMA 4CFLA 5FE4A 5E7DA 4A9JA 4J3IA 3UV4A 5FE8A 4LYWA 5I7YA 5CPEA 2NXBA 4YYDA 2E7OA 4QSTA 1EQFA 4CURA 2R0VA 5D24A 3SVFA 5HRWA 3O34A 4QB3A 4BW3A 4Z93A 4CUSA 4NUEA 2F6JA 5AMFA 2OUOA 3P1CA 4YY4A 5EPBA 5H85A 5DKCA 5EVAA 4Z6HA 3LXJA 5LUUA 2DWWA 2YQDA 5EWCA 5DYAA 5AMEA 5A5QA 5DFCA 4YY6A 5CRMA 4O78A 3I3JA 5IG6A 1F68A 5EWWA 4YYKA 4Z1QA 3JVJA 5E9MA 5D25A 3QZTA 3P1DA 5FDZA 2YYNA 3AQAA 4HXSA 4MR3A 5LKXA 4QR3A 5KU3A 4O71A 4HBVA 5F25A 4UYEA 5D3RA 5I89A 5DY7A 5F36A 5E3DA 5DYUA 4TU4A 4YAXA 4QEVA 2DVVA 5ETDA 3HMFA 4QC1A 4MR5A 4QUUA 5EA1A 5FE5A 5F63A 3SVGA 2DVQA 5DKDA 5H1UA 5LKUA 5FE2A 4MEPA 1E6IA 3O33A 5L8UA 5HM0A 5HJCA 5I29A 4LZSA 4ALHA 4HBWA 5CGPA 4TT2A 4YYNA 4TZ2A 5E9LA 5JWMA 3QZSA 3P1EA 5E9IA 4IOQA 5CUBA 2LSPB 4KCXA 4A9OA 4HXRA 4YABA 5EGUA 5K29A 5FH8A 2RNXA 5DKHA 4LYSA 4O7CA 3O36A 1WUGA 5FFWA 4MR4A 5CQ8A 3MUKA 4QSQA 3O35A 4NR6A 5D3NA 4YYHA 5J0DA 5ENJA 3UVYA 4N3WA 5BT3A 4UITA 5FE3A 4A9EA 5FE6A 3MXFA 5AD2A 5KO4A 4HBYA 3MULA 2L85A 1WUMA 5EPSA 2RFJA 5DLXA 2RI7A 5BT4A 3AADA 2MJVB 3LQHA 5CQ3A 4ZC9A 3MB3A 4TT4A 4O7BA 2R0SA 2R0YA 1N72A 2DVSA 3QZVA 4QUTA 4CUUA 4O70A 4QR5A 4QBMA 5HQ5A 5D3JA 4HXPA 5CS8A 5DBMA 3HMHA 4NYWA 3S92A 3P1FA 5EWVA 4Q0NA 4A9NA 4PKLA 3LQIA 4MR6A 3DAIA 5I1QA 5TCMA 5HRXA 4MEQA 5CU8A 4QZSA 4YBSA 3JVLA 4ALGA 5I40A 5IGLA 3O37A 4FLPA 4ZW1A 5ENEA 4E96A 4TT6A 3ZYUA 4QSWA 1ZS5A 2RNYA 5L8TA 3LQJA 5CUGA 5CFWA 5HQ6A 5LKZA 3IU5A 2KTBB 5ENCA 3ONIA 4TQNA 5FE7A 2GRCA 4Y03A 4NR7A 3G0LA 4IR6A 2WP2A 4QSXA 4O7EA 4YBTA 2E7NA 5DYXA 4O76A 4F3IA 5G4RA 4WIVA 4RVRA 5FB0A 4TTEA 2OO1A 5CQAA 5KTUA 5HRVA 3U5MA 5D3LA 4PCEA 4OUFA 4BHWA 4CFKA 4O74A 5F60A 3LJWA 4A9MA 5CUCA 4XUBA 5A7CA 2DATA 3MB4A 4BW4A 2L84A 4PTBA 4UIXA 4YBMA 3P5OA 3U5OA 3UV2A 4QSPA 5JI8A 5FE9A 5A5OA 5ENIA 5C87A 4TYLA 5DFBA 5DW2A 5E73A 5L97A 4N4IA
chains in the Genus database with same CATH superfamily
4O72A 4HXNA 4QEWA 5LKTA 5CY9A 4Z1SA 5F62A 4YH3A 5EWDA 5CQ4A 3RCWA 4NRBA 2RNWA 5E9YA 4WHWA 5LVRA 2N9GA 5ETBA 5FFYA 5TB6A 4IR3A 3UVWA 5D0CA 5CQ5A 5A85A 4YADA 3JVMA 2D82A 5C8GA 5IGNA 4J1PA 5KHMA 4O75A 2H60A 5EP7A 4CUQA 4C67A 5F61A 4A9LA 5EPRA 5CRZA 5EK9A 5CQ7A 5HLSA 4YYMA 5EV9A 2OSSA 4MEOA 3S91A 5LJ2A 4J0RA 4Z6IA 3MQMA 5A81A 3U5PA 4PY6A 4N4GA 3U5JA 4HBXA 4QSUA 4LDFA 2EJNA 5EQ1A 5E3GA 4QSSA 5A83A 4NUCA 5FG4A 5AD3A 4NR9A 5BT5A 4J0SA 4NR8A 4YK0A 3VKHA 5EISA 5D3PA 4CUPA 4UIZA 4CLBA 5CUAA 5LJ1A 2F6NA 5DW1A 3U5NA 4YYJA 4BW1A 4NQMA 4UYFA 5FE0A 4BW2A 4IORA 5D26A 5I80A 4TU6A 3D7CA 2I7KA 2DKWA 4XY9A 2YEMA 5F1LA 2RO1A 4LYIA 4KV4A 4DONA 4QEUA 5CUEA 4LRGA 5DLZA 3NXBA 5D3TA 4IR4A 5ENFA 4XY8A 2RS9B 5KTXA 3FKMX 3HMEA 5F2PA 5FG5A 3G0JA 5FFVA 5I88A 5EI4A 2L5EA 5II2A 2WP1A 2FSAA 4NYXA 5ENHA 4A9KA 4QYLA 3UVXA 4OGIA 1JSPB 5ACYA 4X2IA 4CL9A 5EICA 4XYAA 5IBNA 5FE1A 4N4HA 5HENA 5A5NA 5FB1A 4AKNA 4HXOA 3TLPA 2DVRA 4IOOA 5A5PA 3U5KA 4UYDA 5CUDA 5ENGA 4NYVA 5CTLA 5KTWA 4UYHA 4XUAA 1JM4B 5DYCA 5C7NA 5H1VA 4CUTA 4IR5A 4LR6A 4QSVA 3DWYA 5D3SA 4NXJA 4TZ8A 2D9EA 4YH4A 5F3AA 2YDWA 3U5LA 1PUOA 4HXMA 3UVDA 4PS5A 3D1DA 4YC9A 5L98A 5CQ6A 4QNSA 4YATA 2I8NA 4NUDA 5E74A 4HXKA 4YYIA 4NRCA 4NQNA 5IIDA 3D1BA 4MENA 5G4SA 3GG3A 4LZRA 4N4FA 3Q2EA 2G4AA 5A82A 5IGKA 4HXLA 4LC2A 5HCLA 5H1TA 4BJXA 4UIVA 3K2JA 3Q2FA 5E9KA 5ENBA 4PCIA 5II1A 5CQTA 