4YYNA

Crystal structure of taf1 bd2 bromodomain bound to a crotonyllysine peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
DDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Transcription initiation factor TFIID subunit 1
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yynA00
2D9EA 2OUOA 4LDFA 4O78A 3UV5A 4WHWA 3ZYUA 4QSWA 5KTUA 4A9IA 5FFVA 4UIXA 5E7DA 5F62A 2RI7A 4MEOA 5HRXA 4YY6A 4NYWA 5FE6A 5LKUA 3UVXA 2F6JA 3MB4A 4NRBA 4O7CA 5II1A 5HQ6A 5A5QA 4O7EA 3UVYA 2YDWA 4TTEA 3S91A 5HQ7A 5DKHA 4BW2A 5C7NA 5FH8A 5A7CA 5F25A 2LSPB 2RO1A 2NXBA 5FE8A 4QSSA 4YADA 4ZC9A 2DVSA 4QB3A 5CGPA 4LYIA 5F2PA 5ENBA 2OO1A 3U5JA 5A85A 5IIDA 5IGMA 4NR5A 3JVKA 5AD2A 4PS5A 4QSPA 5H1TA 3SVGA 2YYNA 2YEKA 5I80A 3Q2EA 1JM4B 5JI8A 4LYWA 5A5OA 5HFRA 3D7CA 4HBXA 4N4FA 4UIUA 5ETDA 4PY6A 3IU5A 4TYLA 5D3TA 5I29A 5FFWA 3G0JA 2G4AA 5L98A 4NS5A 5EWWA 4N3WA 2D82A 5F5ZA 5E9IA 4WHUA 4QSRA 5AMFA 5H1UA 5IGNA 5DYAA 4CFLA 4TU4A 1WUMA 5LKTA 3JVMA 2F6NA 5CS8A 3JVLA 4IOQA 5CUEA 5FG5A 5LVRA 4HBVA 5FB1A 3O35A 4YYKA 3Q2FA 5LJ1A 1X0JA 3O36A 5I40A 4UYDA 4XYAA 5D3PA 3P1CA 4HXOA 3MXFA 5FE7A 2DVQA 3QZVA 4C67A 5C89A 5D24A 5HENA 5FH6A 4NQMA 2RNXA 4UIWA 4QSXA 5EQ1A 5D3SA 2GRCA 5ENFA 4OGIA 5I88A 5EK9A 2DVVA 4YBMA 5JWMA 2YELA 4UIZA 1JSPB 5KTXA 5DYUA 3P1EA 4QYLA 5HRVA 2R0YA 4QEUA 5E3DA 3UV4A 5EPRA 4HBWA 4YBTA 4QNSA 4DONA 5L96A 5CQTA 5DYCA 4NR4A 2DWWA 5KHMA 5CUDA 5A5NA 2YEMA 5COIA 4YYMA 5HELA 3HMHA 4A9LA 3MUKA 5TCMA 4YABA 4O74A 4NQNA 3LJWA 5LUUA 2DVRA 4HXPA 4F3IA 4YYJA 4NYXA 4YYNA 4QSUA 4IR5A 4MR3A 4QC1A 4YY4A 5A5PA 5LVQA 5CUCA 4CLBA 4GPJA 5D26A 1F68A 4O77A 3LQHA 4NUCA 5DW1A 3U5LA 4ZQLA 5DFCA 5FBXA 4ALHA 5C8GA 4O72A 4YYHA 4NR7A 3S92A 5CU8A 3U5KA 5CQ8A 5FB0A 5EV9A 