5TCMA

First bromodomain from leishmania donovani ldbpk.091320 complexed with bi-2536
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
116
structure length
116
Chain Sequence
YFQGYNEADVAALVRSLDRAEDHHIFAVDVLETYPYLAESYTKVCPRRCDLATAAQKALEGAYSYDLRLEGLKADIALMASNCVAYNGPTSAYAETAAKFERYALEQIDAFVLEHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title First Bromodomain from Leishmania donovani LdBPK.091320 complexed with BI-2536
rcsb
source organism Leishmania donovani (strain bpk282a1)
total genus 43
structure length 116
sequence length 116
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5tcmA00
4A9KA 3MXFA 2R10A 5EU1A 3IU5A 5FE8A 5DX4A 3SVFA 3LQIA 5EWWA 5LKXA 5L99A 5CQTA 5CQ3A 5EP7A 5FFYA 5FG6A 3MB3A 4A9LA 4FLPA 5CGPA 4YYNA 5TB6A 4LYIA 4HXPA 1E6IA 4YYDA 4NQMA 4QSSA 4YBMA 5F62A 5BT4A 4QSWA 4UYGA 5D3RA 5CU8A 5I7XA 3UV4A 4QB3A 4WHWA 5IBNA 5KTWA 5KU3A 3TLPA 5EWCA 4N4GA 4TS8A 4NXJA 4LC2A 2WP1A 3O37A 2YYNA 5FH8A 5FB0A 5EGUA 5H1VA 3O34A 5DYCA 5EWDA 4PTBA 4Z1SA 3ONIA 3DWYA 3MUKA 4YYKA 1EQFA 5CUAA 4NUCA 5E9KA 4PKLA 5KTUA 4A9MA 4O78A 2H60A 5H85A 5AD2A 5I80A 3MULA 4IR3A 5ENEA 4QR4A 4KV1A 2F6JA 5ENIA 4X2IA 5LKTA 2E7OA 3AADA 5F1HA 3O35A 3O36A 5CPEA 5D26A 5FE0A 4NR6A 4QY4A 4NR9A 4UIUA 4YY4A 4N4HA 5FE9A 5CTLA 5EV9A 4QEWA 2KTBB 5CUCA 4BW3A 5CUBA 4O77A 5CQ4A 5BT5A 4OUFA 4HXNA 3UV2A 5CQ5A 5CQ6A 4CUUA 3GG3A 4HBYA 4HBXA 5CFWA 3JVMA 3P1DA 5HELA 3U5KA 3G0LA 5E9VA 4CUPA 4QC1A 2FSAA 4ALHA 5E3DA 4NYWA 4TYLA 3UVDA 3HMHA 5FE1A 4UIXA 5D3LA 3SVHA 4HBVA 1WUGA 4CFLA 4O7BA 4F3IA 4A9NA 5EPRA 4PY6A 3QZSA 1ZS5A 4MR4A 5ACYA 4QSRA 2DVQA 3LJWA 4HXOA 4QEVA 5FE6A 3AQAA 5HJCA 4HXKA 4WIVA 4CUSA 3I3JA 4MR5A 5HEMA 5TCMA 4BW1A 5CP5A 5EICA 2YQDA 5A5RA 3P1EA 4XUBA 3O33A 2DKWA 4O7EA 5DFBA 5H1UA 5KO4A 4O72A 3P1FA 2YW5A 5I1QA 5F60A 4LZSA 2YEMA 3QZTA 3Q2EA 5FE2A 5HQ6A 5II2A 4QR5A 4YK0A 2DVVA 4QYLA 2E3KA 2RFJA 5II1A 4HBWA 5CRZA 5DYUA 4AKNA 3RCWA 1JSPB 4YABA 4LYSA 5G4SA 3UVXA 5CZGA 5FG5A 4TTEA 4NR8A 5I29A 5LJ0A 4QNSA 4N4FA 5IGNA 4Q0OA 4QUUA 4IR4A 4MEQA 5I7YA 5DLXA 5ENFA 3P1CA 5A81A 2G4AA 4QSVA 4O74A 5EPBA 5D25A 4CFKA 4UIVA 4QSTA 4DONA 2RS9B 5CRMA 5DKDA 5DFCA 5I89A 4CURA 4A9JA 3U5PA 5IGLA 4MEOA 5D0CA 4NYVA 1X0JA 4NR4A 4O76A 3U5LA 3UVWA 5HM0A 4A9EA 5HCLA 3HMFA 4RVRA 4O7CA 4YYJA 4HXRA 5HENA 5E74A 5AMFA 4IR5A 5BT3A 2YELA 4E96A 3UW9A 3LQJA 5E3GA 4J1PA 5J0DA 5CS8A 5LKUA 5ENCA 3K2JA 5A82A 4UYFB 5A85A 1F68A 5LJ2A 4Y03A 4IOOA 4XUAA 4J3IA 5HRXA 5EA1A 2LSPB 5A5NA 5F3AA 3U5OA 5G4RA 4YYIA 5DBMA 2R0YA 4MR3A 3LQHA 4NUEA 5E9IA 3FKMX 5JI8A 5E73A 4QC3A 5L98A 2L85A 5LVQA 3UVYA 4YH3A 4QSXA 5E7DA 5D3TA 4YY6A 5ENJA 5DW2A 5IGMA 4A9OA 5FH7A 4UIYA 4UYEA 5EWHA 4NRCA 4KV4A 5L96A 5F1LA 4GPJA 5HLSA 5COIA 4NRBA 5D24A 2YEKA 5D3HA 3U5JA 5LVRA 2RNXA 2E7NA 2OUOA 3NXBA 3SVGA 4YADA 5FE5A 4UYFA 4OGJA 3U5NA 4TT4A 5A5PA 5C85A 2F6NA 4Z93A 5IG6A 3QZVA 4QBMA 4TT2A 4YH4A 4CL9A 4HXLA 4UITA 2DVRA 4QSPA 3S91A 4XYAA 5CQ7A 5EPSA 5FB1A 4IORA 2MJVB 5I86A 5A5OA 5A5SA 3HMEA 4TU4A 2DATA 2L84A 3UV5A 4WHUA 3IU6A 3JVLA 4LDFA 4J0SA 4TZ8A 5LKZA 4NRAA 5HRWA 5KTXA 5F36A 4O7FA 5KHMA 3D7CA 4NYXA 5DW1A 4LZRA 4LRGA 5CY9A 5E9YA 4N3WA 4Q0NA 4QSQA 4YC9A 4YYGA 5LUUA 3JVKA 2I7KA 5D7XA 2RNWA 5ETDA 4YATA 5C87A 4LZ2A 5K29A 5DFDA 4J0RA 2OO1A 4MEPA 4NUDA 5AMEA 5EM3A 1JM4B 5ENGA 2L5EA 4PCIA 4MENA 5C89A 3Q2FA 4UIWA 4NR7A 4PCEA 4TQNA 2NXBA 4O75A 4UYDA 5CUGA 5F63A 5DYXA 2OSSA 3ZYUA 4HXMA 5HFRA 5EQ1A 4YBSA 1WUMA 4OGIA 4XY8A 5HQ5A 4ZQLA 5DYAA 4BW2A 4QUTA 4O70A 5FH6A 4PS5A 4A9IA 5CQ8A 3G0JA 4A9HA 4ZW1A 2DVSA 4YYHA 2R0SA 5CUDA 3MQMA 5E0RA 