4UYGA 5L99A 4GPJA 5A5SA 4LZ2A 3ERRA 5EWHA 5FH6A 2YELA 5E9VA 5I83A 4WHUA 4O7FA 5DX4A 4C66A 3JVKA 5DFDA 4O7AA 1X0JA 4TS8A 4NS5A 4UIUA 4QSRA 2YEKA 5FH7A 5L96A 4KV1A 4QC3A 5EM3A 4QR4A 5HELA 5C85A 5FBXA 5HQ7A 2R10A 5LJ0A 5I86A 5F1HA 5EU1A 3UW9A 4QY4A 2E3KA 4YYGA 4UIWA 5HFRA 3VKGA 4OGJA 5D7XA 5F5ZA 2YW5A 5E0RA 5COIA 3UV5A 4A9HA 4NR5A 5C89A 4O77A 5CZGA 5A5RA 4ZQLA 4Q0OA 5I7XA 4NR4A 5CP5A 4UYFB 4QYDA 5LVQA 3SVHA 4UIYA 4A9FA 4A9IA 5FG6A 5C4QA 3IU6A 4NRAA 5HFQA 5HEMA 5D3HA 5IGMA 4CFLA 5FE4A 5E7DA 4A9JA 4J3IA 3UV4A 5FE8A 4AKHA 4LYWA 5I7YA 5CPEA 2NXBA 4YYDA 2E7OA 4QSTA 1EQFA 4CURA 2R0VA 5D24A 3SVFA 5HRWA 3O34A 4QB3A 4BW3A 4Z93A 4CUSA 4NUEA 2F6JA 5AMFA 2OUOA 3P1CA 4YY4A 5EPBA 5H85A 5DKCA 5EVAA 4Z6HA 3LXJA 5LUUA 2DWWA 2YQDA 5EWCA 5DYAA 5AMEA 5A5QA 5DFCA 4YY6A 5CRMA 4O78A 3I3JA 5IG6A 1F68A 5EWWA 4YYKA 4Z1QA 3JVJA 5E9MA 5D25A 3QZTA 3P1DA 5FDZA 2YYNA 3AQAA 4HXSA 4MR3A 5LKXA 4QR3A 5KU3A 4O71A 4HBVA 5F25A 4UYEA 5D3RA 5I89A 5DY7A 5F36A 5E3DA 5DYUA 4TU4A 4YAXA 4QEVA 2DVVA 5ETDA 3HMFA 4QC1A 4MR5A 4QUUA 5EA1A 5FE5A 5F63A 3SVGA 2DVQA 5DKDA 5H1UA 5LKUA 5FE2A 4MEPA 1E6IA 3O33A 5L8UA 1ZKRA 5HJCA 5HM0A 5I29A 4LZSA 4ALHA 4HBWA 5CGPA 4TT2A 4YYNA 4TZ2A 5E9LA 5JWMA 3QZSA 3P1EA 5E9IA 4IOQA 5CUBA 2LSPB 4KCXA 4A9OA 4HXRA 4YABA 5EGUA 5K29A 5FH8A 2RNXA 5DKHA 4LYSA 4O7CA 3O36A 1WUGA 5FFWA 4MR4A 5CQ8A 3MUKA 4QSQA 3O35A 4NR6A 5D3NA 4YYHA 5J0DA 5ENJA 3UVYA 4N3WA 5BT3A 4UITA 5FE3A 4A9EA 5FE6A 3MXFA 5AD2A 5KO4A 4HBYA 3MULA 2L85A 1WUMA 5EPSA 2RFJA 5DLXA 2RI7A 5BT4A 3AADA 2MJVB 3LQHA 5CQ3A 4ZC9A 3MB3A 4TT4A 4O7BA 2R0SA 2R0YA 1N72A 2DVSA 3QZVA 4QUTA 4CUUA 4O70A 4QR5A 4QBMA 5HQ5A 5D3JA 4HXPA 5CS8A 5DBMA 3HMHA 4NYWA 3S92A 3P1FA 5EWVA 4Q0NA 4A9NA 4PKLA 3LQIA 4MR6A 3DAIA 5I1QA 5TCMA 5HRXA 4MEQA 5CU8A 4QZSA 4AKGA 4AKIA 4YBSA 3JVLA 4ALGA 5I40A 5IGLA 3O37A 4FLPA 4ZW1A 5ENEA 4E96A 4TT6A 3ZYUA 4QSWA 1ZS5A 2RNYA 5L8TA 3LQJA 5CUGA 5CFWA 5HQ6A 5LKZA 3IU5A 2KTBB 5ENCA 3ONIA 4TQNA 5FE7A 2GRCA 4Y03A 4NR7A 3G0LA 4IR6A 2WP2A 4QSXA 4O7EA 4YBTA 2E7NA 5DYXA 4O76A 4F3IA 5G4RA 4WIVA 4RVRA 5FB0A 4TTEA 2OO1A 5CQAA 5KTUA 5HRVA 3U5MA 5D3LA 4PCEA 4OUFA 4BHWA 4CFKA 4O74A 5F60A 3LJWA 4A9MA 5CUCA 4XUBA 5A7CA 2DATA 3MB4A 4BW4A 2L84A 4PTBA 4UIXA 4YBMA 4AI6A 3P5OA 3U5OA 3UV2A 4QSPA 5JI8A 5FE9A 5A5OA 5ENIA 5C87A 4TYLA 5DFBA 5DW2A 5E73A 5L97A 4N4IA
chains in the Genus database with same CATH topology
4O72A 4HXNA 4QEWA 5LKTA 5CY9A 4Z1SA 5F62A 4YH3A 5EWDA 5CQ4A 3RCWA 4NRBA 2RNWA 5E9YA 4WHWA 5LVRA 2N9GA 5ETBA 5FFYA 5TB6A 4IR3A 3UVWA 5D0CA 5CQ5A 5A85A 4YADA 3JVMA 2D82A 5C8GA 5IGNA 4J1PA 5KHMA 4O75A 2H60A 5EP7A 4CUQA 4C67A 5F61A 4A9LA 5EPRA 5CRZA 5EK9A 5CQ7A 5HLSA 4YYMA 5EV9A 2OSSA 4MEOA 3S91A 5LJ2A 4J0RA 4Z6IA 3MQMA 5A81A 3U5PA 4PY6A 4N4GA 3U5JA 4HBXA 4QSUA 4LDFA 5EQ1A 5E3GA 4QSSA 5A83A 4NUCA 5FG4A 5AD3A 4NR9A 5BT5A 4J0SA 4NR8A 4YK0A 5EISA 5D3PA 4CUPA 4UIZA 4CLBA 5CUAA 5LJ1A 2F6NA 5DW1A 3U5NA 4YYJA 4BW1A 4NQMA 4UYFA 5FE0A 4BW2A 4IORA 5D26A 5I80A 4TU6A 3D7CA 2I7KA 2DKWA 4XY9A 2YEMA 5F1LA 2RO1A 4LYIA 4KV4A 4DONA 4QEUA 5CUEA 4LRGA 5DLZA 3NXBA 5D3TA 4IR4A 5ENFA 4XY8A 2RS9B 5KTXA 3FKMX 3HMEA 5F2PA 5FG5A 3G0JA 5FFVA 5I88A 5EI4A 2L5EA 5II2A 2WP1A 2FSAA 4NYXA 5ENHA 4A9KA 4QYLA 3UVXA 4OGIA 1JSPB 5ACYA 4X2IA 4CL9A 5EICA 