4YYNA

Crystal structure of taf1 bd2 bromodomain bound to a crotonyllysine peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
DDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID subunit 1
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 54
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yynA00
5ENCA 1E6IA 5EP7A 4Z6HA 4HXNA 4NYWA 4QBMA 5A5SA 5II1A 5D3NA 4TT2A 5FE5A 4O72A 3UVYA 5DYCA 3LQHA 5HFQA 4MEPA 5D0CA 5FH8A 4A9OA 3LXJA 4O7AA 4YABA 4YYGA 4UIXA 5E74A 5EM3A 5EPBA 5BT4A 4Z93A 2D9EA 4HBXA 4XUAA 5CPEA 4A9HA 3UVXA 3O34A 4N4HA 2L84A 5F25A 4ZW1A 5H1TA 3JVLA 4HXSA 4HBWA 4O74A 4NRBA 4F3IA 3FKMX 2R0YA 3LJWA 4PCIA 4YAXA 2OSSA 5L98A 3JVJA 5BT3A 5JI8A 4N4GA 4UYFA 3U5PA 5D3RA 5A5RA 3MB4A 5EWHA 4O70A 5CGPA 2RFJA 4QUTA 2DVSA 5D3SA 4XY9A 5AD3A 5HRWA 5ETDA 5LKUA 5A82A 4NR9A 4A9NA 4ZQLA 5DYXA 5F60A 4MEOA 4YYKA 5C87A 5IGLA 5C89A 5ENHA 3HMEA 5A5NA 3QZSA 5KHMA 4A9LA 5CS8A 4O7EA 4OUFA 3P1FA 5D3TA 5D24A 4J0SA 3AADA 4YBMA 4TYLA 4QSRA 4QSSA 4YADA 1WUGA 4YK0A 5ENIA 4KV4A 4UITA 1JM4B 4LYIA 3UV5A 4QSXA 5I40A 5FG5A 4XYAA 4UYHA 4ALHA 5IGNA 2GRCA 5II2A 4BW4A 3MB3A 5E9IA 4YC9A 4TS8A 5CFWA 5FFWA 4YYJA 5EISA 3MXFA 2WP1A 5TB6A 2RI7A 3O35A 4O71A 5HQ5A 4NR7A 4MR6A 3Q2EA 5EVAA 2RNXA 5KTXA 4N4FA 2FSAA 2YELA 5CZGA 4MR5A 5L8TA 5CUEA 1F68A 4O78A 4TZ8A 5CP5A 2MJVB 2YW5A 3UV2A 5E9MA 4QSTA 5FE8A 2YEMA 5F36A 4NYXA 5F3AA 4GPJA 1WUMA 4MR4A 2G4AA 5I89A 5K29A 5DLZA 4CUTA 4QEUA 4YY4A 4NR6A 5C7NA 3P1DA 5IGMA 4MEQA 3O36A 2L85A 2DKWA 4QSWA 4LR6A 5A85A 5I7YA 5ACYA 5DYAA 4A9FA 3Q2FA 3MUKA 4XY8A 4QSQA 4MR3A 5FE2A 2I7KA 5TCMA 4O75A 5FE3A 4N3WA 5F2PA 5I86A 5CUDA 5LKXA 5FE1A 2LSPB 4Z6IA 4TU6A 5AMFA 3U5NA 4HXPA 4BW1A 4Q0OA 4A9JA 3S91A 3U5OA 5F1LA 5HQ7A 3P5OA 5E9KA 4CLBA 2L5EA 4UYFB 3MQMA 5ENGA 5EWDA 4LYSA 3I3JA 5ENBA 5FE9A 4QSPA 5IG6A 4IR5A 4BW3A 4KCXA 4A9IA 5EWCA 5L96A 2DATA 4QR5A 4ALGA 4HXRA 4LC2A 5DX4A 5D3LA 3IU6A 4IORA 3SVGA 5EGUA 4O7BA 4J1PA 5E7DA 4O77A 5FFYA 5E3GA 5FFVA 5F61A 4C67A 3ZYUA 4NRAA 5EI4A 4C66A 4QR3A 5EV9A 5DW2A 5BT5A 5J0DA 5DLXA 4ZC9A 2E3KA 4UIWA 3HMHA 5I80A 3MULA 4CUQA 4YBTA 5ETBA 5E9VA 5HENA 5FE7A 5F1HA 5CQ8A 4PY6A 5HRXA 4CFKA 5A5OA 4YBSA 4QY4A 5CQ5A 4CUSA 5FE0A 4UIVA 4LZRA 4IR6A 4Z1SA 4Z1QA 3UV4A 4Q0NA 3JVMA 4J0RA 2R10A 4X2IA 5HCLA 2F6NA 5E9YA 4IR4A 4YYDA 3GG3A 5DKDA 3NXBA 4QYDA 5I83A 5KTUA 4UIYA 4YY6A 4PS5A 5DKHA 5E0RA 4RVRA 5DBMA 5C85A 5CY9A 5HELA 2YQDA 3U5JA 1JSPB 3DWYA 4A9EA 5A5PA 5KO4A 4IR3A 4DONA 5H1VA 4WHUA 4HBVA 4CL9A 4YH3A 3HMFA 4QEWA 5LVQA 5ENEA 4YH4A 5L97A 5LJ0A 4WHWA 4NS5A 3DAIA 4TZ2A 3O37A 2NXBA 4CURA 2YDWA 5LKZA 3SVHA 5A5QA 4CFLA 4BJXA 5FE6A 3UVWA 4YYIA 5C8GA 5CQ7A 2F6JA 4HXLA 4UIUA 2RO1A 5LKTA 4YYMA 4O7CA 5D3PA 5FH6A 4LDFA 5CTLA 5CRZA 3P1CA 3LQIA 4UIZA 4HXMA 5CRMA 5CQAA 2N9GA 2RNYA 4IOQA 5EWVA 4OGJA 5AD2A 4WIVA 5E73A 4LYWA 4A9KA 4TT6A 5A7CA 4TT4A 5HEMA 4NR8A 5DY7A 5DYUA 5FG4A 3QZVA 3AQAA 5F62A 4CUPA 4YYHA 4QR4A 4UYEA 2OO1A 5FB1A 4LRGA 4PTBA 2WP2A 2D82A 5LJ2A 1X0JA 4BW2A 4YATA 4LZ2A 4NQNA 3ONIA 4HXKA 5CQ3A 5LUUA 5G4SA 4TU4A 3G0JA 5IGKA 3D7CA 3UW9A 2DVVA 4XUBA 5F63A 4QYLA 4Y03A 4QUUA 5HFRA 4QB3A 5AMEA 5I1QA 5E3DA 3P1EA 5D7XA 4NQMA 5ENFA 3U5MA 2R0VA 3RCWA 5HLSA 2I8NA 5DFCA 3S92A 5FBXA 2OUOA 5JWMA 5EICA 5ENJA 5FB0A 5CU8A 4TTEA 4NR4A 5DKCA 3QZTA 5H1UA 5F5ZA 4LZSA 5HRVA 4J3IA 5G4RA 4NUDA 5FG6A 3O33A 4QEVA 5A83A 2E7NA 5H85A 4IOOA 5IIDA 5L8UA 1N72A 3SVFA 5EK9A 2DVQA 5FH7A 1EQFA 5DFDA 5D26A 5DW1A 5CQ6A 5L99A 4QSUA 5I7XA 4OGIA 4QC3A 5LJ1A 3G0LA 2E7OA 4NXJA 5EU1A 4CUUA 5D25A 3JVKA 5E9LA 2YYNA 5HQ6A 4O76A 5CUAA 4QC1A 4QNSA 5KTWA 5EPSA 5C4QA 5HJCA 3IU5A 5FE4A 5CUGA 4BHWA 2H60A 5CUBA 4PKLA 4QSVA 5DFBA 4QZSA 5COIA 2RS9B 1ZS5A 4NRCA 4NUEA 4FLPA 4PCEA 5D3HA 4KV1A 3LQJA 5EWWA 4NYVA 3TLPA 4E96A 4NUCA 5EQ1A 4N4IA 3U5LA 2DVRA 5IBNA 5I88A 2KTBB 3U5KA 2R0SA 2RNWA 5EA1A 4NR5A 5KU3A 2DWWA 4UYGA 4UYDA 5FDZA 5A81A 5CQTA 4TQNA 4HXOA 5EPRA 4YYNA 4A9MA 4MENA 5D3JA 3UVDA 5LVRA 4HBYA 5I29A 5CQ4A 4AKNA 2YEKA 5CUCA 4O7FA 3K2JA 5HM0A