4BW4A 2D82A 4YAXA 5IGKA 5DKCA 5FG4A 4NQNA 3P5OA 3S92A 5EISA 4LYWA 5C8GA 4TT6A 2R0VA 5DY7A 3DAIA 5EVAA 5FE4A 4UYHA 5A83A 5A7CA 5L8UA 5L8TA 5D3SA 4KCXA 5IIDA 4TU6A 2RI7A 4TZ2A 5DLZA 5F25A 5D3JA 4Z6HA 5FDZA 4BHWA 2RNYA 4Z1QA 4O71A 5I83A 2I8NA 2D9EA 4ZC9A 4IR6A 4QR3A 5I88A 5EWVA 1N72A 5A5QA 5D3NA 2WP2A 5F5ZA 5D3PA 4N4IA 4XY9A 4A9FA 5CUEA 5DKHA 3U5MA 2N9GA 5ENHA 5ENBA 4CUTA 4QYDA 5F61A 5I40A 5AD3A 4QEUA 5ETBA 4CUQA 4MR6A 5EK9A 5FFVA 5FFWA 4C67A 4O7AA 5E9LA 5LJ1A 4QZSA 4QSUA 5EI4A 4C66A 4UIZA 5CQAA 4YYMA 5FBXA 5FE3A 5L97A 4IOQA 4NS5A 3JVJA 5HFQA 4ALGA 4YBTA 5C4QA 5H1TA 2RO1A 5HRVA 4Z6IA 2GRCA 4HXSA 2YDWA 3MB4A 4CLBA 4BJXA 5F2PA 5FE7A 5JWMA 2DWWA 3LXJA 5C7NA 4LR6A 5E9MA 5HQ7A 4NR5A
chains in the Genus database with same CATH superfamily
4A9KA 3MXFA 2R10A 5EU1A 3IU5A 5FE8A 5DX4A 3SVFA 3LQIA 5EWWA 5LKXA 5L99A 5CQTA 5CQ3A 5EP7A 5FFYA 5FG6A 3MB3A 4A9LA 4FLPA 5CGPA 4YYNA 5TB6A 4LYIA 4HXPA 1E6IA 4YYDA 4NQMA 4QSSA 4YBMA 5F62A 5BT4A 4QSWA 4UYGA 5D3RA 5CU8A 5I7XA 3UV4A 4QB3A 4WHWA 5IBNA 5KTWA 5KU3A 3TLPA 5EWCA 4N4GA 4TS8A 4NXJA 4LC2A 2WP1A 3O37A 2YYNA 5FH8A 5FB0A 5EGUA 5H1VA 3O34A 5DYCA 5EWDA 4PTBA 4Z1SA 3ONIA 3DWYA 3MUKA 4YYKA 1EQFA 5CUAA 4NUCA 5E9KA 4PKLA 5KTUA 4A9MA 4O78A 2H60A 4AKGA 5H85A 5AD2A 5I80A 3MULA 4IR3A 5ENEA 4QR4A 4KV1A 2F6JA 5ENIA 4X2IA 5LKTA 2E7OA 3AADA 5F1HA 3O35A 3O36A 5CPEA 5D26A 5FE0A 4NR6A 4QY4A 4NR9A 4UIUA 4YY4A 4N4HA 5FE9A 5CTLA 5EV9A 4QEWA 2KTBB 5CUCA 4BW3A 5CUBA 4O77A 5CQ4A 5BT5A 4OUFA 4HXNA 3UV2A 5CQ5A 5CQ6A 4CUUA 3GG3A 4HBYA 4HBXA 5CFWA 3JVMA 3P1DA 5HELA 3U5KA 3G0LA 5E9VA 4CUPA 4QC1A 2FSAA 4ALHA 5E3DA 4NYWA 4TYLA 3UVDA 3HMHA 5FE1A 4UIXA 5D3LA 4AI6A 3SVHA 4HBVA 1WUGA 4CFLA 4O7BA 4F3IA 4A9NA 5EPRA 4PY6A 3QZSA 1ZS5A 4MR4A 5ACYA 4QSRA 2DVQA 3LJWA 4HXOA 4QEVA 5FE6A 3AQAA 5HJCA 4HXKA 4WIVA 4CUSA 3I3JA 4MR5A 5HEMA 5TCMA 4BW1A 5CP5A 5EICA 2YQDA 5A5RA 3P1EA 4XUBA 3O33A 2DKWA 4O7EA 5DFBA 5H1UA 5KO4A 4O72A 3P1FA 2YW5A 5I1QA 5F60A 4LZSA 2YEMA 3QZTA 3Q2EA 5FE2A 5HQ6A 5II2A 4QR5A 4YK0A 2DVVA 4QYLA 1PUOA 2E3KA 2RFJA 5II1A 4HBWA 5CRZA 5DYUA 4AKNA 3RCWA 1JSPB 4YABA 4LYSA 5G4SA 3UVXA 5CZGA 5FG5A 4TTEA 4NR8A 5I29A 5LJ0A 4QNSA 4N4FA 5IGNA 4Q0OA 3VKGA 4AKHA 4QUUA 4IR4A 4MEQA 5I7YA 5DLXA 5ENFA 1ZKRA 3P1CA 5A81A 2G4AA 4QSVA 4O74A 5EPBA 5D25A 4CFKA 4UIVA 4QSTA 4DONA 2RS9B 5CRMA 5DKDA 5DFCA 5I89A 4CURA 4A9JA 3U5PA 5IGLA 4MEOA 5D0CA 4NYVA 3D1BA 1X0JA 4NR4A 4O76A 3U5LA 3UVWA 5HM0A 4A9EA 5HCLA 4AKIA 3HMFA 4RVRA 4O7CA 4YYJA 4HXRA 5HENA 5E74A 5AMFA 4IR5A 5BT3A 2YELA 4E96A 3UW9A 3LQJA 5E3GA 4J1PA 5J0DA 5CS8A 5LKUA 5ENCA 3K2JA 5A82A 4UYFB 5A85A 1F68A 5LJ2A 4Y03A 4IOOA 4XUAA 4J3IA 5HRXA 5EA1A 2LSPB 5A5NA 5F3AA 3U5OA 5G4RA 4YYIA 5DBMA 2R0YA 4MR3A 3LQHA 4NUEA 5E9IA 3FKMX 5JI8A 5E73A 4QC3A 5L98A 2L85A 5LVQA 3UVYA 4YH3A 4QSXA 5E7DA 5D3TA 4YY6A 5ENJA 5DW2A 5IGMA 4A9OA 5FH7A 4UIYA 4UYEA 5EWHA 4NRCA 4KV4A 5L96A 5F1LA 4GPJA 5HLSA 5COIA 4NRBA 5D24A 2YEKA 5D3HA 3U5JA 5LVRA 2RNXA 2E7NA 2OUOA 3NXBA 3SVGA 4YADA 5FE5A 4UYFA 4OGJA 3U5NA 4TT4A 5A5PA 5C85A 2F6NA 4Z93A 5IG6A 3QZVA 4QBMA 4TT2A 4YH4A 4CL9A 4HXLA 4UITA 2DVRA 4QSPA 3S91A 4XYAA 5CQ7A 5EPSA 5FB1A 4IORA 2MJVB 5I86A 5A5OA 5A5SA 3HMEA 4TU4A 2DATA 2L84A 3UV5A 4WHUA 3IU6A 3JVLA 4LDFA 4J0SA 4TZ8A 5LKZA 4NRAA 5HRWA 5KTXA 5F36A 4O7FA 5KHMA 3D7CA 4NYXA 5DW1A 4LZRA 3VKHA 4LRGA 5CY9A 5E9YA 4N3WA 4Q0NA 4QSQA 4YC9A 4YYGA 5LUUA 3JVKA 2I7KA 5D7XA 2RNWA 5ETDA 4YATA 5C87A 4LZ2A 5K29A 5DFDA 4J0RA 2OO1A 4MEPA 4NUDA 5AMEA 5EM3A 2EJNA 1JM4B 5ENGA 2L5EA 4PCIA 4MENA 5C89A 3Q2FA 4UIWA 4NR7A 4PCEA 4TQNA 2NXBA 