4XYAA 5IBNA 5FE1A 4N4HA 5HENA 5A5NA 5FB1A 4AKNA 4HXOA 3TLPA 2DVRA 4IOOA 5A5PA 3U5KA 4UYDA 5CUDA 5ENGA 4NYVA 5CTLA 5KTWA 4UYHA 4XUAA 1JM4B 5DYCA 5C7NA 5H1VA 4CUTA 4IR5A 4LR6A 4QSVA 3DWYA 5D3SA 4NXJA 4TZ8A 2D9EA 4YH4A 5F3AA 2YDWA 3U5LA 4HXMA 3UVDA 4PS5A 4YC9A 5L98A 5CQ6A 4QNSA 4YATA 2I8NA 4NUDA 5E74A 4HXKA 4YYIA 4NRCA 4NQNA 5IIDA 4MENA 5G4SA 3GG3A 4LZRA 4N4FA 3Q2EA 2G4AA 5A82A 5IGKA 4HXLA 4LC2A 5HCLA 5H1TA 4BJXA 4UIVA 3K2JA 3Q2FA 5E9KA 5ENBA 4PCIA 5II1A 5CQTA 4UYGA 5L99A 4GPJA 5A5SA 4LZ2A 5EWHA 5FH6A 2YELA 5E9VA 5I83A 4WHUA 4O7FA 5DX4A 4C66A 3JVKA 5DFDA 4O7AA 1X0JA 4TS8A 4NS5A 4UIUA 4QSRA 2YEKA 5FH7A 5L96A 4KV1A 4QC3A 5EM3A 4QR4A 5HELA 5C85A 5FBXA 5HQ7A 2R10A 5LJ0A 5I86A 5F1HA 5EU1A 3UW9A 4QY4A 2E3KA 4YYGA 4UIWA 5HFRA 4OGJA 5D7XA 5F5ZA 2YW5A 5E0RA 5COIA 3UV5A 4A9HA 4NR5A 5C89A 4O77A 5CZGA 5A5RA 4ZQLA 4Q0OA 5I7XA 4NR4A 5CP5A 4UYFB 4QYDA 5LVQA 3SVHA 4UIYA 4A9FA 4A9IA 5FG6A 5C4QA 3IU6A 4NRAA 5HFQA 5HEMA 5D3HA 5IGMA 4CFLA 5FE4A 5E7DA 4A9JA 4J3IA 3UV4A 5FE8A 4LYWA 5I7YA 5CPEA 2NXBA 4YYDA 2E7OA 4QSTA 1EQFA 4CURA 2R0VA 5D24A 3SVFA 5HRWA 3O34A 4QB3A 4BW3A 4Z93A 4CUSA 4NUEA 2F6JA 5AMFA 2OUOA 3P1CA 4YY4A 5EPBA 5H85A 5DKCA 5EVAA 4Z6HA 3LXJA 5LUUA 2DWWA 2YQDA 5EWCA 5DYAA 5AMEA 5A5QA 5DFCA 4YY6A 5CRMA 4O78A 3I3JA 5IG6A 1F68A 5EWWA 4YYKA 4Z1QA 3JVJA 5E9MA 5D25A 3QZTA 3P1DA 5FDZA 2YYNA 3AQAA 4HXSA 4MR3A 5LKXA 4QR3A 5KU3A 4O71A 4HBVA 5F25A 4UYEA 5D3RA 5I89A 5DY7A 5F36A 5E3DA 5DYUA 4TU4A 4YAXA 4QEVA 2DVVA 5ETDA 3HMFA 4QC1A 4MR5A 4QUUA 5EA1A 5FE5A 5F63A 3SVGA 2DVQA 5DKDA 5H1UA 5LKUA 5FE2A 4MEPA 1E6IA 3O33A 5L8UA 5HM0A 5HJCA 5I29A 4LZSA 4ALHA 4HBWA 5CGPA 4TT2A 4YYNA 4TZ2A 5E9LA 5JWMA 3QZSA 3P1EA 5E9IA 4IOQA 5CUBA 2LSPB 4KCXA 4A9OA 4HXRA 4YABA 5EGUA 5K29A 5FH8A 2RNXA 5DKHA 4LYSA 4O7CA 3O36A 1WUGA 5FFWA 4MR4A 5CQ8A 3MUKA 4QSQA 3O35A 4NR6A 5D3NA 4YYHA 5J0DA 5ENJA 3UVYA 4N3WA 5BT3A 4UITA 5FE3A 4A9EA 5FE6A 3MXFA 5AD2A 5KO4A 4HBYA 3MULA 2L85A 1WUMA 5EPSA 2RFJA 5DLXA 2RI7A 5BT4A 3AADA 2MJVB 3LQHA 5CQ3A 4ZC9A 3MB3A 4TT4A 4O7BA 2R0SA 2R0YA 1N72A 2DVSA 3QZVA 4QUTA 4CUUA 4O70A 4QR5A 4QBMA 5HQ5A 5D3JA 4HXPA 5CS8A 5DBMA 3HMHA 4NYWA 3S92A 3P1FA 5EWVA 4Q0NA 4A9NA 4PKLA 3LQIA 4MR6A 3DAIA 5I1QA 5TCMA 5HRXA 4MEQA 5CU8A 4QZSA 4YBSA 3JVLA 4ALGA 5I40A 5IGLA 3O37A 4FLPA 4ZW1A 5ENEA 4E96A 4TT6A 3ZYUA 4QSWA 1ZS5A 2RNYA 5L8TA 3LQJA 5CUGA 5CFWA 5HQ6A 5LKZA 3IU5A 2KTBB 5ENCA 3ONIA 4TQNA 5FE7A 2GRCA 4Y03A 4NR7A 3G0LA 4IR6A 2WP2A 4QSXA 4O7EA 4YBTA 2E7NA 5DYXA 4O76A 4F3IA 5G4RA 4WIVA 4RVRA 5FB0A 4TTEA 2OO1A 5CQAA 5KTUA 5HRVA 3U5MA 5D3LA 4PCEA 4OUFA 4BHWA 4CFKA 4O74A 5F60A 3LJWA 4A9MA 5CUCA 4XUBA 5A7CA 2DATA 3MB4A 4BW4A 2L84A 4PTBA 4UIXA 4YBMA 3P5OA 3U5OA 3UV2A 4QSPA 5JI8A 5FE9A 5A5OA 5ENIA 5C87A 4TYLA 5DFBA 5DW2A 5E73A 5L97A 4N4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O72 A;  4HXN A;  4QEW A;  5LKT A;  5CY9 A;  4Z1S A;  5F62 A;  4YH3 A;  5EWD A;  5CQ4 A;  3RCW A;  4NRB A;  2RNW A;  5E9Y A;  4WHW A;  5LVR A;  2N9G A;  5ETB A;  5FFY A;  5TB6 A;  4IR3 A;  3UVW A;  5D0C A;  5CQ5 A;  5A85 A;  4YAD A;  3JVM A;  2D82 A;  5C8G A;  5IGN A;  4J1P A;  5KHM A;  4O75 A;  2H60 A;  5EP7 A;  4CUQ A;  4C67 A;  5F61 A;  4A9L A;  5EPR A;  5CRZ A;  5EK9 A;  5CQ7 A;  5HLS A;  4YYM