chains in the Genus database with same CATH superfamily
5ENCA 1E6IA 5EP7A 4Z6HA 4HXNA 4NYWA 4QBMA 5A5SA 5II1A 5D3NA 4TT2A 5FE5A 4O72A 3UVYA 5DYCA 3LQHA 5HFQA 4MEPA 5D0CA 5FH8A 4A9OA 3LXJA 4O7AA 4YABA 4YYGA 4UIXA 5E74A 5EM3A 5EPBA 5BT4A 4Z93A 2D9EA 4HBXA 4XUAA 5CPEA 4A9HA 3UVXA 3O34A 4N4HA 2L84A 5F25A 4ZW1A 5H1TA 3JVLA 4HXSA 4HBWA 4O74A 4NRBA 4F3IA 3FKMX 2R0YA 3LJWA 4PCIA 4YAXA 2OSSA 5L98A 3JVJA 5BT3A 5JI8A 4N4GA 4UYFA 3U5PA 5D3RA 5A5RA 3MB4A 5EWHA 4O70A 5CGPA 2RFJA 4QUTA 2DVSA 5D3SA 4XY9A 5AD3A 5HRWA 5ETDA 5LKUA 5A82A 4NR9A 4A9NA 4ZQLA 5DYXA 5F60A 4MEOA 4YYKA 5C87A 5IGLA 5C89A 5ENHA 3HMEA 2EJNA 5A5NA 3QZSA 5KHMA 4A9LA 5CS8A 4O7EA 4OUFA 3P1FA 5D3TA 4AKHA 5D24A 4J0SA 3AADA 4YBMA 4TYLA 4QSRA 4QSSA 4YADA 1WUGA 4YK0A 5ENIA 4KV4A 4UITA 1JM4B 4LYIA 3UV5A 4QSXA 5I40A 5FG5A 4XYAA 4UYHA 4ALHA 5IGNA 2GRCA 5II2A 4BW4A 3MB3A 5E9IA 4YC9A 4TS8A 5CFWA 5FFWA 4YYJA 5EISA 3MXFA 2WP1A 5TB6A 2RI7A 3O35A 4O71A 5HQ5A 4NR7A 4MR6A 3Q2EA 5EVAA 2RNXA 5KTXA 4N4FA 2FSAA 2YELA 5CZGA 4MR5A 5L8TA 5CUEA 1F68A 4O78A 4TZ8A 5CP5A 2MJVB 2YW5A 3UV2A 5E9MA 4QSTA 5FE8A 2YEMA 3D1DA 5F36A 4NYXA 3D1BA 5F3AA 4GPJA 1WUMA 4MR4A 2G4AA 5I89A 5K29A 4AKGA 5DLZA 4CUTA 4QEUA 4YY4A 4NR6A 5C7NA 3P1DA 5IGMA 4MEQA 3O36A 4AKIA 2L85A 2DKWA 4QSWA 4LR6A 5A85A 5I7YA 5ACYA 5DYAA 4A9FA 3Q2FA 3MUKA 4XY8A 4QSQA 4MR3A 5FE2A 2I7KA 5TCMA 4O75A 5FE3A 4N3WA 5F2PA 5I86A 5CUDA 5LKXA 5FE1A 2LSPB 4Z6IA 4TU6A 5AMFA 3U5NA 4HXPA 4BW1A 4Q0OA 4A9JA 3S91A 3U5OA 5F1LA 5HQ7A 3P5OA 5E9KA 4CLBA 2L5EA 4UYFB 3VKHA 3MQMA 5ENGA 5EWDA 4LYSA 1PUOA 3I3JA 5ENBA 5FE9A 4QSPA 5IG6A 4IR5A 4BW3A 4KCXA 4A9IA 5EWCA 5L96A 2DATA 4QR5A 4ALGA 4HXRA 4LC2A 5DX4A 5D3LA 3IU6A 4IORA 3SVGA 5EGUA 4O7BA 4J1PA 5E7DA 4O77A 5FFYA 5E3GA 5FFVA 5F61A 4C67A 3ZYUA 4NRAA 5EI4A 4C66A 4QR3A 5EV9A 5DW2A 5BT5A 5J0DA 5DLXA 4ZC9A 2E3KA 4UIWA 3HMHA 5I80A 3MULA 4CUQA 4YBTA 5ETBA 5E9VA 5HENA 5FE7A 5F1HA 5CQ8A 4PY6A 5HRXA 4CFKA 5A5OA 4YBSA 4QY4A 5CQ5A 4CUSA 4AI6A 5FE0A 4UIVA 4LZRA 4IR6A 4Z1SA 4Z1QA 3UV4A 4Q0NA 3JVMA 4J0RA 2R10A 4X2IA 5HCLA 2F6NA 5E9YA 4IR4A 4YYDA 3GG3A 5DKDA 3NXBA 4QYDA 5I83A 5KTUA 4UIYA 4YY6A 4PS5A 5DKHA 5E0RA 4RVRA 5DBMA 5C85A 5CY9A 5HELA 2YQDA 3U5JA 1JSPB 3DWYA 4A9EA 5A5PA 5KO4A 4IR3A 4DONA 5H1VA 4WHUA 4HBVA 4CL9A 4YH3A 3HMFA 4QEWA 5LVQA 5ENEA 4YH4A 5L97A 5LJ0A 4WHWA 4NS5A 3DAIA 4TZ2A 3O37A 2NXBA 4CURA 2YDWA 5LKZA 3SVHA 5A5QA 4CFLA 4BJXA 5FE6A 3UVWA 4YYIA 5C8GA 5CQ7A 2F6JA 4HXLA 4UIUA 3ERRA 2RO1A 5LKTA 4YYMA 4O7CA 5D3PA 5FH6A 4LDFA 5CTLA 5CRZA 3P1CA 3LQIA 4UIZA 4HXMA 5CRMA 5CQAA 2N9GA 2RNYA 4IOQA 5EWVA 4OGJA 5AD2A 4WIVA 5E73A 4LYWA 4A9KA 4TT6A 5A7CA 4TT4A 5HEMA 4NR8A 5DY7A 5DYUA 5FG4A 3QZVA 3AQAA 5F62A 4CUPA 4YYHA 4QR4A 4UYEA 1ZKRA 2OO1A 5FB1A 4LRGA 4PTBA 2WP2A 2D82A 5LJ2A 1X0JA 4BW2A 4YATA 4LZ2A 4NQNA 3ONIA 4HXKA 5CQ3A 5LUUA 5G4SA 4TU4A 3G0JA 5IGKA 3D7CA 3UW9A 2DVVA 4XUBA 5F63A 4QYLA 4Y03A 4QUUA 5HFRA 4QB3A 5AMEA 5I1QA 5E3DA 3P1EA 5D7XA 4NQMA 5ENFA 3U5MA 2R0VA 3RCWA 5HLSA 2I8NA 5DFCA 3S92A 5FBXA 2OUOA 5JWMA 5EICA 5ENJA 5FB0A 5CU8A 4TTEA 4NR4A 5DKCA 3QZTA 5H1UA 