5CUGA 4BHWA 4QY4A 4KV1A 4YYGA 4QBMA 4MR4A 5C4QA 4LC2A 4LRGA 5CRZA 5DKCA 4Z1SA 1WUGA 5I7YA 4QUTA 5CFWA 5EPBA 4C66A 4UITA 5E0RA 5HEMA 4HBYA 4XUBA 2FSAA 4YATA 5HM0A 4CUPA 5FH7A 5FE3A 5E9YA 5HRWA 4XY8A 5CP5A 5EVAA 5FE4A 4MEPA 5CQ5A 2R0SA 3LXJA 4A9OA 5HCLA 4OGJA 5HJCA 5CQAA 4QSQA 4HXNA 5FFYA 4MEQA 4BW3A 4QR3A 2DATA 5E73A 3MQMA 2OSSA 5DBMA 5E9MA 3P5OA 4Q0OA 5D3RA 2E7NA 2YQDA 5EM3A 5EU1A 5FDZA 5D3NA 5EISA 3MULA 4O7AA 5I7XA 3O34A 3AQAA 5CQ7A 4CUTA 4YK0A 5F1LA 1N72A 3O37A 3U5OA 5C85A 4UYFB 5L99A 5EWCA 4NRCA 4HXSA 4QR5A 4LR6A 4HXRA 4QSTA 5L8UA 5I1QA 4NRAA 5FE2A 2RNYA 4O7BA 5ENEA 5FE5A 2RS9B 4YH4A 5CUAA 3QZSA 5EWDA 4O75A 4N4HA 5EP7A 4UYFA 4YYIA 2H60A 4RVRA 3U5NA 4TT6A 4CUUA 5HLSA 5ENGA 5D3LA 5CQ6A 5FE0A 4CUQA 5I83A 5KO4A 4NUDA 4XUAA 4BW4A 5G4RA 4WIVA 3DAIA 3FKMX 5IGLA 4J0RA 4UYHA 5E9LA 2DKWA 5DFBA 4NYVA 5CQ4A 2KTBB 3U5MA 4YC9A 4O70A 4TT2A 5TB6A 5EGUA 5D0CA 4A9MA 4TZ8A 2I8NA 3LQIA 4NUEA 4A9FA 5AMEA 5H85A 5E74A 4HXKA 4Q0NA 5DW2A 4FLPA 5ETBA 4QR4A 3JVJA 4Z93A 3HMEA 4QYDA 4QZSA 4IORA 4YBSA 5ENJA 2YW5A 3IU6A 5K29A 5CUBA 5F63A 4UIVA 4Y03A 4YAXA 5DKDA 4O71A 5AD3A 5KTWA 4NXJA 4BJXA 5H1VA 1ZS5A 4TU6A 4A9NA 5E9VA 3HMFA 4J1PA 5CY9A 3LQJA 4LYSA 2R10A 3DWYA 5CRMA 5E9KA 4QUUA 5A81A 4XY9A 4Z6HA 4KCXA 5ACYA 4NR9A 2R0VA 4J0SA 5DLXA 4Z6IA 5C87A 4NR8A 5F1HA 5DX4A 5DY7A 4YH3A 5I89A 5A82A 5J0DA 2N9GA 4LZ2A 4UYEA 5L8TA 2L5EA 4QC3A 4UIYA 4HXMA 4HXLA 4A9HA 5EI4A 4IR3A 5ENIA 4A9JA 5I86A 3UW9A 4TZ2A 2MJVB 4KV4A 1E6IA 4CL9A 2RNWA 4OUFA 4E96A 3U5PA 5BT3A 4J3IA 3TLPA 2L85A 2E3KA 3GG3A 3G0LA 3MB3A 4Z1QA 5CQ3A 5CPEA 4BW1A 5DFDA 4YYDA 5D25A 5DLZA 3O33A 4QEVA 4MR5A 5F36A 4QSVA 5EWHA 4N4GA 4AKNA 5LKXA 2WP2A 5IBNA 5IGKA 5KU3A 4QEWA 5LJ2A 4CURA 3UVWA 5E3GA 5ENHA 4TS8A 