4O75A 4UYDA 5CUGA 5F63A 5DYXA 2OSSA 3D1DA 3ZYUA 4HXMA 5HFRA 5EQ1A 4YBSA 1WUMA 4OGIA 4XY8A 5HQ5A 4ZQLA 5DYAA 4BW2A 4QUTA 4O70A 5FH6A 4PS5A 4A9IA 5CQ8A 3G0JA 4A9HA 4ZW1A 2DVSA 4YYHA 2R0SA 5CUDA 3MQMA 5E0RA 4BW4A 2D82A 4YAXA 5IGKA 5DKCA 5FG4A 4NQNA 3P5OA 3S92A 5EISA 4LYWA 5C8GA 4TT6A 2R0VA 5DY7A 3DAIA 5EVAA 5FE4A 4UYHA 5A83A 5A7CA 5L8UA 5L8TA 5D3SA 4KCXA 5IIDA 4TU6A 2RI7A 4TZ2A 5DLZA 5F25A 5D3JA 4Z6HA 5FDZA 4BHWA 2RNYA 4Z1QA 4O71A 5I83A 2I8NA 2D9EA 4ZC9A 4IR6A 4QR3A 5I88A 5EWVA 1N72A 5A5QA 5D3NA 2WP2A 5F5ZA 5D3PA 4N4IA 4XY9A 4A9FA 5CUEA 5DKHA 3U5MA 2N9GA 5ENHA 5ENBA 4CUTA 4QYDA 5F61A 5I40A 5AD3A 4QEUA 5ETBA 4CUQA 4MR6A 5EK9A 3ERRA 5FFVA 5FFWA 4C67A 4O7AA 5E9LA 5LJ1A 4QZSA 4QSUA 5EI4A 4C66A 4UIZA 5CQAA 4YYMA 5FBXA 5FE3A 5L97A 4IOQA 4NS5A 3JVJA 5HFQA 4ALGA 4YBTA 5C4QA 5H1TA 2RO1A 5HRVA 4Z6IA 2GRCA 4HXSA 2YDWA 3MB4A 4CLBA 4BJXA 5F2PA 5FE7A 5JWMA 2DWWA 3LXJA 5C7NA 4LR6A 5E9MA 5HQ7A 4NR5A
chains in the Genus database with same CATH topology
4A9KA 3MXFA 2R10A 5EU1A 3IU5A 5FE8A 5DX4A 3SVFA 3LQIA 5EWWA 5LKXA 5L99A 5CQTA 5CQ3A 5EP7A 5FFYA 5FG6A 3MB3A 4A9LA 4FLPA 5CGPA 4YYNA 5TB6A 4LYIA 4HXPA 1E6IA 4YYDA 4NQMA 4QSSA 4YBMA 5F62A 5BT4A 4QSWA 4UYGA 5D3RA 5CU8A 5I7XA 3UV4A 4QB3A 4WHWA 5IBNA 5KTWA 5KU3A 3TLPA 5EWCA 4N4GA 4TS8A 4NXJA 4LC2A 2WP1A 3O37A 2YYNA 5FH8A 5FB0A 5EGUA 5H1VA 3O34A 5DYCA 5EWDA 4PTBA 4Z1SA 3ONIA 3DWYA 3MUKA 4YYKA 1EQFA 5CUAA 4NUCA 5E9KA 4PKLA 5KTUA 4A9MA 4O78A 2H60A 5H85A 5AD2A 5I80A 3MULA 4IR3A 5ENEA 4QR4A 4KV1A 2F6JA 5ENIA 4X2IA 5LKTA 2E7OA 3AADA 5F1HA 3O35A 3O36A 5CPEA 5D26A 5FE0A 4NR6A 4QY4A 4NR9A 4UIUA 4YY4A 4N4HA 5FE9A 5CTLA 5EV9A 4QEWA 2KTBB 5CUCA 4BW3A 5CUBA 4O77A 5CQ4A 5BT5A 4OUFA 4HXNA 3UV2A 5CQ5A 5CQ6A 4CUUA 3GG3A 4HBYA 4HBXA 5CFWA 3JVMA 3P1DA 5HELA 3U5KA 3G0LA 5E9VA 4CUPA 4QC1A 2FSAA 4ALHA 5E3DA 4NYWA 4TYLA 3UVDA 3HMHA 5FE1A 4UIXA 5D3LA 3SVHA 4HBVA 1WUGA 4CFLA 4O7BA 4F3IA 4A9NA 5EPRA 4PY6A 3QZSA 1ZS5A 4MR4A 5ACYA 4QSRA 2DVQA 3LJWA 4HXOA 4QEVA 5FE6A 3AQAA 5HJCA 4HXKA 4WIVA 4CUSA 3I3JA 4MR5A 5HEMA 5TCMA 4BW1A 5CP5A 5EICA 2YQDA 5A5RA 3P1EA 4XUBA 3O33A 2DKWA 4O7EA 5DFBA 5H1UA 5KO4A 4O72A 3P1FA 2YW5A 5I1QA 5F60A 4LZSA 2YEMA 3QZTA 3Q2EA 5FE2A 5HQ6A 5II2A 4QR5A 4YK0A 2DVVA 4QYLA 2E3KA 2RFJA 5II1A 4HBWA 5CRZA 5DYUA 4AKNA 3RCWA 1JSPB 4YABA 4LYSA 5G4SA 3UVXA 5CZGA 5FG5A 4TTEA 4NR8A 5I29A 5LJ0A 4QNSA 4N4FA 5IGNA 4Q0OA 4QUUA 4IR4A 4MEQA 5I7YA 5DLXA 5ENFA 3P1CA 5A81A 2G4AA 4QSVA 4O74A 5EPBA 5D25A 4CFKA 4UIVA 4QSTA 4DONA 2RS9B 5CRMA 5DKDA 5DFCA 5I89A 4CURA 4A9JA 3U5PA 5IGLA 4MEOA 5D0CA 4NYVA 1X0JA 4NR4A 4O76A 3U5LA 3UVWA 5HM0A 4A9EA 5HCLA 3HMFA 4RVRA 4O7CA 4YYJA 4HXRA 5HENA 5E74A 5AMFA 4IR5A 5BT3A 2YELA 4E96A 3UW9A 3LQJA 5E3GA 4J1PA 5J0DA 5CS8A 5LKUA 5ENCA 3K2JA 5A82A 4UYFB 5A85A 1F68A 5LJ2A 4Y03A 4IOOA 4XUAA 4J3IA 5HRXA 5EA1A 2LSPB 5A5NA 5F3AA 3U5OA 5G4RA 4YYIA 5DBMA 2R0YA 4MR3A 3LQHA 4NUEA 5E9IA 3FKMX 5JI8A 5E73A 4QC3A 5L98A 2L85A 5LVQA 3UVYA 4YH3A 4QSXA 5E7DA 5D3TA 4YY6A 5ENJA 5DW2A 5IGMA 4A9OA 5FH7A 4UIYA 4UYEA 5EWHA 4NRCA 4KV4A 5L96A 5F1LA 4GPJA 5HLSA 5COIA 4NRBA 5D24A 2YEKA 5D3HA 3U5JA 5LVRA 2RNXA 2E7NA 2OUOA 3NXBA 3SVGA 4YADA 5FE5A 4UYFA 4OGJA 3U5NA 4TT4A 5A5PA 5C85A 2F6NA 4Z93A 5IG6A 3QZVA 4QBMA 4TT2A 4YH4A 4CL9A 4HXLA 4UITA 2DVRA 4QSPA 3S91A 4XYAA 5CQ7A 5EPSA 5FB1A 4IORA 2MJVB 5I86A 5A5OA 5A5SA 3HMEA 4TU4A 2DATA 2L84A 3UV5A 4WHUA 3IU6A 3JVLA 4LDFA 4J0SA 4TZ8A 5LKZA 4NRAA 5HRWA 5KTXA 5F36A 4O7FA 5KHMA 3D7CA 4NYXA 5DW1A 4LZRA 4LRGA 5CY9A 5E9YA 4N3WA 4Q0NA 4QSQA 4YC9A 4YYGA 5LUUA 3JVKA 2I7KA 5D7XA 2RNWA 5ETDA 