5F5ZA 4LZSA 5HRVA 4J3IA 5G4RA 4NUDA 5FG6A 3O33A 4QEVA 5A83A 2E7NA 5H85A 4IOOA 5IIDA 5L8UA 1N72A 3SVFA 5EK9A 2DVQA 5FH7A 1EQFA 5DFDA 5D26A 5DW1A 5CQ6A 5L99A 3VKGA 4QSUA 5I7XA 4OGIA 4QC3A 5LJ1A 3G0LA 2E7OA 4NXJA 5EU1A 4CUUA 5D25A 3JVKA 5E9LA 2YYNA 5HQ6A 4O76A 5CUAA 4QC1A 4QNSA 5KTWA 5EPSA 5C4QA 5HJCA 3IU5A 5FE4A 5CUGA 4BHWA 2H60A 5CUBA 4PKLA 4QSVA 5DFBA 4QZSA 5COIA 2RS9B 1ZS5A 4NRCA 4NUEA 4FLPA 4PCEA 5D3HA 4KV1A 3LQJA 5EWWA 4NYVA 3TLPA 4E96A 4NUCA 5EQ1A 4N4IA 3U5LA 2DVRA 5IBNA 5I88A 2KTBB 3U5KA 2R0SA 2RNWA 5EA1A 4NR5A 5KU3A 2DWWA 4UYGA 4UYDA 5FDZA 5A81A 5CQTA 4TQNA 4HXOA 5EPRA 4YYNA 4A9MA 4MENA 5D3JA 3UVDA 5LVRA 4HBYA 5I29A 5CQ4A 4AKNA 2YEKA 5CUCA 4O7FA 3K2JA 5HM0A
chains in the Genus database with same CATH topology
5ENCA 1E6IA 5EP7A 4Z6HA 4HXNA 4NYWA 4QBMA 5A5SA 5II1A 5D3NA 4TT2A 5FE5A 4O72A 3UVYA 5DYCA 3LQHA 5HFQA 4MEPA 5D0CA 5FH8A 4A9OA 3LXJA 4O7AA 4YABA 4YYGA 4UIXA 5E74A 5EM3A 5EPBA 5BT4A 4Z93A 2D9EA 4HBXA 4XUAA 5CPEA 4A9HA 3UVXA 3O34A 4N4HA 2L84A 5F25A 4ZW1A 5H1TA 3JVLA 4HXSA 4HBWA 4O74A 4NRBA 4F3IA 3FKMX 2R0YA 3LJWA 4PCIA 4YAXA 2OSSA 5L98A 3JVJA 5BT3A 5JI8A 4N4GA 4UYFA 3U5PA 5D3RA 5A5RA 3MB4A 5EWHA 4O70A 5CGPA 2RFJA 4QUTA 2DVSA 5D3SA 4XY9A 5AD3A 5HRWA 5ETDA 5LKUA 5A82A 4NR9A 4A9NA 4ZQLA 5DYXA 5F60A 4MEOA 4YYKA 5C87A 5IGLA 5C89A 5ENHA 3HMEA 5A5NA 3QZSA 5KHMA 4A9LA 5CS8A 4O7EA 4OUFA 3P1FA 5D3TA 5D24A 4J0SA 3AADA 4YBMA 4TYLA 4QSRA 4QSSA 4YADA 1WUGA 4YK0A 5ENIA 4KV4A 4UITA 1JM4B 4LYIA 3UV5A 4QSXA 5I40A 5FG5A 4XYAA 4UYHA 4ALHA 5IGNA 2GRCA 5II2A 4BW4A 3MB3A 5E9IA 4YC9A 4TS8A 5CFWA 5FFWA 4YYJA 5EISA 3MXFA 2WP1A 5TB6A 2RI7A 3O35A 4O71A 5HQ5A 4NR7A 4MR6A 3Q2EA 5EVAA 2RNXA 5KTXA 4N4FA 2FSAA 2YELA 5CZGA 4MR5A 5L8TA 5CUEA 1F68A 4O78A 4TZ8A 5CP5A 2MJVB 2YW5A 3UV2A 5E9MA 4QSTA 5FE8A 2YEMA 5F36A 4NYXA 5F3AA 4GPJA 1WUMA 4MR4A 2G4AA 5I89A 5K29A 5DLZA 4CUTA 4QEUA 4YY4A 4NR6A 5C7NA 3P1DA 5IGMA 4MEQA 3O36A 2L85A 2DKWA 4QSWA 4LR6A 5A85A 5I7YA 5ACYA 5DYAA 4A9FA 3Q2FA 3MUKA 4XY8A 4QSQA 4MR3A 5FE2A 2I7KA 5TCMA 4O75A 5FE3A 4N3WA 5F2PA 5I86A 5CUDA 5LKXA 5FE1A 2LSPB 4Z6IA 4TU6A 5AMFA 3U5NA 4HXPA 4BW1A 4Q0OA 4A9JA 3S91A 3U5OA 5F1LA 5HQ7A 3P5OA 5E9KA 4CLBA 2L5EA 4UYFB 3MQMA 5ENGA 5EWDA 4LYSA 3I3JA 5ENBA 5FE9A 4QSPA 5IG6A 4IR5A 4BW3A 4KCXA 4A9IA 5EWCA 5L96A 2DATA 4QR5A 4ALGA 4HXRA 4LC2A 5DX4A 5D3LA 3IU6A 4IORA 3SVGA 5EGUA 4O7BA 4J1PA 5E7DA 4O77A 5FFYA 5E3GA 5FFVA 5F61A 4C67A 3ZYUA 4NRAA 5EI4A 4C66A 4QR3A 5EV9A 5DW2A 5BT5A 5J0DA 5DLXA 4ZC9A 2E3KA 4UIWA 3HMHA 5I80A 3MULA 4CUQA 4YBTA 5ETBA 5E9VA 5HENA 5FE7A 5F1HA 5CQ8A 4PY6A 5HRXA 4CFKA 5A5OA 4YBSA 4QY4A 5CQ5A 4CUSA 5FE0A 4UIVA 4LZRA 4IR6A 4Z1SA 4Z1QA 3UV4A 4Q0NA 3JVMA 4J0RA 2R10A 4X2IA 5HCLA 2F6NA 5E9YA 4IR4A 4YYDA 3GG3A 5DKDA 3NXBA 4QYDA 5I83A 5KTUA 4UIYA 4YY6A 4PS5A 5DKHA 5E0RA 4RVRA 5DBMA 5C85A 5CY9A 5HELA 2YQDA 3U5JA 1JSPB 3DWYA 4A9EA 5A5PA 5KO4A 4IR3A 4DONA 5H1VA 4WHUA 4HBVA 4CL9A 4YH3A 3HMFA 4QEWA 5LVQA 5ENEA 4YH4A 5L97A 5LJ0A 4WHWA 4NS5A 3DAIA 4TZ2A 3O37A 2NXBA 4CURA 2YDWA 5LKZA 3SVHA 5A5QA 4CFLA 4BJXA 5FE6A 3UVWA 4YYIA 5C8GA 5CQ7A 2F6JA 4HXLA 4UIUA 2RO1A 5LKTA 4YYMA 4O7CA 5D3PA 5FH6A 4LDFA 5CTLA 5CRZA 3P1CA 3LQIA 4UIZA 4HXMA 5CRMA 5CQAA 2N9GA 2RNYA 4IOQA 5EWVA 4OGJA 5AD2A 4WIVA 5E73A 4LYWA 4A9KA 4TT6A 5A7CA 4TT4A 5HEMA 4NR8A 5DY7A 5DYUA 5FG4A 3QZVA 3AQAA 5F62A 4CUPA 4YYHA 4QR4A 4UYEA 2OO1A 5FB1A 4LRGA 4PTBA 2WP2A 2D82A 5LJ2A 1X0JA 4BW2A 4YATA 4LZ2A 4NQNA 3ONIA 4HXKA 5CQ3A 5LUUA 5G4SA 4TU4A 3G0JA 5IGKA 3D7CA 3UW9A 2DVVA 4XUBA 5F63A 4QYLA 4Y03A 