3SVFA 3P1FA 5EPSA 5F3AA 5A5SA 4IR4A 5IG6A 4PKLA 3NXBA 4LZRA 5DYXA 3I3JA 4PTBA 5HFQA 3UVDA 4A9EA 4MENA 4IR6A 5A5RA 4LZSA 5D3HA 5BT5A 5D7XA 5FE1A 3UV2A 3RCWA 5BT4A 5EWVA 5FG6A 4PCEA 5F60A 5CZGA 5II2A 4O7FA 4O76A 2RFJA 2I7KA 5FE9A 4CUSA 3SVHA 4MR6A 5EICA 5D3JA 3QZTA 2WP1A 5CTLA 3P1DA 5FG4A 1EQFA 3ONIA 5F61A 5A83A 4UYGA 4IOOA 5ENCA 5G4SA 4NR6A 2E7OA 4ZW1A 4PCIA 3AADA 4A9KA 5L97A 4TQNA 4N4IA 4ALGA 5LKZA 5LJ0A 3K2JA 5HQ5A 5EA1A 2L84A 4X2IA 4TT4A 4CFKA
chains in the Genus database with same CATH superfamily
2D9EA 2OUOA 4LDFA 4O78A 3UV5A 4WHWA 3ZYUA 4QSWA 5KTUA 4A9IA 5FFVA 4UIXA 5E7DA 5F62A 2RI7A 4MEOA 5HRXA 4YY6A 4NYWA 3D1DA 5FE6A 5LKUA 3UVXA 2F6JA 3MB4A 4NRBA 4O7CA 5II1A 5HQ6A 5A5QA 4O7EA 3UVYA 2YDWA 4TTEA 3S91A 5HQ7A 5DKHA 4BW2A 5C7NA 5FH8A 5A7CA 5F25A 2LSPB 2RO1A 2NXBA 3ERRA 5FE8A 4QSSA 4YADA 4ZC9A 2DVSA 4QB3A 5CGPA 4LYIA 5F2PA 5ENBA 2OO1A 3U5JA 5A85A 5IIDA 5IGMA 4NR5A 3JVKA 5AD2A 4PS5A 4QSPA 5H1TA 3SVGA 2YYNA 2YEKA 5I80A 3Q2EA 1JM4B 5JI8A 4LYWA 5A5OA 5HFRA 3D7CA 4HBXA 4N4FA 4UIUA 5ETDA 4PY6A 3IU5A 4TYLA 5D3TA 5I29A 5FFWA 3G0JA 2G4AA 5L98A 4NS5A 5EWWA 4N3WA 2D82A 5F5ZA 5E9IA 4AKHA 4WHUA 4QSRA 5AMFA 5H1UA 5IGNA 5DYAA 4CFLA 4TU4A 1WUMA 5LKTA 3JVMA 2F6NA 5CS8A 3JVLA 4IOQA 5CUEA 5FG5A 5LVRA 4HBVA 5FB1A 3O35A 4YYKA 3Q2FA 5LJ1A 1X0JA 3O36A 3VKGA 5I40A 4UYDA 4XYAA 5D3PA 3P1CA 4HXOA 3MXFA 5FE7A 2DVQA 3QZVA 4C67A 5C89A 5D24A 5HENA 5FH6A 4NQMA 2RNXA 4UIWA 4QSXA 5EQ1A 5D3SA 2GRCA 5ENFA 4OGIA 5I88A 5EK9A 2DVVA 4YBMA 5JWMA 2YELA 4UIZA 1JSPB 5KTXA 5DYUA 3P1EA 4QYLA 5HRVA 2R0YA 4QEUA 5E3DA 3UV4A 5EPRA 4HBWA 4YBTA 4QNSA 4DONA 5L96A 5CQTA 5DYCA 4NR4A 2DWWA 5KHMA 5CUDA 5A5NA 2YEMA 5COIA 4YYMA 5HELA 3HMHA 4A9LA 3MUKA 5TCMA 4YABA 4AKIA 4O74A 