A;  5EV9 A;  2OSS A;  4MEO A;  3S91 A;  5LJ2 A;  4J0R A;  4Z6I A;  3MQM A;  5A81 A;  3U5P A;  4PY6 A;  4N4G A;  3U5J A;  4HBX A;  4QSU A;  4LDF A;  5EQ1 A;  5E3G A;  4QSS A;  5A83 A;  4NUC A;  5FG4 A;  5AD3 A;  4NR9 A;  5BT5 A;  4J0S A;  4NR8 A;  4YK0 A;  5EIS A;  5D3P A;  4CUP A;  4UIZ A;  4CLB A;  5CUA A;  5LJ1 A;  2F6N A;  5DW1 A;  3U5N A;  4YYJ A;  4BW1 A;  4NQM A;  4UYF A;  5FE0 A;  4BW2 A;  4IOR A;  5D26 A;  5I80 A;  4TU6 A;  3D7C A;  2I7K A;  2DKW A;  4XY9 A;  2YEM A;  5F1L A;  2RO1 A;  4LYI A;  4KV4 A;  4DON A;  4QEU A;  5CUE A;  4LRG A;  5DLZ A;  3NXB A;  5D3T A;  4IR4 A;  5ENF A;  4XY8 A;  2RS9 B;  5KTX A;  3FKM X;  3HME A;  5F2P A;  5FG5 A;  3G0J A;  5FFV A;  5I88 A;  5EI4 A;  2L5E A;  5II2 A;  2WP1 A;  2FSA A;  4NYX A;  5ENH A;  4A9K A;  4QYL A;  3UVX A;  4OGI A;  1JSP B;  5ACY A;  4X2I A;  4CL9 A;  5EIC A;  4XYA A;  5IBN A;  5FE1 A;  4N4H A;  5HEN A;  5A5N A;  5FB1 A;  4AKN A;  4HXO A;  3TLP A;  2DVR A;  4IOO A;  5A5P A;  3U5K A;  4UYD A;  5CUD A;  5ENG A;  4NYV A;  5CTL A;  5KTW A;  4UYH A;  4XUA A;  1JM4 B;  5DYC A;  5C7N A;  5H1V A;  4CUT A;  4IR5 A;  4LR6 A;  4QSV A;  3DWY A;  5D3S A;  4NXJ A;  4TZ8 A;  2D9E A;  4YH4 A;  5F3A A;  2YDW A;  3U5L A;  4HXM A;  3UVD A;  4PS5 A;  4YC9 A;  5L98 A;  5CQ6 A;  4QNS A;  4YAT A;  2I8N A;  4NUD A;  5E74 A;  4HXK A;  4YYI A;  4NRC A;  4NQN A;  5IID A;  4MEN A;  5G4S A;  3GG3 A;  4LZR A;  4N4F A;  3Q2E A;  2G4A A;  5A82 A;  5IGK A;  4HXL A;  4LC2 A;  5HCL A;  5H1T A;  4BJX A;  4UIV A;  3K2J A;  3Q2F A;  5E9K A;  5ENB A;  4PCI A;  5II1 A;  5CQT A;  4UYG A;  5L99 A;  4GPJ A;  5A5S A;  4LZ2 A;  5EWH A;  5FH6 A;  2YEL A;  5E9V A;  5I83 A;  4WHU A;  4O7F A;  5DX4 A;  4C66 A;  3JVK A;  5DFD A;  4O7A A;  1X0J A;  4TS8 A;  4NS5 A;  4UIU A;  4QSR A;  2YEK A;  5FH7 A;  5L96 A;  4KV1 A;  4QC3 A;  5EM3 A;  4QR4 A;  5HEL A;  5C85 A;  5FBX A;  5HQ7 A;  2R10 A;  5LJ0 A;  5I86 A;  5F1H A;  5EU1 A;  3UW9 A;  4QY4 A;  2E3K A;  4YYG A;  4UIW A;  5HFR A;  4OGJ A;  5D7X A;  5F5Z A;  2YW5 A;  5E0R A;  5COI A;  3UV5 A;  4A9H A;  4NR5 A;  5C89 A;  4O77 A;  5CZG A;  5A5R A;  4ZQL A;  4Q0O A;  5I7X A;  4NR4 A;  5CP5 A;  4UYF B;  4QYD A;  5LVQ A;  3SVH A;  4UIY A;  4A9F A;  4A9I A;  5FG6 A;  5C4Q A;  3IU6 A;  4NRA A;  5HFQ A;  5HEM A;  5D3H A;  5IGM A;  4CFL A;  5FE4 A;  5E7D A;  4A9J A;  4J3I A;  3UV4 A;  5FE8 A;  4LYW A;  5I7Y A;  5CPE A;  2NXB A;  4YYD A;  2E7O A;  4QST A;  1EQF A;  4CUR A;  2R0V A;  5D24 A;  3SVF A;  5HRW A;  3O34 A;  4QB3 A;  4BW3 A;  4Z93 A;  4CUS A;  4NUE A;  2F6J A;  5AMF A;  2OUO A;  3P1C A;  4YY4 A;  5EPB A;  5H85 A;  5DKC A;  5EVA A;  4Z6H A;  3LXJ A;  5LUU A;  2DWW A;  2YQD A;  5EWC A;  5DYA A;  5AME A;  5A5Q A;  5DFC A;  4YY6 A;  5CRM A;  4O78 A;  3I3J A;  5IG6 A;  1F68 A;  5EWW A;  4YYK A;  4Z1Q A;  3JVJ A;  5E9M A;  5D25 A;  3QZT A;  3P1D A;  5FDZ A;  2YYN A;  3AQA A;  4HXS A;  4MR3 A;  5LKX A;  4QR3 A;  5KU3 A;  4O71 A;  4HBV A;  5F25 A;  4UYE A;  5D3R A;  5I89 A;  5DY7 A;  5F36 A;  5E3D A;  5DYU A;  4TU4 A;  4YAX A;  4QEV A;  2DVV A;  5ETD A;  3HMF A;  4QC1 A;  4MR5 A;  4QUU A;  5EA1 A;  5FE5 A;  5F63 A;  3SVG A;  2DVQ A;  5DKD A;  5H1U A;  5LKU A;  5FE2 A;  4MEP