4QUUA 5HFRA 4QB3A 5AMEA 5I1QA 5E3DA 3P1EA 5D7XA 4NQMA 5ENFA 3U5MA 2R0VA 3RCWA 5HLSA 2I8NA 5DFCA 3S92A 5FBXA 2OUOA 5JWMA 5EICA 5ENJA 5FB0A 5CU8A 4TTEA 4NR4A 5DKCA 3QZTA 5H1UA 5F5ZA 4LZSA 5HRVA 4J3IA 5G4RA 4NUDA 5FG6A 3O33A 4QEVA 5A83A 2E7NA 5H85A 4IOOA 5IIDA 5L8UA 1N72A 3SVFA 5EK9A 2DVQA 5FH7A 1EQFA 5DFDA 5D26A 5DW1A 5CQ6A 5L99A 4QSUA 5I7XA 4OGIA 4QC3A 5LJ1A 3G0LA 2E7OA 4NXJA 5EU1A 4CUUA 5D25A 3JVKA 5E9LA 2YYNA 5HQ6A 4O76A 5CUAA 4QC1A 4QNSA 5KTWA 5EPSA 5C4QA 5HJCA 3IU5A 5FE4A 5CUGA 4BHWA 2H60A 5CUBA 4PKLA 4QSVA 5DFBA 4QZSA 5COIA 2RS9B 1ZS5A 4NRCA 4NUEA 4FLPA 4PCEA 5D3HA 4KV1A 3LQJA 5EWWA 4NYVA 3TLPA 4E96A 4NUCA 5EQ1A 4N4IA 3U5LA 2DVRA 5IBNA 5I88A 2KTBB 3U5KA 2R0SA 2RNWA 5EA1A 4NR5A 5KU3A 2DWWA 4UYGA 4UYDA 5FDZA 5A81A 5CQTA 4TQNA 4HXOA 5EPRA 4YYNA 4A9MA 4MENA 5D3JA 3UVDA 5LVRA 4HBYA 5I29A 5CQ4A 4AKNA 2YEKA 5CUCA 4O7FA 3K2JA 5HM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENC A;  1E6I A;  5EP7 A;  4Z6H A;  4HXN A;  4NYW A;  4QBM A;  5A5S A;  5II1 A;  5D3N A;  4TT2 A;  5FE5 A;  4O72 A;  3UVY A;  5DYC A;  3LQH A;  5HFQ A;  4MEP A;  5D0C A;  5FH8 A;  4A9O A;  3LXJ A;  4O7A A;  4YAB A;  4YYG A;  4UIX A;  5E74 A;  5EM3 A;  5EPB A;  5BT4 A;  4Z93 A;  2D9E A;  4HBX A;  4XUA A;  5CPE A;  4A9H A;  3UVX A;  3O34 A;  4N4H A;  2L84 A;  5F25 A;  4ZW1 A;  5H1T A;  3JVL A;  4HXS A;  4HBW A;  4O74 A;  4NRB A;  4F3I A;  3FKM X;  2R0Y A;  3LJW A;  4PCI A;  4YAX A;  2OSS A;  5L98 A;  3JVJ A;  5BT3 A;  5JI8 A;  4N4G A;  4UYF A;  3U5P A;  5D3R A;  5A5R A;  3MB4 A;  5EWH A;  4O70 A;  5CGP A;  2RFJ A;  4QUT A;  2DVS A;  5D3S A;  4XY9 A;  5AD3 A;  5HRW A;  5ETD A;  5LKU A;  5A82 A;  4NR9 A;  4A9N A;  4ZQL A;  5DYX A;  5F60 A;  4MEO A;  4YYK A;  5C87 A;  5IGL A;  5C89 A;  5ENH A;  3HME A;  5A5N A;  3QZS A;  5KHM A;  4A9L A;  5CS8 A;  4O7E A;  4OUF A;  3P1F A;  5D3T A;  5D24 A;  4J0S A;  3AAD A;  4YBM A;  4TYL A;  4QSR A;  4QSS A;  4YAD A;  1WUG A;  4YK0 A;  5ENI A;  4KV4 A;  4UIT A;  1JM4 B;  4LYI A;  3UV5 A;  4QSX A;  5I40 A;  5FG5 A;  4XYA A;  4UYH A;  4ALH A;  5IGN A;  2GRC A;  5II2 A;  4BW4 A;  3MB3 A;  5E9I A;  4YC9 A;  4TS8 A;  5CFW A;  5FFW A;  4YYJ A;  5EIS A;  3MXF A;  2WP1 A;  5TB6 A;  2RI7 A;  3O35 A;  4O71 A;  5HQ5 A;  4NR7 A;  4MR6 A;  3Q2E A;  5EVA A;  2RNX A;  5KTX A;  4N4F A;  2FSA A;  2YEL A;  5CZG A;  4MR5 A;  5L8T A;  5CUE A;  1F68 A;  4O78 A;  4TZ8 A;  5CP5 A;  2MJV B;  2YW5 A;  3UV2 A;  5E9M A;  4QST A;  5FE8 A;  2YEM A;  5F36 A;  4NYX A;  5F3A A;  4GPJ A;  1WUM A;  4MR4 A;  2G4A A;  5I89 A;  5K29 A;  5DLZ A;  4CUT A;  4QEU A;  4YY4 A;  4NR6 A;  5C7N A;  3P1D A;  5IGM A;  4MEQ A;  3O36 A;  2L85 A;  2DKW A;  4QSW A;  4LR6 A;  5A85 A;  5I7Y A;  5ACY A;  5DYA A;  4A9F A;  3Q2F A;  3MUK A;  4XY8 A;  4QSQ A;  4MR3 A;  5FE2 A;  2I7K A;  5TCM A;  4O75 A;  5FE3 A;  4N3W A;  5F2P A;  5I86 A;  5CUD A;  5LKX A;  5FE1 A;  2LSP B;  4Z6I A;  4TU6 A;  5AMF A;  3U5N A;  4HXP A;  4BW1 A;  4Q0O A;  4A9J A;  3S91 A;  3U5O A;  5F1L A;  5HQ7 A;  3P5O A;  5E9K A;  4CLB A;  2L5E A;  4UYF B;  3MQM A;  5ENG A;  5EWD A;  4LYS A;  3I3J A;  5ENB A;  5FE9 A;  4QSP A;  5IG6 A;  4IR5 A;  4BW3 A;  4KCX A;  4A9I A;  5EWC A;  5L96 A;  2DAT A;  4QR5 A;  4ALG A;  4HXR A;  4LC2 A;  5DX4 A;  5D3L A;  3IU6 A;  4IOR A;  3SVG A;  5EGU A;  4O7B A;  4J1P A;  5E7D A;  4O77 A;  5FFY A;  5E3G A;  5FFV A;  5F61 A;  4C67 A;  3ZYU A;  4NRA A;  5EI4 A;  4C66 A;  4QR3 A;  5EV9 A;  5DW2 A;  5BT5 A;  5J0D A;  5DLX A;  4ZC9 A;  