4YATA 5C87A 4LZ2A 5K29A 5DFDA 4J0RA 2OO1A 4MEPA 4NUDA 5AMEA 5EM3A 1JM4B 5ENGA 2L5EA 4PCIA 4MENA 5C89A 3Q2FA 4UIWA 4NR7A 4PCEA 4TQNA 2NXBA 4O75A 4UYDA 5CUGA 5F63A 5DYXA 2OSSA 3ZYUA 4HXMA 5HFRA 5EQ1A 4YBSA 1WUMA 4OGIA 4XY8A 5HQ5A 4ZQLA 5DYAA 4BW2A 4QUTA 4O70A 5FH6A 4PS5A 4A9IA 5CQ8A 3G0JA 4A9HA 4ZW1A 2DVSA 4YYHA 2R0SA 5CUDA 3MQMA 5E0RA 4BW4A 2D82A 4YAXA 5IGKA 5DKCA 5FG4A 4NQNA 3P5OA 3S92A 5EISA 4LYWA 5C8GA 4TT6A 2R0VA 5DY7A 3DAIA 5EVAA 5FE4A 4UYHA 5A83A 5A7CA 5L8UA 5L8TA 5D3SA 4KCXA 5IIDA 4TU6A 2RI7A 4TZ2A 5DLZA 5F25A 5D3JA 4Z6HA 5FDZA 4BHWA 2RNYA 4Z1QA 4O71A 5I83A 2I8NA 2D9EA 4ZC9A 4IR6A 4QR3A 5I88A 5EWVA 1N72A 5A5QA 5D3NA 2WP2A 5F5ZA 5D3PA 4N4IA 4XY9A 4A9FA 5CUEA 5DKHA 3U5MA 2N9GA 5ENHA 5ENBA 4CUTA 4QYDA 5F61A 5I40A 5AD3A 4QEUA 5ETBA 4CUQA 4MR6A 5EK9A 5FFVA 5FFWA 4C67A 4O7AA 5E9LA 5LJ1A 4QZSA 4QSUA 5EI4A 4C66A 4UIZA 5CQAA 4YYMA 5FBXA 5FE3A 5L97A 4IOQA 4NS5A 3JVJA 5HFQA 4ALGA 4YBTA 5C4QA 5H1TA 2RO1A 5HRVA 4Z6IA 2GRCA 4HXSA 2YDWA 3MB4A 4CLBA 4BJXA 5F2PA 5FE7A 5JWMA 2DWWA 3LXJA 5C7NA 4LR6A 5E9MA 5HQ7A 4NR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A9K A;  3MXF A;  2R10 A;  5EU1 A;  3IU5 A;  5FE8 A;  5DX4 A;  3SVF A;  3LQI A;  5EWW A;  5LKX A;  5L99 A;  5CQT A;  5CQ3 A;  5EP7 A;  5FFY A;  5FG6 A;  3MB3 A;  4A9L A;  4FLP A;  5CGP A;  4YYN A;  5TB6 A;  4LYI A;  4HXP A;  1E6I A;  4YYD A;  4NQM A;  4QSS A;  4YBM A;  5F62 A;  5BT4 A;  4QSW A;  4UYG A;  5D3R A;  5CU8 A;  5I7X A;  3UV4 A;  4QB3 A;  4WHW A;  5IBN A;  5KTW A;  5KU3 A;  3TLP A;  5EWC A;  4N4G A;  4TS8 A;  4NXJ A;  4LC2 A;  2WP1 A;  3O37 A;  2YYN A;  5FH8 A;  5FB0 A;  5EGU A;  5H1V A;  3O34 A;  5DYC A;  5EWD A;  4PTB A;  4Z1S A;  3ONI A;  3DWY A;  3MUK A;  4YYK A;  1EQF A;  5CUA A;  4NUC A;  5E9K A;  4PKL A;  5KTU A;  4A9M A;  4O78 A;  2H60 A;  5H85 A;  5AD2 A;  5I80 A;  3MUL A;  4IR3 A;  5ENE A;  4QR4 A;  4KV1 A;  2F6J A;  5ENI A;  4X2I A;  5LKT A;  2E7O A;  3AAD A;  5F1H A;  3O35 A;  3O36 A;  5CPE A;  5D26 A;  5FE0 A;  4NR6 A;  4QY4 A;  4NR9 A;  4UIU A;  4YY4 A;  4N4H A;  5FE9 A;  5CTL A;  5EV9 A;  4QEW A;  2KTB B;  5CUC A;  4BW3 A;  5CUB A;  4O77 A;  5CQ4 A;  5BT5 A;  4OUF A;  4HXN A;  3UV2 A;  5CQ5 A;  5CQ6 A;  4CUU A;  3GG3 A;  4HBY A;  4HBX A;  5CFW A;  3JVM A;  3P1D A;  5HEL A;  3U5K A;  3G0L A;  5E9V A;  4CUP A;  4QC1 A;  2FSA A;  4ALH A;  5E3D A;  4NYW A;  4TYL A;  3UVD A;  3HMH A;  5FE1 A;  4UIX A;  5D3L A;  3SVH A;  4HBV A;  1WUG A;  4CFL A;  4O7B A;  4F3I A;  4A9N A;  5EPR A;  4PY6 A;  3QZS A;  1ZS5 A;  4MR4 A;  5ACY A;  4QSR A;  2DVQ A;  3LJW A;  4HXO A;  4QEV A;  5FE6 A;  3AQA A;  5HJC A;  4HXK A;  4WIV A;  4CUS A;  3I3J A;  4MR5 A;  5HEM A;  5TCM A;  4BW1 A;  5CP5 A;  5EIC A;  2YQD A;  5A5R A;  3P1E A;  4XUB A;  3O33 A;  2DKW A;  4O7E A;  5DFB A;  5H1U A;  5KO4 A;  4O72 A;  3P1F A;  2YW5 A;  5I1Q A;  5F60 A;  4LZS A;  2YEM A;  3QZT A;  3Q2E A;  5FE2 A;  5HQ6 A;  5II2 A;  4QR5 A;  4YK0 A;  2DVV A;  4QYL A;  2E3K A;  2RFJ A;  5II1 A;  4HBW A;  5CRZ A;  5DYU A;  4AKN A;  3RCW A;  1JSP B;  4YAB A;  4LYS A;  5G4S A;  3UVX A;  5CZG A;  5FG5 A;  4TTE A;  4NR8 A;  5I29 A;  5LJ0 A;  4QNS A;  4N4F A;  5IGN A;  4Q0O A;  4QUU A;  4IR4 A;  4MEQ A;  5I7Y A;  5DLX A;  5ENF A;  3P1C A;  5A81 A;  2G4A A;  4QSV A;  4O74 A;  5EPB A;  5D25 A;  4CFK A;  4UIV A;  4QST A;  4DON A;  2RS9 B;  5CRM A;  5DKD A;  5DFC A;  5I89 A;  4CUR A;  4A9J A;  3U5P A;  5IGL A;  4MEO A;  5D0C A;  4NYV A;  1X0J A;  4NR4 A;  4O76 A;  3U5L A;  3UVW A;  5HM0 A;  4A9E A;  5HCL