A;  1E6I A;  3O33 A;  5L8U A;  5HM0 A;  5HJC A;  5I29 A;  4LZS A;  4ALH A;  4HBW A;  5CGP A;  4TT2 A;  4YYN A;  4TZ2 A;  5E9L A;  5JWM A;  3QZS A;  3P1E A;  5E9I A;  4IOQ A;  5CUB A;  2LSP B;  4KCX A;  4A9O A;  4HXR A;  4YAB A;  5EGU A;  5K29 A;  5FH8 A;  2RNX A;  5DKH A;  4LYS A;  4O7C A;  3O36 A;  1WUG A;  5FFW A;  4MR4 A;  5CQ8 A;  3MUK A;  4QSQ A;  3O35 A;  4NR6 A;  5D3N A;  4YYH A;  5J0D A;  5ENJ A;  3UVY A;  4N3W A;  5BT3 A;  4UIT A;  5FE3 A;  4A9E A;  5FE6 A;  3MXF A;  5AD2 A;  5KO4 A;  4HBY A;  3MUL A;  2L85 A;  1WUM A;  5EPS A;  2RFJ A;  5DLX A;  2RI7 A;  5BT4 A;  3AAD A;  2MJV B;  3LQH A;  5CQ3 A;  4ZC9 A;  3MB3 A;  4TT4 A;  4O7B A;  2R0S A;  2R0Y A;  1N72 A;  2DVS A;  3QZV A;  4QUT A;  4CUU A;  4O70 A;  4QR5 A;  4QBM A;  5HQ5 A;  5D3J A;  4HXP A;  5CS8 A;  5DBM A;  3HMH A;  4NYW A;  3S92 A;  3P1F A;  5EWV A;  4Q0N A;  4A9N A;  4PKL A;  3LQI A;  4MR6 A;  3DAI A;  5I1Q A;  5TCM A;  5HRX A;  4MEQ A;  5CU8 A;  4QZS A;  4YBS A;  3JVL A;  4ALG A;  5I40 A;  5IGL A;  3O37 A;  4FLP A;  4ZW1 A;  5ENE A;  4E96 A;  4TT6 A;  3ZYU A;  4QSW A;  1ZS5 A;  2RNY A;  5L8T A;  3LQJ A;  5CUG A;  5CFW A;  5HQ6 A;  5LKZ A;  3IU5 A;  2KTB B;  5ENC A;  3ONI A;  4TQN A;  5FE7 A;  2GRC A;  4Y03 A;  4NR7 A;  3G0L A;  4IR6 A;  2WP2 A;  4QSX A;  4O7E A;  4YBT A;  2E7N A;  5DYX A;  4O76 A;  4F3I A;  5G4R A;  4WIV A;  4RVR A;  5FB0 A;  4TTE A;  2OO1 A;  5CQA A;  5KTU A;  5HRV A;  3U5M A;  5D3L A;  4PCE A;  4OUF A;  4BHW A;  4CFK A;  4O74 A;  5F60 A;  3LJW A;  4A9M A;  5CUC A;  4XUB A;  5A7C A;  2DAT A;  3MB4 A;  4BW4 A;  2L84 A;  4PTB A;  4UIX A;  4YBM A;  3P5O A;  3U5O A;  3UV2 A;  4QSP A;  5JI8 A;  5FE9 A;  5A5O A;  5ENI A;  5C87 A;  4TYL A;  5DFB A;  5DW2 A;  5E73 A;  5L97 A;  4N4I A; 
#chains in the Genus database with same CATH topology
 4O72 A;  4HXN A;  4QEW A;  5LKT A;  5CY9 A;  4Z1S A;  5F62 A;  4YH3 A;  5EWD A;  5CQ4 A;  3RCW A;  4NRB A;  2RNW A;  5E9Y A;  4WHW A;  5LVR A;  2N9G A;  5ETB A;  5FFY A;  5TB6 A;  4IR3 A;  3UVW A;  5D0C A;  5CQ5 A;  5A85 A;  4YAD A;  3JVM A;  2D82 A;  5C8G A;  5IGN A;  4J1P A;  5KHM A;  4O75 A;  2H60 A;  5EP7 A;  4CUQ A;  4C67 A;  5F61 A;  4A9L A;  5EPR A;  5CRZ A;  5EK9 A;  5CQ7 A;  5HLS A;  4YYM A;  5EV9 A;  2OSS A;  4MEO A;  3S91 A;  5LJ2 A;  4J0R A;  4Z6I A;  3MQM A;  5A81 A;  3U5P A;  4PY6 A;  4N4G A;  3U5J A;  4HBX A;  4QSU A;  4LDF A;  2EJN A;  5EQ1 A;  5E3G A;  4QSS A;  5A83 A;  4NUC A;  5FG4 A;  5AD3 A;  4NR9 A;  5BT5 A;  4J0S A;  4NR8 A;  4YK0 A;  3VKH A;  5EIS A;  5D3P A;  4CUP A;  4UIZ A;  4CLB A;  5CUA A;  5LJ1 A;  2F6N A;  5DW1 A;  3U5N A;  4YYJ A;  4BW1 A;  4NQM A;  4UYF A;  5FE0 A;  4BW2 A;  4IOR A;  5D26 A;  5I80 A;  4TU6 A;  3D7C A;  2I7K A;  2DKW A;  4XY9 A;  2YEM A;  5F1L A;  2RO1 A;  4LYI A;  4KV4 A;  4DON A;  4QEU A;  5CUE A;  4LRG A;  5DLZ A;  3NXB A;  5D3T A;  4IR4 A;  5ENF A;  4XY8 A;  2RS9 B;  5KTX A;  3FKM X;  3HME A;  5F2P A;  5FG5 A;  3G0J A;  5FFV A;  5I88 A;  5EI4 A;  2L5E A;  5II2 A;  2WP1 A;  2FSA A;  4NYX A;  5ENH A;  4A9K A;  4QYL A;  3UVX A;  4OGI A;  1JSP B;  5ACY A;  4X2I A;  4CL9 A;  5EIC A;  4XYA A;  5IBN A;  5FE1 A;  4N4H A;  5HEN A;  5A5N A;  5FB1 A;  4AKN A;  4HXO