2E3K A;  4UIW A;  3HMH A;  5I80 A;  3MUL A;  4CUQ A;  4YBT A;  5ETB A;  5E9V A;  5HEN A;  5FE7 A;  5F1H A;  5CQ8 A;  4PY6 A;  5HRX A;  4CFK A;  5A5O A;  4YBS A;  4QY4 A;  5CQ5 A;  4CUS A;  5FE0 A;  4UIV A;  4LZR A;  4IR6 A;  4Z1S A;  4Z1Q A;  3UV4 A;  4Q0N A;  3JVM A;  4J0R A;  2R10 A;  4X2I A;  5HCL A;  2F6N A;  5E9Y A;  4IR4 A;  4YYD A;  3GG3 A;  5DKD A;  3NXB A;  4QYD A;  5I83 A;  5KTU A;  4UIY A;  4YY6 A;  4PS5 A;  5DKH A;  5E0R A;  4RVR A;  5DBM A;  5C85 A;  5CY9 A;  5HEL A;  2YQD A;  3U5J A;  1JSP B;  3DWY A;  4A9E A;  5A5P A;  5KO4 A;  4IR3 A;  4DON A;  5H1V A;  4WHU A;  4HBV A;  4CL9 A;  4YH3 A;  3HMF A;  4QEW A;  5LVQ A;  5ENE A;  4YH4 A;  5L97 A;  5LJ0 A;  4WHW A;  4NS5 A;  3DAI A;  4TZ2 A;  3O37 A;  2NXB A;  4CUR A;  2YDW A;  5LKZ A;  3SVH A;  5A5Q A;  4CFL A;  4BJX A;  5FE6 A;  3UVW A;  4YYI A;  5C8G A;  5CQ7 A;  2F6J A;  4HXL A;  4UIU A;  2RO1 A;  5LKT A;  4YYM A;  4O7C A;  5D3P A;  5FH6 A;  4LDF A;  5CTL A;  5CRZ A;  3P1C A;  3LQI A;  4UIZ A;  4HXM A;  5CRM A;  5CQA A;  2N9G A;  2RNY A;  4IOQ A;  5EWV A;  4OGJ A;  5AD2 A;  4WIV A;  5E73 A;  4LYW A;  4A9K A;  4TT6 A;  5A7C A;  4TT4 A;  5HEM A;  4NR8 A;  5DY7 A;  5DYU A;  5FG4 A;  3QZV A;  3AQA A;  5F62 A;  4CUP A;  4YYH A;  4QR4 A;  4UYE A;  2OO1 A;  5FB1 A;  4LRG A;  4PTB A;  2WP2 A;  2D82 A;  5LJ2 A;  1X0J A;  4BW2 A;  4YAT A;  4LZ2 A;  4NQN A;  3ONI A;  4HXK A;  5CQ3 A;  5LUU A;  5G4S A;  4TU4 A;  3G0J A;  5IGK A;  3D7C A;  3UW9 A;  2DVV A;  4XUB A;  5F63 A;  4QYL A;  4Y03 A;  4QUU A;  5HFR A;  4QB3 A;  5AME A;  5I1Q A;  5E3D A;  3P1E A;  5D7X A;  4NQM A;  5ENF A;  3U5M A;  2R0V A;  3RCW A;  5HLS A;  2I8N A;  5DFC A;  3S92 A;  5FBX A;  2OUO A;  5JWM A;  5EIC A;  5ENJ A;  5FB0 A;  5CU8 A;  4TTE A;  4NR4 A;  5DKC A;  3QZT A;  5H1U A;  5F5Z A;  4LZS A;  5HRV A;  4J3I A;  5G4R A;  4NUD A;  5FG6 A;  3O33 A;  4QEV A;  5A83 A;  2E7N A;  5H85 A;  4IOO A;  5IID A;  5L8U A;  1N72 A;  3SVF A;  5EK9 A;  2DVQ A;  5FH7 A;  1EQF A;  5DFD A;  5D26 A;  5DW1 A;  5CQ6 A;  5L99 A;  4QSU A;  5I7X A;  4OGI A;  4QC3 A;  5LJ1 A;  3G0L A;  2E7O A;  4NXJ A;  5EU1 A;  4CUU A;  5D25 A;  3JVK A;  5E9L A;  2YYN A;  5HQ6 A;  4O76 A;  5CUA A;  4QC1 A;  4QNS A;  5KTW A;  5EPS A;  5C4Q A;  5HJC A;  3IU5 A;  5FE4 A;  5CUG A;  4BHW A;  2H60 A;  5CUB A;  4PKL A;  4QSV A;  5DFB A;  4QZS A;  5COI A;  2RS9 B;  1ZS5 A;  4NRC A;  4NUE A;  4FLP A;  4PCE A;  5D3H A;  4KV1 A;  3LQJ A;  5EWW A;  4NYV A;  3TLP A;  4E96 A;  4NUC A;  5EQ1 A;  4N4I A;  3U5L A;  2DVR A;  5IBN A;  5I88 A;  2KTB B;  3U5K A;  2R0S A;  2RNW A;  5EA1 A;  4NR5 A;  5KU3 A;  2DWW A;  4UYG A;  4UYD A;  5FDZ A;  5A81 A;  5CQT A;  4TQN A;  4HXO A;  5EPR A;  4YYN A;  4A9M A;  4MEN A;  5D3J A;  3UVD A;  5LVR A;  4HBY A;  5I29 A;  5CQ4 A;  4AKN A;  2YEK A;  5CUC A;  4O7F A;  3K2J A;  5HM0 A; 
#chains in the Genus database with same CATH topology
 5ENC A;  1E6I A;  5EP7 A;  4Z6H A;  4HXN A;  4NYW A;  4QBM A;  5A5S A;  5II1 A;  5D3N A;  4TT2 A;  5FE5 A;  4O72 A;  3UVY A;  5DYC A;  3LQH A;  5HFQ A;  4MEP A;  5D0C A;  5FH8 A;  4A9O A;  3LXJ A;  4O7A A;  4YAB A;  4YYG A;  4UIX A;  5E74 A;  5EM3 A;  5EPB A;  5BT4 A;  4Z93 A;  2D9E A;  4HBX A;  4XUA A;  5CPE A;  4A9H A;  3UVX A;  3O34 A;  4N4H A;  2L84 A;  5F25 A;  4ZW1 A;  5H1T A;  3JVL A;  4HXS A;  4HBW A;  4O74 A;  4NRB A;  4F3I A;  3FKM X;  2R0Y A;  3LJW A;  4PCI A;  4YAX A;  2OSS A;  5L98 A;  3JVJ A;  5BT3 A;  5JI8 A;  4N4G A;  4UYF A;  3U5P