A;  3HMF A;  4RVR A;  4O7C A;  4YYJ A;  4HXR A;  5HEN A;  5E74 A;  5AMF A;  4IR5 A;  5BT3 A;  2YEL A;  4E96 A;  3UW9 A;  3LQJ A;  5E3G A;  4J1P A;  5J0D A;  5CS8 A;  5LKU A;  5ENC A;  3K2J A;  5A82 A;  4UYF B;  5A85 A;  1F68 A;  5LJ2 A;  4Y03 A;  4IOO A;  4XUA A;  4J3I A;  5HRX A;  5EA1 A;  2LSP B;  5A5N A;  5F3A A;  3U5O A;  5G4R A;  4YYI A;  5DBM A;  2R0Y A;  4MR3 A;  3LQH A;  4NUE A;  5E9I A;  3FKM X;  5JI8 A;  5E73 A;  4QC3 A;  5L98 A;  2L85 A;  5LVQ A;  3UVY A;  4YH3 A;  4QSX A;  5E7D A;  5D3T A;  4YY6 A;  5ENJ A;  5DW2 A;  5IGM A;  4A9O A;  5FH7 A;  4UIY A;  4UYE A;  5EWH A;  4NRC A;  4KV4 A;  5L96 A;  5F1L A;  4GPJ A;  5HLS A;  5COI A;  4NRB A;  5D24 A;  2YEK A;  5D3H A;  3U5J A;  5LVR A;  2RNX A;  2E7N A;  2OUO A;  3NXB A;  3SVG A;  4YAD A;  5FE5 A;  4UYF A;  4OGJ A;  3U5N A;  4TT4 A;  5A5P A;  5C85 A;  2F6N A;  4Z93 A;  5IG6 A;  3QZV A;  4QBM A;  4TT2 A;  4YH4 A;  4CL9 A;  4HXL A;  4UIT A;  2DVR A;  4QSP A;  3S91 A;  4XYA A;  5CQ7 A;  5EPS A;  5FB1 A;  4IOR A;  2MJV B;  5I86 A;  5A5O A;  5A5S A;  3HME A;  4TU4 A;  2DAT A;  2L84 A;  3UV5 A;  4WHU A;  3IU6 A;  3JVL A;  4LDF A;  4J0S A;  4TZ8 A;  5LKZ A;  4NRA A;  5HRW A;  5KTX A;  5F36 A;  4O7F A;  5KHM A;  3D7C A;  4NYX A;  5DW1 A;  4LZR A;  4LRG A;  5CY9 A;  5E9Y A;  4N3W A;  4Q0N A;  4QSQ A;  4YC9 A;  4YYG A;  5LUU A;  3JVK A;  2I7K A;  5D7X A;  2RNW A;  5ETD A;  4YAT A;  5C87 A;  4LZ2 A;  5K29 A;  5DFD A;  4J0R A;  2OO1 A;  4MEP A;  4NUD A;  5AME A;  5EM3 A;  1JM4 B;  5ENG A;  2L5E A;  4PCI A;  4MEN A;  5C89 A;  3Q2F A;  4UIW A;  4NR7 A;  4PCE A;  4TQN A;  2NXB A;  4O75 A;  4UYD A;  5CUG A;  5F63 A;  5DYX A;  2OSS A;  3ZYU A;  4HXM A;  5HFR A;  5EQ1 A;  4YBS A;  1WUM A;  4OGI A;  4XY8 A;  5HQ5 A;  4ZQL A;  5DYA A;  4BW2 A;  4QUT A;  4O70 A;  5FH6 A;  4PS5 A;  4A9I A;  5CQ8 A;  3G0J A;  4A9H A;  4ZW1 A;  2DVS A;  4YYH A;  2R0S A;  5CUD A;  3MQM A;  5E0R A;  4BW4 A;  2D82 A;  4YAX A;  5IGK A;  5DKC A;  5FG4 A;  4NQN A;  3P5O A;  3S92 A;  5EIS A;  4LYW A;  5C8G A;  4TT6 A;  2R0V A;  5DY7 A;  3DAI A;  5EVA A;  5FE4 A;  4UYH A;  5A83 A;  5A7C A;  5L8U A;  5L8T A;  5D3S A;  4KCX A;  5IID A;  4TU6 A;  2RI7 A;  4TZ2 A;  5DLZ A;  5F25 A;  5D3J A;  4Z6H A;  5FDZ A;  4BHW A;  2RNY A;  4Z1Q A;  4O71 A;  5I83 A;  2I8N A;  2D9E A;  4ZC9 A;  4IR6 A;  4QR3 A;  5I88 A;  5EWV A;  1N72 A;  5A5Q A;  5D3N A;  2WP2 A;  5F5Z A;  5D3P A;  4N4I A;  4XY9 A;  4A9F A;  5CUE A;  5DKH A;  3U5M A;  2N9G A;  5ENH A;  5ENB A;  4CUT A;  4QYD A;  5F61 A;  5I40 A;  5AD3 A;  4QEU A;  5ETB A;  4CUQ A;  4MR6 A;  5EK9 A;  5FFV A;  5FFW A;  4C67 A;  4O7A A;  5E9L A;  5LJ1 A;  4QZS A;  4QSU A;  5EI4 A;  4C66 A;  4UIZ A;  5CQA A;  4YYM A;  5FBX A;  5FE3 A;  5L97 A;  4IOQ A;  4NS5 A;  3JVJ A;  5HFQ A;  4ALG A;  4YBT A;  5C4Q A;  5H1T A;  2RO1 A;  5HRV A;  4Z6I A;  2GRC A;  4HXS A;  2YDW A;  3MB4 A;  4CLB A;  4BJX A;  5F2P A;  5FE7 A;  5JWM A;  2DWW A;  3LXJ A;  5C7N A;  4LR6 A;  5E9M A;  5HQ7 A;  4NR5 A; 
#chains in the Genus database with same CATH topology