A;  3TLP A;  2DVR A;  4IOO A;  5A5P A;  3U5K A;  4UYD A;  5CUD A;  5ENG A;  4NYV A;  5CTL A;  5KTW A;  4UYH A;  4XUA A;  1JM4 B;  5DYC A;  5C7N A;  5H1V A;  4CUT A;  4IR5 A;  4LR6 A;  4QSV A;  3DWY A;  5D3S A;  4NXJ A;  4TZ8 A;  2D9E A;  4YH4 A;  5F3A A;  2YDW A;  3U5L A;  1PUO A;  4HXM A;  3UVD A;  4PS5 A;  3D1D A;  4YC9 A;  5L98 A;  5CQ6 A;  4QNS A;  4YAT A;  2I8N A;  4NUD A;  5E74 A;  4HXK A;  4YYI A;  4NRC A;  4NQN A;  5IID A;  3D1B A;  4MEN A;  5G4S A;  3GG3 A;  4LZR A;  4N4F A;  3Q2E A;  2G4A A;  5A82 A;  5IGK A;  4HXL A;  4LC2 A;  5HCL A;  5H1T A;  4BJX A;  4UIV A;  3K2J A;  3Q2F A;  5E9K A;  5ENB A;  4PCI A;  5II1 A;  5CQT A;  4UYG A;  5L99 A;  4GPJ A;  5A5S A;  4LZ2 A;  3ERR A;  5EWH A;  5FH6 A;  2YEL A;  5E9V A;  5I83 A;  4WHU A;  4O7F A;  5DX4 A;  4C66 A;  3JVK A;  5DFD A;  4O7A A;  1X0J A;  4TS8 A;  4NS5 A;  4UIU A;  4QSR A;  2YEK A;  5FH7 A;  5L96 A;  4KV1 A;  4QC3 A;  5EM3 A;  4QR4 A;  5HEL A;  5C85 A;  5FBX A;  5HQ7 A;  2R10 A;  5LJ0 A;  5I86 A;  5F1H A;  5EU1 A;  3UW9 A;  4QY4 A;  2E3K A;  4YYG A;  4UIW A;  5HFR A;  3VKG A;  4OGJ A;  5D7X A;  5F5Z A;  2YW5 A;  5E0R A;  5COI A;  3UV5 A;  4A9H A;  4NR5 A;  5C89 A;  4O77 A;  5CZG A;  5A5R A;  4ZQL A;  4Q0O A;  5I7X A;  4NR4 A;  5CP5 A;  4UYF B;  4QYD A;  5LVQ A;  3SVH A;  4UIY A;  4A9F A;  4A9I A;  5FG6 A;  5C4Q A;  3IU6 A;  4NRA A;  5HFQ A;  5HEM A;  5D3H A;  5IGM A;  4CFL A;  5FE4 A;  5E7D A;  4A9J A;  4J3I A;  3UV4 A;  5FE8 A;  4AKH A;  4LYW A;  5I7Y A;  5CPE A;  2NXB A;  4YYD A;  2E7O A;  4QST A;  1EQF A;  4CUR A;  2R0V A;  5D24 A;  3SVF A;  5HRW A;  3O34 A;  4QB3 A;  4BW3 A;  4Z93 A;  4CUS A;  4NUE A;  2F6J A;  5AMF A;  2OUO A;  3P1C A;  4YY4 A;  5EPB A;  5H85 A;  5DKC A;  5EVA A;  4Z6H A;  3LXJ A;  5LUU A;  2DWW A;  2YQD A;  5EWC A;  5DYA A;  5AME A;  5A5Q A;  5DFC A;  4YY6 A;  5CRM A;  4O78 A;  3I3J A;  5IG6 A;  1F68 A;  5EWW A;  4YYK A;  4Z1Q A;  3JVJ A;  5E9M A;  5D25 A;  3QZT A;  3P1D A;  5FDZ A;  2YYN A;  3AQA A;  4HXS A;  4MR3 A;  5LKX A;  4QR3 A;  5KU3 A;  4O71 A;  4HBV A;  5F25 A;  4UYE A;  5D3R A;  5I89 A;  5DY7 A;  5F36 A;  5E3D A;  5DYU A;  4TU4 A;  4YAX A;  4QEV A;  2DVV A;  5ETD A;  3HMF A;  4QC1 A;  4MR5 A;  4QUU A;  5EA1 A;  5FE5 A;  5F63 A;  3SVG A;  2DVQ A;  5DKD A;  5H1U A;  5LKU A;  5FE2 A;  4MEP A;  1E6I A;  3O33 A;  5L8U A;  1ZKR A;  5HJC A;  5HM0 A;  5I29 A;  4LZS A;  4ALH A;  4HBW A;  5CGP A;  4TT2 A;  4YYN A;  4TZ2 A;  5E9L A;  5JWM A;  3QZS A;  3P1E A;  5E9I A;  4IOQ A;  5CUB A;  2LSP B;  4KCX A;  4A9O A;  4HXR A;  4YAB A;  5EGU A;  5K29 A;  5FH8 A;  2RNX A;  5DKH A;  4LYS A;  4O7C A;  3O36 A;  1WUG A;  5FFW A;  4MR4 A;  5CQ8 A;  3MUK A;  4QSQ A;  3O35 A;  4NR6 A;  5D3N A;  4YYH A;  5J0D A;  5ENJ A;  3UVY A;  4N3W A;  5BT3 A;  4UIT A;  5FE3 A;  4A9E A;  5FE6 A;  3MXF A;  5AD2 A;  5KO4 A;  4HBY A;  3MUL A;  2L85 A;  1WUM A;  5EPS A;  2RFJ A;  5DLX A;  2RI7 A;  5BT4 A;  3AAD A;  2MJV B;  3LQH A;  5CQ3 A;  4ZC9 A;  3MB3 A;  4TT4 A;  4O7B A;  2R0S A;  2R0Y A;  1N72 A;  2DVS A;  3QZV A;  4QUT A;  4CUU A;  4O70 A;  4QR5 A;  4QBM A;  5HQ5 A;  5D3J A;  4HXP A;  5CS8 A;  5DBM A;  3HMH A;  4NYW A;  3S92 A;  3P1F A;  5EWV A;  4Q0N A;  4A9N