A;  5D3R A;  5A5R A;  3MB4 A;  5EWH A;  4O70 A;  5CGP A;  2RFJ A;  4QUT A;  2DVS A;  5D3S A;  4XY9 A;  5AD3 A;  5HRW A;  5ETD A;  5LKU A;  5A82 A;  4NR9 A;  4A9N A;  4ZQL A;  5DYX A;  5F60 A;  4MEO A;  4YYK A;  5C87 A;  5IGL A;  5C89 A;  5ENH A;  3HME A;  2EJN A;  5A5N A;  3QZS A;  5KHM A;  4A9L A;  5CS8 A;  4O7E A;  4OUF A;  3P1F A;  5D3T A;  4AKH A;  5D24 A;  4J0S A;  3AAD A;  4YBM A;  4TYL A;  4QSR A;  4QSS A;  4YAD A;  1WUG A;  4YK0 A;  5ENI A;  4KV4 A;  4UIT A;  1JM4 B;  4LYI A;  3UV5 A;  4QSX A;  5I40 A;  5FG5 A;  4XYA A;  4UYH A;  4ALH A;  5IGN A;  2GRC A;  5II2 A;  4BW4 A;  3MB3 A;  5E9I A;  4YC9 A;  4TS8 A;  5CFW A;  5FFW A;  4YYJ A;  5EIS A;  3MXF A;  2WP1 A;  5TB6 A;  2RI7 A;  3O35 A;  4O71 A;  5HQ5 A;  4NR7 A;  4MR6 A;  3Q2E A;  5EVA A;  2RNX A;  5KTX A;  4N4F A;  2FSA A;  2YEL A;  5CZG A;  4MR5 A;  5L8T A;  5CUE A;  1F68 A;  4O78 A;  4TZ8 A;  5CP5 A;  2MJV B;  2YW5 A;  3UV2 A;  5E9M A;  4QST A;  5FE8 A;  2YEM A;  3D1D A;  5F36 A;  4NYX A;  3D1B A;  5F3A A;  4GPJ A;  1WUM A;  4MR4 A;  2G4A A;  5I89 A;  5K29 A;  4AKG A;  5DLZ A;  4CUT A;  4QEU A;  4YY4 A;  4NR6 A;  5C7N A;  3P1D A;  5IGM A;  4MEQ A;  3O36 A;  4AKI A;  2L85 A;  2DKW A;  4QSW A;  4LR6 A;  5A85 A;  5I7Y A;  5ACY A;  5DYA A;  4A9F A;  3Q2F A;  3MUK A;  4XY8 A;  4QSQ A;  4MR3 A;  5FE2 A;  2I7K A;  5TCM A;  4O75 A;  5FE3 A;  4N3W A;  5F2P A;  5I86 A;  5CUD A;  5LKX A;  5FE1 A;  2LSP B;  4Z6I A;  4TU6 A;  5AMF A;  3U5N A;  4HXP A;  4BW1 A;  4Q0O A;  4A9J A;  3S91 A;  3U5O A;  5F1L A;  5HQ7 A;  3P5O A;  5E9K A;  4CLB A;  2L5E A;  4UYF B;  3VKH A;  3MQM A;  5ENG A;  5EWD A;  4LYS A;  1PUO A;  3I3J A;  5ENB A;  5FE9 A;  4QSP A;  5IG6 A;  4IR5 A;  4BW3 A;  4KCX A;  4A9I A;  5EWC A;  5L96 A;  2DAT A;  4QR5 A;  4ALG A;  4HXR A;  4LC2 A;  5DX4 A;  5D3L A;  3IU6 A;  4IOR A;  3SVG A;  5EGU A;  4O7B A;  4J1P A;  5E7D A;  4O77 A;  5FFY A;  5E3G A;  5FFV A;  5F61 A;  4C67 A;  3ZYU A;  4NRA A;  5EI4 A;  4C66 A;  4QR3 A;  5EV9 A;  5DW2 A;  5BT5 A;  5J0D A;  5DLX A;  4ZC9 A;  2E3K A;  4UIW A;  3HMH A;  5I80 A;  3MUL A;  4CUQ A;  4YBT A;  5ETB A;  5E9V A;  5HEN A;  5FE7 A;  5F1H A;  5CQ8 A;  4PY6 A;  5HRX A;  4CFK A;  5A5O A;  4YBS A;  4QY4 A;  5CQ5 A;  4CUS A;  4AI6 A;  5FE0 A;  4UIV A;  4LZR A;  4IR6 A;  4Z1S A;  4Z1Q A;  3UV4 A;  4Q0N A;  3JVM A;  4J0R A;  2R10 A;  4X2I A;  5HCL A;  2F6N A;  5E9Y A;  4IR4 A;  4YYD A;  3GG3 A;  5DKD A;  3NXB A;  4QYD A;  5I83 A;  5KTU A;  4UIY A;  4YY6 A;  4PS5 A;  5DKH A;  5E0R A;  4RVR A;  5DBM A;  5C85 A;  5CY9 A;  5HEL A;  2YQD A;  3U5J A;  1JSP B;  3DWY A;  4A9E A;  5A5P A;  5KO4 A;  4IR3 A;  4DON A;  5H1V A;  4WHU A;  4HBV A;  4CL9 A;  4YH3 A;  3HMF A;  4QEW A;  5LVQ A;  5ENE A;  4YH4 A;  5L97 A;  5LJ0 A;  4WHW A;  4NS5 A;  3DAI A;  4TZ2 A;  3O37 A;  2NXB A;  4CUR A;  2YDW A;  5LKZ A;  3SVH A;  5A5Q A;  4CFL A;  4BJX A;  5FE6 A;  3UVW A;  4YYI A;  5C8G A;  5CQ7 A;  2F6J A;  4HXL A;  4UIU A;  3ERR A;  2RO1 A;  5LKT A;  4YYM A;  4O7C A;  5D3P A;  5FH6 A;  4LDF A;  5CTL A;  5CRZ A;  3P1C A;  3LQI A;  4UIZ A;  4HXM A;  5CRM A;  5CQA A;  2N9G A;  2RNY A;  4IOQ A;  5EWV A;  4OGJ A;  5AD2 A;  4WIV A;  5E73 A;  4LYW A;  4A9K A;  4TT6 A;  5A7C A;  4TT4 A;  5HEM A;  4NR8 A;  5DY7 A;  5DYU A;  5FG4 A;  3QZV A;  3AQA A;  5F62 A;  4CUP A;  4YYH A;  4QR4 A;  4UYE A;  1ZKR A;  2OO1 A;  5FB1 A;  4LRG A;  4PTB A;  2WP2 A;  2D82 A;  5LJ2 A;  1X0J A;  4BW2 A;  4YAT A;  4LZ2 A;  4NQN A;  3ONI A;  4HXK