 4A9K A;  3MXF A;  2R10 A;  5EU1 A;  3IU5 A;  5FE8 A;  5DX4 A;  3SVF A;  3LQI A;  5EWW A;  5LKX A;  5L99 A;  5CQT A;  5CQ3 A;  5EP7 A;  5FFY A;  5FG6 A;  3MB3 A;  4A9L A;  4FLP A;  5CGP A;  4YYN A;  5TB6 A;  4LYI A;  4HXP A;  1E6I A;  4YYD A;  4NQM A;  4QSS A;  4YBM A;  5F62 A;  5BT4 A;  4QSW A;  4UYG A;  5D3R A;  5CU8 A;  5I7X A;  3UV4 A;  4QB3 A;  4WHW A;  5IBN A;  5KTW A;  5KU3 A;  3TLP A;  5EWC A;  4N4G A;  4TS8 A;  4NXJ A;  4LC2 A;  2WP1 A;  3O37 A;  2YYN A;  5FH8 A;  5FB0 A;  5EGU A;  5H1V A;  3O34 A;  5DYC A;  5EWD A;  4PTB A;  4Z1S A;  3ONI A;  3DWY A;  3MUK A;  4YYK A;  1EQF A;  5CUA A;  4NUC A;  5E9K A;  4PKL A;  5KTU A;  4A9M A;  4O78 A;  2H60 A;  4AKG A;  5H85 A;  5AD2 A;  5I80 A;  3MUL A;  4IR3 A;  5ENE A;  4QR4 A;  4KV1 A;  2F6J A;  5ENI A;  4X2I A;  5LKT A;  2E7O A;  3AAD A;  5F1H A;  3O35 A;  3O36 A;  5CPE A;  5D26 A;  5FE0 A;  4NR6 A;  4QY4 A;  4NR9 A;  4UIU A;  4YY4 A;  4N4H A;  5FE9 A;  5CTL A;  5EV9 A;  4QEW A;  2KTB B;  5CUC A;  4BW3 A;  5CUB A;  4O77 A;  5CQ4 A;  5BT5 A;  4OUF A;  4HXN A;  3UV2 A;  5CQ5 A;  5CQ6 A;  4CUU A;  3GG3 A;  4HBY A;  4HBX A;  5CFW A;  3JVM A;  3P1D A;  5HEL A;  3U5K A;  3G0L A;  5E9V A;  4CUP A;  4QC1 A;  2FSA A;  4ALH A;  5E3D A;  4NYW A;  4TYL A;  3UVD A;  3HMH A;  5FE1 A;  4UIX A;  5D3L A;  4AI6 A;  3SVH A;  4HBV A;  1WUG A;  4CFL A;  4O7B A;  4F3I A;  4A9N A;  5EPR A;  4PY6 A;  3QZS A;  1ZS5 A;  4MR4 A;  5ACY A;  4QSR A;  2DVQ A;  3LJW A;  4HXO A;  4QEV A;  5FE6 A;  3AQA A;  5HJC A;  4HXK A;  4WIV A;  4CUS A;  3I3J A;  4MR5 A;  5HEM A;  5TCM A;  4BW1 A;  5CP5 A;  5EIC A;  2YQD A;  5A5R A;  3P1E A;  4XUB A;  3O33 A;  2DKW A;  4O7E A;  5DFB A;  5H1U A;  5KO4 A;  4O72 A;  3P1F A;  2YW5 A;  5I1Q A;  5F60 A;  4LZS A;  2YEM A;  3QZT A;  3Q2E A;  5FE2 A;  5HQ6 A;  5II2 A;  4QR5 A;  4YK0 A;  2DVV A;  4QYL A;  1PUO A;  2E3K A;  2RFJ A;  5II1 A;  4HBW A;  5CRZ A;  5DYU A;  4AKN A;  3RCW A;  1JSP B;  4YAB A;  4LYS A;  5G4S A;  3UVX A;  5CZG A;  5FG5 A;  4TTE A;  4NR8 A;  5I29 A;  5LJ0 A;  4QNS A;  4N4F A;  5IGN A;  4Q0O A;  3VKG A;  4AKH A;  4QUU A;  4IR4 A;  4MEQ A;  5I7Y A;  5DLX A;  5ENF A;  1ZKR A;  3P1C A;  5A81 A;  2G4A A;  4QSV A;  4O74 A;  5EPB A;  5D25 A;  4CFK A;  4UIV A;  4QST A;  4DON A;  2RS9 B;  5CRM A;  5DKD A;  5DFC A;  5I89 A;  4CUR A;  4A9J A;  3U5P A;  5IGL A;  4MEO A;  5D0C A;  4NYV A;  3D1B A;  1X0J A;  4NR4 A;  4O76 A;  3U5L A;  3UVW A;  5HM0 A;  4A9E A;  5HCL A;  4AKI A;  3HMF A;  4RVR A;  4O7C A;  4YYJ A;  4HXR A;  5HEN A;  5E74 A;  5AMF A;  4IR5 A;  5BT3 A;  2YEL A;  4E96 A;  3UW9 A;  3LQJ A;  5E3G A;  4J1P A;  5J0D A;  5CS8 A;  5LKU A;  5ENC A;  3K2J A;  5A82 A;  4UYF B;  5A85 A;  1F68 A;  5LJ2 A;  4Y03 A;  4IOO A;  4XUA A;  4J3I A;  5HRX A;  5EA1 A;  2LSP B;  5A5N A;  5F3A A;  3U5O A;  5G4R A;  4YYI A;  5DBM A;  2R0Y A;  4MR3 A;  3LQH A;  4NUE A;  5E9I A;  3FKM X;  5JI8 A;  5E73 A;  4QC3 A;  5L98 A;  2L85 A;  5LVQ A;  3UVY A;  4YH3 A;  4QSX A;  5E7D A;  5D3T A;  4YY6 A;  5ENJ A;  5DW2 A;  5IGM A;  4A9O A;  5FH7 A;  4UIY A;  4UYE A;  5EWH A;  4NRC A;  4KV4 A;  5L96 A;  5F1L A;  4GPJ A;  5HLS A;  5COI A;  4NRB A;  5D24 A;  2YEK A;  5D3H A;  3U5J A;  5LVR A;  2RNX A;  2E7N A;  2OUO A;  3NXB A;  3SVG A;  4YAD A;  5FE5 A;  4UYF A;  4OGJ A;  3U5N A;  4TT4 A;  5A5P A;  5C85 A;  2F6N A;  4Z93 A;  5IG6 A;  3QZV A;  4QBM A;  4TT2 A;  4YH4 A;  4CL9 A;  4HXL A;  4UIT A;  2DVR A;  4QSP A;  3S91 A;  4XYA A;  5CQ7 A;  5EPS A;  5FB1 A;  4IOR A;  2MJV B;  5I86 A;  5A5O A;  5A5S A;  3HME A;  4TU4 A;  2DAT A;  2L84 A;  3UV5 A;  4WHU A;  3IU6 A;  3JVL A;  4LDF A;  4J0S A;  4TZ8 A;  5LKZ A;  4NRA A;  5HRW A;  5KTX A;  5F36 A;  4O7F A;  5KHM A;  3D7C A;  4NYX A;  5DW1 A;  4LZR A;  3VKH A;  4LRG A;  5CY9 A;  5E9Y A;  4N3W A;  4Q0N A;  4QSQ A;  4YC9 A;  4YYG A;  5LUU A;  3JVK A;  2I7K A;  5D7X A;  2RNW A;  5ETD A;  4YAT A;  5C87 A;  4LZ2 A;  5K29 A;  5DFD A;  4J0R A;  2OO1 A;  4MEP A;  4NUD A;  5AME A;  