A;  4PKL A;  3LQI A;  4MR6 A;  3DAI A;  5I1Q A;  5TCM A;  5HRX A;  4MEQ A;  5CU8 A;  4QZS A;  4AKG A;  4AKI A;  4YBS A;  3JVL A;  4ALG A;  5I40 A;  5IGL A;  3O37 A;  4FLP A;  4ZW1 A;  5ENE A;  4E96 A;  4TT6 A;  3ZYU A;  4QSW A;  1ZS5 A;  2RNY A;  5L8T A;  3LQJ A;  5CUG A;  5CFW A;  5HQ6 A;  5LKZ A;  3IU5 A;  2KTB B;  5ENC A;  3ONI A;  4TQN A;  5FE7 A;  2GRC A;  4Y03 A;  4NR7 A;  3G0L A;  4IR6 A;  2WP2 A;  4QSX A;  4O7E A;  4YBT A;  2E7N A;  5DYX A;  4O76 A;  4F3I A;  5G4R A;  4WIV A;  4RVR A;  5FB0 A;  4TTE A;  2OO1 A;  5CQA A;  5KTU A;  5HRV A;  3U5M A;  5D3L A;  4PCE A;  4OUF A;  4BHW A;  4CFK A;  4O74 A;  5F60 A;  3LJW A;  4A9M A;  5CUC A;  4XUB A;  5A7C A;  2DAT A;  3MB4 A;  4BW4 A;  2L84 A;  4PTB A;  4UIX A;  4YBM A;  4AI6 A;  3P5O A;  3U5O A;  3UV2 A;  4QSP A;  5JI8 A;  5FE9 A;  5A5O A;  5ENI A;  5C87 A;  4TYL A;  5DFB A;  5DW2 A;  5E73 A;  5L97 A;  4N4I A; 
#chains in the Genus database with same CATH homology
 4O72 A;  4HXN A;  4QEW A;  5LKT A;  5CY9 A;  4Z1S A;  5F62 A;  4YH3 A;  5EWD A;  5CQ4 A;  3RCW A;  4NRB A;  2RNW A;  5E9Y A;  4WHW A;  5LVR A;  2N9G A;  5ETB A;  5FFY A;  5TB6 A;  4IR3 A;  3UVW A;  5D0C A;  5CQ5 A;  5A85 A;  4YAD A;  3JVM A;  2D82 A;  5C8G A;  5IGN A;  4J1P A;  5KHM A;  4O75 A;  2H60 A;  5EP7 A;  4CUQ A;  4C67 A;  5F61 A;  4A9L A;  5EPR A;  5CRZ A;  5EK9 A;  5CQ7 A;  5HLS A;  4YYM A;  5EV9 A;  2OSS A;  4MEO A;  3S91 A;  5LJ2 A;  4J0R A;  4Z6I A;  3MQM A;  5A81 A;  3U5P A;  4PY6 A;  4N4G A;  3U5J A;  4HBX A;  4QSU A;  4LDF A;  5EQ1 A;  5E3G A;  4QSS A;  5A83 A;  4NUC A;  5FG4 A;  5AD3 A;  4NR9 A;  5BT5 A;  4J0S A;  4NR8 A;  4YK0 A;  5EIS A;  5D3P A;  4CUP A;  4UIZ A;  4CLB A;  5CUA A;  5LJ1 A;  2F6N A;  5DW1 A;  3U5N A;  4YYJ A;  4BW1 A;  4NQM A;  4UYF A;  5FE0 A;  4BW2 A;  4IOR A;  5D26 A;  5I80 A;  4TU6 A;  3D7C A;  2I7K A;  2DKW A;  4XY9 A;  2YEM A;  5F1L A;  2RO1 A;  4LYI A;  4KV4 A;  4DON A;  4QEU A;  5CUE A;  4LRG A;  5DLZ A;  3NXB A;  5D3T A;  4IR4 A;  5ENF A;  4XY8 A;  2RS9 B;  5KTX A;  3FKM X;  3HME A;  5F2P A;  5FG5 A;  3G0J A;  5FFV A;  5I88 A;  5EI4 A;  2L5E A;  5II2 A;  2WP1 A;  2FSA A;  4NYX A;  5ENH A;  4A9K A;  4QYL A;  3UVX A;  4OGI A;  1JSP B;  5ACY A;  4X2I A;  4CL9 A;  5EIC A;  4XYA A;  5IBN A;  5FE1 A;  4N4H A;  5HEN A;  5A5N A;  5FB1 A;  4AKN A;  4HXO A;  3TLP A;  2DVR A;  4IOO A;  5A5P A;  3U5K A;  4UYD A;  5CUD A;  5ENG A;  4NYV A;  5CTL A;  5KTW A;  4UYH A;  4XUA A;  1JM4 B;  5DYC A;  5C7N A;  5H1V A;  4CUT A;  4IR5 A;  4LR6 A;  4QSV A;  3DWY A;  5D3S A;  4NXJ A;  4TZ8 A;  2D9E A;  4YH4 A;  5F3A A;  2YDW A;  3U5L A;  4HXM A;  3UVD A;  4PS5 A;  4YC9 A;  5L98 A;  5CQ6 A;  4QNS A;  4YAT A;  2I8N A;  4NUD A;  5E74 A;  4HXK A;  4YYI A;  4NRC A;  4NQN A;  5IID A;  4MEN A;  5G4S A;  3GG3 A;  4LZR A;  4N4F A;  3Q2E A;  2G4A A;  5A82 A;  5IGK A;  4HXL A;  4LC2 A;  5HCL A;  5H1T A;  4BJX A;  4UIV A;  3K2J A;  3Q2F A;  5E9K A;  5ENB A;  4PCI A;  5II1 A;  5CQT A;  4UYG A;  5L99 A;  4GPJ A;  5A5S A;  4LZ2 A;  5EWH A;  5FH6 A;  2YEL A;  5E9V A;  5I83 A;  4WHU A;  4O7F A;  5DX4 A;  4C66 A;  3JVK A;  5DFD A;  4O7A A;  1X0J A;  4TS8 A;  4NS5 A;  4UIU A;  4QSR A;  2YEK A;  5FH7 A;  5L96 