A;  5CQ3 A;  5LUU A;  5G4S A;  4TU4 A;  3G0J A;  5IGK A;  3D7C A;  3UW9 A;  2DVV A;  4XUB A;  5F63 A;  4QYL A;  4Y03 A;  4QUU A;  5HFR A;  4QB3 A;  5AME A;  5I1Q A;  5E3D A;  3P1E A;  5D7X A;  4NQM A;  5ENF A;  3U5M A;  2R0V A;  3RCW A;  5HLS A;  2I8N A;  5DFC A;  3S92 A;  5FBX A;  2OUO A;  5JWM A;  5EIC A;  5ENJ A;  5FB0 A;  5CU8 A;  4TTE A;  4NR4 A;  5DKC A;  3QZT A;  5H1U A;  5F5Z A;  4LZS A;  5HRV A;  4J3I A;  5G4R A;  4NUD A;  5FG6 A;  3O33 A;  4QEV A;  5A83 A;  2E7N A;  5H85 A;  4IOO A;  5IID A;  5L8U A;  1N72 A;  3SVF A;  5EK9 A;  2DVQ A;  5FH7 A;  1EQF A;  5DFD A;  5D26 A;  5DW1 A;  5CQ6 A;  5L99 A;  3VKG A;  4QSU A;  5I7X A;  4OGI A;  4QC3 A;  5LJ1 A;  3G0L A;  2E7O A;  4NXJ A;  5EU1 A;  4CUU A;  5D25 A;  3JVK A;  5E9L A;  2YYN A;  5HQ6 A;  4O76 A;  5CUA A;  4QC1 A;  4QNS A;  5KTW A;  5EPS A;  5C4Q A;  5HJC A;  3IU5 A;  5FE4 A;  5CUG A;  4BHW A;  2H60 A;  5CUB A;  4PKL A;  4QSV A;  5DFB A;  4QZS A;  5COI A;  2RS9 B;  1ZS5 A;  4NRC A;  4NUE A;  4FLP A;  4PCE A;  5D3H A;  4KV1 A;  3LQJ A;  5EWW A;  4NYV A;  3TLP A;  4E96 A;  4NUC A;  5EQ1 A;  4N4I A;  3U5L A;  2DVR A;  5IBN A;  5I88 A;  2KTB B;  3U5K A;  2R0S A;  2RNW A;  5EA1 A;  4NR5 A;  5KU3 A;  2DWW A;  4UYG A;  4UYD A;  5FDZ A;  5A81 A;  5CQT A;  4TQN A;  4HXO A;  5EPR A;  4YYN A;  4A9M A;  4MEN A;  5D3J A;  3UVD A;  5LVR A;  4HBY A;  5I29 A;  5CQ4 A;  4AKN A;  2YEK A;  5CUC A;  4O7F A;  3K2J A;  5HM0 A; 
#chains in the Genus database with same CATH homology
 5ENC A;  1E6I A;  5EP7 A;  4Z6H A;  4HXN A;  4NYW A;  4QBM A;  5A5S A;  5II1 A;  5D3N A;  4TT2 A;  5FE5 A;  4O72 A;  3UVY A;  5DYC A;  3LQH A;  5HFQ A;  4MEP A;  5D0C A;  5FH8 A;  4A9O A;  3LXJ A;  4O7A A;  4YAB A;  4YYG A;  4UIX A;  5E74 A;  5EM3 A;  5EPB A;  5BT4 A;  4Z93 A;  2D9E A;  4HBX A;  4XUA A;  5CPE A;  4A9H A;  3UVX A;  3O34 A;  4N4H A;  2L84 A;  5F25 A;  4ZW1 A;  5H1T A;  3JVL A;  4HXS A;  4HBW A;  4O74 A;  4NRB A;  4F3I A;  3FKM X;  2R0Y A;  3LJW A;  4PCI A;  4YAX A;  2OSS A;  5L98 A;  3JVJ A;  5BT3 A;  5JI8 A;  4N4G A;  4UYF A;  3U5P A;  5D3R A;  5A5R A;  3MB4 A;  5EWH A;  4O70 A;  5CGP A;  2RFJ A;  4QUT A;  2DVS A;  5D3S A;  4XY9 A;  5AD3 A;  5HRW A;  5ETD A;  5LKU A;  5A82 A;  4NR9 A;  4A9N A;  4ZQL A;  5DYX A;  5F60 A;  4MEO A;  4YYK A;  5C87 A;  5IGL A;  5C89 A;  5ENH A;  3HME A;  5A5N A;  3QZS A;  5KHM A;  4A9L A;  5CS8 A;  4O7E A;  4OUF A;  3P1F A;  5D3T A;  5D24 A;  4J0S A;  3AAD A;  4YBM A;  4TYL A;  4QSR A;  4QSS A;  4YAD A;  1WUG A;  4YK0 A;  5ENI A;  4KV4 A;  4UIT A;  1JM4 B;  4LYI A;  3UV5 A;  4QSX A;  5I40 A;  5FG5 A;  4XYA A;  4UYH A;  4ALH A;  5IGN A;  2GRC A;  5II2 A;  4BW4 A;  3MB3 A;  5E9I A;  4YC9 A;  4TS8 A;  5CFW A;  5FFW A;  4YYJ A;  5EIS A;  3MXF A;  2WP1 A;  5TB6 A;  2RI7 A;  3O35 A;  4O71 A;  5HQ5 A;  4NR7 A;  4MR6 A;  3Q2E A;  5EVA A;  2RNX A;  5KTX A;  4N4F A;  2FSA A;  2YEL A;  5CZG A;  4MR5 A;  5L8T A;  5CUE A;  1F68 A;  4O78 A;  4TZ8 A;  5CP5 A;  2MJV B;  2YW5 A;  3UV2 A;  5E9M A;  4QST A;  5FE8 A;  2YEM A;  5F36 A;  4NYX A;  5F3A A;  4GPJ A;  1WUM A;  4MR4 A;  2G4A A;  5I89 A;  5K29 A;  5DLZ A;  4CUT A;  4QEU A;  4YY4 A;  4NR6 A;  5C7N A;  3P1D A;  5IGM A;  4MEQ A;  3O36 A;  2L85 A;  2DKW A;  4QSW A;  4LR6 A;  5A85 A;  5I7Y A;  5ACY A;  5DYA A;  4A9F A;  3Q2F A;  3MUK A;  4XY8 A;  4QSQ A;  4MR3 A;  5FE2 A;  2I7K A;  5TCM A;  4O75 A;  5FE3 A;  4N3W A;  5F2P A;  5I86 A;  5CUD A;  5LKX A;  5FE1 A;  2LSP B;  4Z6I A;  