5EM3 A;  2EJN A;  1JM4 B;  5ENG A;  2L5E A;  4PCI A;  4MEN A;  5C89 A;  3Q2F A;  4UIW A;  4NR7 A;  4PCE A;  4TQN A;  2NXB A;  4O75 A;  4UYD A;  5CUG A;  5F63 A;  5DYX A;  2OSS A;  3D1D A;  3ZYU A;  4HXM A;  5HFR A;  5EQ1 A;  4YBS A;  1WUM A;  4OGI A;  4XY8 A;  5HQ5 A;  4ZQL A;  5DYA A;  4BW2 A;  4QUT A;  4O70 A;  5FH6 A;  4PS5 A;  4A9I A;  5CQ8 A;  3G0J A;  4A9H A;  4ZW1 A;  2DVS A;  4YYH A;  2R0S A;  5CUD A;  3MQM A;  5E0R A;  4BW4 A;  2D82 A;  4YAX A;  5IGK A;  5DKC A;  5FG4 A;  4NQN A;  3P5O A;  3S92 A;  5EIS A;  4LYW A;  5C8G A;  4TT6 A;  2R0V A;  5DY7 A;  3DAI A;  5EVA A;  5FE4 A;  4UYH A;  5A83 A;  5A7C A;  5L8U A;  5L8T A;  5D3S A;  4KCX A;  5IID A;  4TU6 A;  2RI7 A;  4TZ2 A;  5DLZ A;  5F25 A;  5D3J A;  4Z6H A;  5FDZ A;  4BHW A;  2RNY A;  4Z1Q A;  4O71 A;  5I83 A;  2I8N A;  2D9E A;  4ZC9 A;  4IR6 A;  4QR3 A;  5I88 A;  5EWV A;  1N72 A;  5A5Q A;  5D3N A;  2WP2 A;  5F5Z A;  5D3P A;  4N4I A;  4XY9 A;  4A9F A;  5CUE A;  5DKH A;  3U5M A;  2N9G A;  5ENH A;  5ENB A;  4CUT A;  4QYD A;  5F61 A;  5I40 A;  5AD3 A;  4QEU A;  5ETB A;  4CUQ A;  4MR6 A;  5EK9 A;  3ERR A;  5FFV A;  5FFW A;  4C67 A;  4O7A A;  5E9L A;  5LJ1 A;  4QZS A;  4QSU A;  5EI4 A;  4C66 A;  4UIZ A;  5CQA A;  4YYM A;  5FBX A;  5FE3 A;  5L97 A;  4IOQ A;  4NS5 A;  3JVJ A;  5HFQ A;  4ALG A;  4YBT A;  5C4Q A;  5H1T A;  2RO1 A;  5HRV A;  4Z6I A;  2GRC A;  4HXS A;  2YDW A;  3MB4 A;  4CLB A;  4BJX A;  5F2P A;  5FE7 A;  5JWM A;  2DWW A;  3LXJ A;  5C7N A;  4LR6 A;  5E9M A;  5HQ7 A;  4NR5 A; 
#chains in the Genus database with same CATH homology
 4A9K A;  3MXF A;  2R10 A;  5EU1 A;  3IU5 A;  5FE8 A;  5DX4 A;  3SVF A;  3LQI A;  5EWW A;  5LKX A;  5L99 A;  5CQT A;  5CQ3 A;  5EP7 A;  5FFY A;  5FG6 A;  3MB3 A;  4A9L A;  4FLP A;  5CGP A;  4YYN A;  5TB6 A;  4LYI A;  4HXP A;  1E6I A;  4YYD A;  4NQM A;  4QSS A;  4YBM A;  5F62 A;  5BT4 A;  4QSW A;  4UYG A;  5D3R A;  5CU8 A;  5I7X A;  3UV4 A;  4QB3 A;  4WHW A;  5IBN A;  5KTW A;  5KU3 A;  3TLP A;  5EWC A;  4N4G A;  4TS8 A;  4NXJ A;  4LC2 A;  2WP1 A;  3O37 A;  2YYN A;  5FH8 A;  5FB0 A;  5EGU A;  5H1V A;  3O34 A;  5DYC A;  5EWD A;  4PTB A;  4Z1S A;  3ONI A;  3DWY A;  3MUK A;  4YYK A;  1EQF A;  5CUA A;  4NUC A;  5E9K A;  4PKL A;  5KTU A;  4A9M A;  4O78 A;  2H60 A;  5H85 A;  5AD2 A;  5I80 A;  3MUL A;  4IR3 A;  5ENE A;  4QR4 A;  4KV1 A;  2F6J A;  5ENI A;  4X2I A;  5LKT A;  2E7O A;  3AAD A;  5F1H A;  3O35 A;  3O36 A;  5CPE A;  5D26 A;  5FE0 A;  4NR6 A;  4QY4 A;  4NR9 A;  4UIU A;  4YY4 A;  4N4H A;  5FE9 A;  5CTL A;  5EV9 A;  4QEW A;  2KTB B;  5CUC A;  4BW3 A;  5CUB A;  4O77 A;  5CQ4 A;  5BT5 A;  4OUF A;  4HXN A;  3UV2 A;  5CQ5 A;  5CQ6 A;  4CUU A;  3GG3 A;  4HBY A;  4HBX A;  5CFW A;  3JVM A;  3P1D A;  5HEL A;  3U5K A;  3G0L A;  5E9V A;  4CUP A;  4QC1 A;  2FSA A;  4ALH A;  5E3D A;  4NYW A;  4TYL A;  3UVD A;  3HMH A;  5FE1 A;  4UIX A;  5D3L A;  3SVH A;  4HBV A;  1WUG A;  4CFL A;  4O7B A;  4F3I A;  4A9N A;  5EPR A;  4PY6 A;  3QZS A;  1ZS5 A;  4MR4 A;  5ACY A;  4QSR A;  2DVQ A;  3LJW A;  4HXO A;  4QEV A;  5FE6 A;  3AQA A;  5HJC A;  4HXK A;  4WIV A;  4CUS A;  3I3J A;  4MR5 A;  5HEM A;  5TCM A;  4BW1 A;  5CP5 A;  5EIC A;  2YQD A;  5A5R A;  3P1E A;  4XUB A;  3O33 A;  2DKW A;  4O7E A;  5DFB A;  5H1U A;  5KO4 A;  4O72 A;  3P1F A;  2YW5 A;  5I1Q A;  5F60 A;  4LZS A;  2YEM A;  3QZT A;  3Q2E A;  5FE2 A;  5HQ6 A;  5II2 A;  4QR5 A;  4YK0 A;  2DVV A;  4QYL A;  2E3K A;  2RFJ A;  5II1 A;  4HBW A;  5CRZ A;  5DYU A;  4AKN A;  3RCW A;  1JSP B;  4YAB A;  