A;  4KV1 A;  4QC3 A;  5EM3 A;  4QR4 A;  5HEL A;  5C85 A;  5FBX A;  5HQ7 A;  2R10 A;  5LJ0 A;  5I86 A;  5F1H A;  5EU1 A;  3UW9 A;  4QY4 A;  2E3K A;  4YYG A;  4UIW A;  5HFR A;  4OGJ A;  5D7X A;  5F5Z A;  2YW5 A;  5E0R A;  5COI A;  3UV5 A;  4A9H A;  4NR5 A;  5C89 A;  4O77 A;  5CZG A;  5A5R A;  4ZQL A;  4Q0O A;  5I7X A;  4NR4 A;  5CP5 A;  4UYF B;  4QYD A;  5LVQ A;  3SVH A;  4UIY A;  4A9F A;  4A9I A;  5FG6 A;  5C4Q A;  3IU6 A;  4NRA A;  5HFQ A;  5HEM A;  5D3H A;  5IGM A;  4CFL A;  5FE4 A;  5E7D A;  4A9J A;  4J3I A;  3UV4 A;  5FE8 A;  4LYW A;  5I7Y A;  5CPE A;  2NXB A;  4YYD A;  2E7O A;  4QST A;  1EQF A;  4CUR A;  2R0V A;  5D24 A;  3SVF A;  5HRW A;  3O34 A;  4QB3 A;  4BW3 A;  4Z93 A;  4CUS A;  4NUE A;  2F6J A;  5AMF A;  2OUO A;  3P1C A;  4YY4 A;  5EPB A;  5H85 A;  5DKC A;  5EVA A;  4Z6H A;  3LXJ A;  5LUU A;  2DWW A;  2YQD A;  5EWC A;  5DYA A;  5AME A;  5A5Q A;  5DFC A;  4YY6 A;  5CRM A;  4O78 A;  3I3J A;  5IG6 A;  1F68 A;  5EWW A;  4YYK A;  4Z1Q A;  3JVJ A;  5E9M A;  5D25 A;  3QZT A;  3P1D A;  5FDZ A;  2YYN A;  3AQA A;  4HXS A;  4MR3 A;  5LKX A;  4QR3 A;  5KU3 A;  4O71 A;  4HBV A;  5F25 A;  4UYE A;  5D3R A;  5I89 A;  5DY7 A;  5F36 A;  5E3D A;  5DYU A;  4TU4 A;  4YAX A;  4QEV A;  2DVV A;  5ETD A;  3HMF A;  4QC1 A;  4MR5 A;  4QUU A;  5EA1 A;  5FE5 A;  5F63 A;  3SVG A;  2DVQ A;  5DKD A;  5H1U A;  5LKU A;  5FE2 A;  4MEP A;  1E6I A;  3O33 A;  5L8U A;  5HM0 A;  5HJC A;  5I29 A;  4LZS A;  4ALH A;  4HBW A;  5CGP A;  4TT2 A;  4YYN A;  4TZ2 A;  5E9L A;  5JWM A;  3QZS A;  3P1E A;  5E9I A;  4IOQ A;  5CUB A;  2LSP B;  4KCX A;  4A9O A;  4HXR A;  4YAB A;  5EGU A;  5K29 A;  5FH8 A;  2RNX A;  5DKH A;  4LYS A;  4O7C A;  3O36 A;  1WUG A;  5FFW A;  4MR4 A;  5CQ8 A;  3MUK A;  4QSQ A;  3O35 A;  4NR6 A;  5D3N A;  4YYH A;  5J0D A;  5ENJ A;  3UVY A;  4N3W A;  5BT3 A;  4UIT A;  5FE3 A;  4A9E A;  5FE6 A;  3MXF A;  5AD2 A;  5KO4 A;  4HBY A;  3MUL A;  2L85 A;  1WUM A;  5EPS A;  2RFJ A;  5DLX A;  2RI7 A;  5BT4 A;  3AAD A;  2MJV B;  3LQH A;  5CQ3 A;  4ZC9 A;  3MB3 A;  4TT4 A;  4O7B A;  2R0S A;  2R0Y A;  1N72 A;  2DVS A;  3QZV A;  4QUT A;  4CUU A;  4O70 A;  4QR5 A;  4QBM A;  5HQ5 A;  5D3J A;  4HXP A;  5CS8 A;  5DBM A;  3HMH A;  4NYW A;  3S92 A;  3P1F A;  5EWV A;  4Q0N A;  4A9N A;  4PKL A;  3LQI A;  4MR6 A;  3DAI A;  5I1Q A;  5TCM A;  5HRX A;  4MEQ A;  5CU8 A;  4QZS A;  4YBS A;  3JVL A;  4ALG A;  5I40 A;  5IGL A;  3O37 A;  4FLP A;  4ZW1 A;  5ENE A;  4E96 A;  4TT6 A;  3ZYU A;  4QSW A;  1ZS5 A;  2RNY A;  5L8T A;  3LQJ A;  5CUG A;  5CFW A;  5HQ6 A;  5LKZ A;  3IU5 A;  2KTB B;  5ENC A;  3ONI A;  4TQN A;  5FE7 A;  2GRC A;  4Y03 A;  4NR7 A;  3G0L A;  4IR6 A;  2WP2 A;  4QSX A;  4O7E A;  4YBT A;  2E7N A;  5DYX A;  4O76 A;  4F3I A;  5G4R A;  4WIV A;  4RVR A;  5FB0 A;  4TTE A;  2OO1 A;  5CQA A;  5KTU A;  5HRV A;  3U5M A;  5D3L A;  4PCE A;  4OUF A;  4BHW A;  4CFK A;  4O74 A;  5F60 A;  3LJW A;  4A9M A;  5CUC A;  4XUB A;  5A7C A;  2DAT A;  3MB4 A;  4BW4 A;  2L84 A;  4PTB A;  4UIX A;  4YBM A;  3P5O A;  3U5O A;  3UV2 A;  4QSP A;  5JI8 A;  5FE9 A;  5A5O A;  5ENI A;  5C87 A;  4TYL A;  5DFB A;  5DW2 A;  5E73 A;  5L97 A;  4N4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...