4TU6 A;  5AMF A;  3U5N A;  4HXP A;  4BW1 A;  4Q0O A;  4A9J A;  3S91 A;  3U5O A;  5F1L A;  5HQ7 A;  3P5O A;  5E9K A;  4CLB A;  2L5E A;  4UYF B;  3MQM A;  5ENG A;  5EWD A;  4LYS A;  3I3J A;  5ENB A;  5FE9 A;  4QSP A;  5IG6 A;  4IR5 A;  4BW3 A;  4KCX A;  4A9I A;  5EWC A;  5L96 A;  2DAT A;  4QR5 A;  4ALG A;  4HXR A;  4LC2 A;  5DX4 A;  5D3L A;  3IU6 A;  4IOR A;  3SVG A;  5EGU A;  4O7B A;  4J1P A;  5E7D A;  4O77 A;  5FFY A;  5E3G A;  5FFV A;  5F61 A;  4C67 A;  3ZYU A;  4NRA A;  5EI4 A;  4C66 A;  4QR3 A;  5EV9 A;  5DW2 A;  5BT5 A;  5J0D A;  5DLX A;  4ZC9 A;  2E3K A;  4UIW A;  3HMH A;  5I80 A;  3MUL A;  4CUQ A;  4YBT A;  5ETB A;  5E9V A;  5HEN A;  5FE7 A;  5F1H A;  5CQ8 A;  4PY6 A;  5HRX A;  4CFK A;  5A5O A;  4YBS A;  4QY4 A;  5CQ5 A;  4CUS A;  5FE0 A;  4UIV A;  4LZR A;  4IR6 A;  4Z1S A;  4Z1Q A;  3UV4 A;  4Q0N A;  3JVM A;  4J0R A;  2R10 A;  4X2I A;  5HCL A;  2F6N A;  5E9Y A;  4IR4 A;  4YYD A;  3GG3 A;  5DKD A;  3NXB A;  4QYD A;  5I83 A;  5KTU A;  4UIY A;  4YY6 A;  4PS5 A;  5DKH A;  5E0R A;  4RVR A;  5DBM A;  5C85 A;  5CY9 A;  5HEL A;  2YQD A;  3U5J A;  1JSP B;  3DWY A;  4A9E A;  5A5P A;  5KO4 A;  4IR3 A;  4DON A;  5H1V A;  4WHU A;  4HBV A;  4CL9 A;  4YH3 A;  3HMF A;  4QEW A;  5LVQ A;  5ENE A;  4YH4 A;  5L97 A;  5LJ0 A;  4WHW A;  4NS5 A;  3DAI A;  4TZ2 A;  3O37 A;  2NXB A;  4CUR A;  2YDW A;  5LKZ A;  3SVH A;  5A5Q A;  4CFL A;  4BJX A;  5FE6 A;  3UVW A;  4YYI A;  5C8G A;  5CQ7 A;  2F6J A;  4HXL A;  4UIU A;  2RO1 A;  5LKT A;  4YYM A;  4O7C A;  5D3P A;  5FH6 A;  4LDF A;  5CTL A;  5CRZ A;  3P1C A;  3LQI A;  4UIZ A;  4HXM A;  5CRM A;  5CQA A;  2N9G A;  2RNY A;  4IOQ A;  5EWV A;  4OGJ A;  5AD2 A;  4WIV A;  5E73 A;  4LYW A;  4A9K A;  4TT6 A;  5A7C A;  4TT4 A;  5HEM A;  4NR8 A;  5DY7 A;  5DYU A;  5FG4 A;  3QZV A;  3AQA A;  5F62 A;  4CUP A;  4YYH A;  4QR4 A;  4UYE A;  2OO1 A;  5FB1 A;  4LRG A;  4PTB A;  2WP2 A;  2D82 A;  5LJ2 A;  1X0J A;  4BW2 A;  4YAT A;  4LZ2 A;  4NQN A;  3ONI A;  4HXK A;  5CQ3 A;  5LUU A;  5G4S A;  4TU4 A;  3G0J A;  5IGK A;  3D7C A;  3UW9 A;  2DVV A;  4XUB A;  5F63 A;  4QYL A;  4Y03 A;  4QUU A;  5HFR A;  4QB3 A;  5AME A;  5I1Q A;  5E3D A;  3P1E A;  5D7X A;  4NQM A;  5ENF A;  3U5M A;  2R0V A;  3RCW A;  5HLS A;  2I8N A;  5DFC A;  3S92 A;  5FBX A;  2OUO A;  5JWM A;  5EIC A;  5ENJ A;  5FB0 A;  5CU8 A;  4TTE A;  4NR4 A;  5DKC A;  3QZT A;  5H1U A;  5F5Z A;  4LZS A;  5HRV A;  4J3I A;  5G4R A;  4NUD A;  5FG6 A;  3O33 A;  4QEV A;  5A83 A;  2E7N A;  5H85 A;  4IOO A;  5IID A;  5L8U A;  1N72 A;  3SVF A;  5EK9 A;  2DVQ A;  5FH7 A;  1EQF A;  5DFD A;  5D26 A;  5DW1 A;  5CQ6 A;  5L99 A;  4QSU A;  5I7X A;  4OGI A;  4QC3 A;  5LJ1 A;  3G0L A;  2E7O A;  4NXJ A;  5EU1 A;  4CUU A;  5D25 A;  3JVK A;  5E9L A;  2YYN A;  5HQ6 A;  4O76 A;  5CUA A;  4QC1 A;  4QNS A;  5KTW A;  5EPS A;  5C4Q A;  5HJC A;  3IU5 A;  5FE4 A;  5CUG A;  4BHW A;  2H60 A;  5CUB A;  4PKL A;  4QSV A;  5DFB A;  4QZS A;  5COI A;  2RS9 B;  1ZS5 A;  4NRC A;  4NUE A;  4FLP A;  4PCE A;  5D3H A;  4KV1 A;  3LQJ A;  5EWW A;  4NYV A;  3TLP A;  4E96 A;  4NUC A;  5EQ1 A;  4N4I A;  3U5L A;  2DVR A;  5IBN A;  5I88 A;  2KTB B;  3U5K A;  2R0S A;  2RNW A;  5EA1 A;  4NR5 A;  5KU3 A;  2DWW A;  4UYG A;  4UYD A;  5FDZ A;  5A81 A;  5CQT A;  4TQN A;  4HXO A;  5EPR A;  4YYN A;  4A9M A;  4MEN A;  5D3J A;  3UVD A;  5LVR A;  4HBY A;  5I29 A;  5CQ4 A;  4AKN A;  2YEK A;  5CUC A;  4O7F A;  3K2J A;  5HM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...