4LYS A;  5G4S A;  3UVX A;  5CZG A;  5FG5 A;  4TTE A;  4NR8 A;  5I29 A;  5LJ0 A;  4QNS A;  4N4F A;  5IGN A;  4Q0O A;  4QUU A;  4IR4 A;  4MEQ A;  5I7Y A;  5DLX A;  5ENF A;  3P1C A;  5A81 A;  2G4A A;  4QSV A;  4O74 A;  5EPB A;  5D25 A;  4CFK A;  4UIV A;  4QST A;  4DON A;  2RS9 B;  5CRM A;  5DKD A;  5DFC A;  5I89 A;  4CUR A;  4A9J A;  3U5P A;  5IGL A;  4MEO A;  5D0C A;  4NYV A;  1X0J A;  4NR4 A;  4O76 A;  3U5L A;  3UVW A;  5HM0 A;  4A9E A;  5HCL A;  3HMF A;  4RVR A;  4O7C A;  4YYJ A;  4HXR A;  5HEN A;  5E74 A;  5AMF A;  4IR5 A;  5BT3 A;  2YEL A;  4E96 A;  3UW9 A;  3LQJ A;  5E3G A;  4J1P A;  5J0D A;  5CS8 A;  5LKU A;  5ENC A;  3K2J A;  5A82 A;  4UYF B;  5A85 A;  1F68 A;  5LJ2 A;  4Y03 A;  4IOO A;  4XUA A;  4J3I A;  5HRX A;  5EA1 A;  2LSP B;  5A5N A;  5F3A A;  3U5O A;  5G4R A;  4YYI A;  5DBM A;  2R0Y A;  4MR3 A;  3LQH A;  4NUE A;  5E9I A;  3FKM X;  5JI8 A;  5E73 A;  4QC3 A;  5L98 A;  2L85 A;  5LVQ A;  3UVY A;  4YH3 A;  4QSX A;  5E7D A;  5D3T A;  4YY6 A;  5ENJ A;  5DW2 A;  5IGM A;  4A9O A;  5FH7 A;  4UIY A;  4UYE A;  5EWH A;  4NRC A;  4KV4 A;  5L96 A;  5F1L A;  4GPJ A;  5HLS A;  5COI A;  4NRB A;  5D24 A;  2YEK A;  5D3H A;  3U5J A;  5LVR A;  2RNX A;  2E7N A;  2OUO A;  3NXB A;  3SVG A;  4YAD A;  5FE5 A;  4UYF A;  4OGJ A;  3U5N A;  4TT4 A;  5A5P A;  5C85 A;  2F6N A;  4Z93 A;  5IG6 A;  3QZV A;  4QBM A;  4TT2 A;  4YH4 A;  4CL9 A;  4HXL A;  4UIT A;  2DVR A;  4QSP A;  3S91 A;  4XYA A;  5CQ7 A;  5EPS A;  5FB1 A;  4IOR A;  2MJV B;  5I86 A;  5A5O A;  5A5S A;  3HME A;  4TU4 A;  2DAT A;  2L84 A;  3UV5 A;  4WHU A;  3IU6 A;  3JVL A;  4LDF A;  4J0S A;  4TZ8 A;  5LKZ A;  4NRA A;  5HRW A;  5KTX A;  5F36 A;  4O7F A;  5KHM A;  3D7C A;  4NYX A;  5DW1 A;  4LZR A;  4LRG A;  5CY9 A;  5E9Y A;  4N3W A;  4Q0N A;  4QSQ A;  4YC9 A;  4YYG A;  5LUU A;  3JVK A;  2I7K A;  5D7X A;  2RNW A;  5ETD A;  4YAT A;  5C87 A;  4LZ2 A;  5K29 A;  5DFD A;  4J0R A;  2OO1 A;  4MEP A;  4NUD A;  5AME A;  5EM3 A;  1JM4 B;  5ENG A;  2L5E A;  4PCI A;  4MEN A;  5C89 A;  3Q2F A;  4UIW A;  4NR7 A;  4PCE A;  4TQN A;  2NXB A;  4O75 A;  4UYD A;  5CUG A;  5F63 A;  5DYX A;  2OSS A;  3ZYU A;  4HXM A;  5HFR A;  5EQ1 A;  4YBS A;  1WUM A;  4OGI A;  4XY8 A;  5HQ5 A;  4ZQL A;  5DYA A;  4BW2 A;  4QUT A;  4O70 A;  5FH6 A;  4PS5 A;  4A9I A;  5CQ8 A;  3G0J A;  4A9H A;  4ZW1 A;  2DVS A;  4YYH A;  2R0S A;  5CUD A;  3MQM A;  5E0R A;  4BW4 A;  2D82 A;  4YAX A;  5IGK A;  5DKC A;  5FG4 A;  4NQN A;  3P5O A;  3S92 A;  5EIS A;  4LYW A;  5C8G A;  4TT6 A;  2R0V A;  5DY7 A;  3DAI A;  5EVA A;  5FE4 A;  4UYH A;  5A83 A;  5A7C A;  5L8U A;  5L8T A;  5D3S A;  4KCX A;  5IID A;  4TU6 A;  2RI7 A;  4TZ2 A;  5DLZ A;  5F25 A;  5D3J A;  4Z6H A;  5FDZ A;  4BHW A;  2RNY A;  4Z1Q A;  4O71 A;  5I83 A;  2I8N A;  2D9E A;  4ZC9 A;  4IR6 A;  4QR3 A;  5I88 A;  5EWV A;  1N72 A;  5A5Q A;  5D3N A;  2WP2 A;  5F5Z A;  5D3P A;  4N4I A;  4XY9 A;  4A9F A;  5CUE A;  5DKH A;  3U5M A;  2N9G A;  5ENH A;  5ENB A;  4CUT A;  4QYD A;  5F61 A;  5I40 A;  5AD3 A;  4QEU A;  5ETB A;  4CUQ A;  4MR6 A;  5EK9 A;  5FFV A;  5FFW A;  4C67 A;  4O7A A;  5E9L A;  5LJ1 A;  4QZS A;  4QSU A;  5EI4 A;  4C66 A;  4UIZ A;  5CQA A;  4YYM A;  5FBX A;  5FE3 A;  5L97 A;  4IOQ A;  4NS5 A;  3JVJ A;  5HFQ A;  4ALG A;  4YBT A;  5C4Q A;  5H1T A;  2RO1 A;  5HRV A;  4Z6I A;  2GRC A;  4HXS A;  2YDW A;  3MB4 A;  4CLB A;  4BJX A;  5F2P A;  5FE7 A;  5JWM A;  2DWW A;  3LXJ A;  5C7N A;  4LR6 A;  5E9M A;  5HQ7 A;  4NR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...