4NQNA 3LJWA 5LUUA 2DVRA 4HXPA 4F3IA 4YYJA 4NYXA 4YYNA 4QSUA 4IR5A 4MR3A 4QC1A 4YY4A 5A5PA 5LVQA 5CUCA 4CLBA 4GPJA 5D26A 1F68A 4O77A 3LQHA 4NUCA 5DW1A 3U5LA 4ZQLA 5DFCA 5FBXA 4ALHA 5C8GA 4O72A 4YYHA 3D1BA 4NR7A 3S92A 5CU8A 3U5KA 5CQ8A 5FB0A 5EV9A 5CUGA 4BHWA 4QY4A 4KV1A 4YYGA 4QBMA 4MR4A 5C4QA 4LC2A 4LRGA 5CRZA 5DKCA 4Z1SA 1WUGA 5I7YA 4QUTA 5CFWA 5EPBA 4C66A 4UITA 5E0RA 5HEMA 4HBYA 4XUBA 2FSAA 4YATA 5HM0A 4CUPA 5FH7A 5FE3A 5E9YA 5HRWA 4AI6A 4XY8A 5CP5A 5EVAA 5FE4A 4MEPA 5CQ5A 2R0SA 3LXJA 4A9OA 5HCLA 4OGJA 5HJCA 5CQAA 4QSQA 4HXNA 5FFYA 4MEQA 4BW3A 4QR3A 2DATA 5E73A 3MQMA 2OSSA 5DBMA 5E9MA 3P5OA 4Q0OA 5D3RA 2E7NA 2YQDA 5EM3A 5EU1A 1ZKRA 5FDZA 5D3NA 5EISA 3MULA 4O7AA 5I7XA 3O34A 3AQAA 5CQ7A 4CUTA 4YK0A 5F1LA 1N72A 3O37A 3U5OA 5C85A 4UYFB 5L99A 5EWCA 4NRCA 4HXSA 4QR5A 4LR6A 4HXRA 4QSTA 5L8UA 5I1QA 4NRAA 5FE2A 2RNYA 4O7BA 5ENEA 5FE5A 2RS9B 4YH4A 5CUAA 3QZSA 5EWDA 4AKGA 4O75A 4N4HA 5EP7A 4UYFA 4YYIA 2H60A 4RVRA 3U5NA 4TT6A 4CUUA 5HLSA 5ENGA 5D3LA 5CQ6A 5FE0A 4CUQA 5I83A 5KO4A 4NUDA 4XUAA 4BW4A 5G4RA 4WIVA 3DAIA 3FKMX 5IGLA 4J0RA 4UYHA 5E9LA 2DKWA 5DFBA 4NYVA 5CQ4A 2KTBB 3U5MA 4YC9A 4O70A 4TT2A 5TB6A 5EGUA 5D0CA 4A9MA 4TZ8A 2I8NA 3LQIA 4NUEA 4A9FA 5AMEA 5H85A 5E74A 4HXKA 4Q0NA 5DW2A 4FLPA 5ETBA 4QR4A 3JVJA 4Z93A 3HMEA 4QYDA 4QZSA 4IORA 4YBSA 5ENJA 2YW5A 3IU6A 5K29A 5CUBA 5F63A 4UIVA 4Y03A 4YAXA 5DKDA 4O71A 5AD3A 5KTWA 4NXJA 4BJXA 5H1VA 1ZS5A 4TU6A 4A9NA 5E9VA 3HMFA 4J1PA 5CY9A 3LQJA 4LYSA 2R10A 3DWYA 5CRMA 5E9KA 3VKHA 4QUUA 5A81A 2EJNA 4XY9A 4KCXA 4Z6HA 5ACYA 4NR9A 2R0VA 4J0SA 5DLXA 4Z6IA 5C87A 4NR8A 5F1HA 5DX4A 5DY7A 4YH3A 5I89A 5A82A 5J0DA 2N9GA 4LZ2A 4UYEA 5L8TA 2L5EA 4QC3A 4UIYA 4HXMA 4HXLA 4A9HA 5EI4A 4IR3A 5ENIA 4A9JA 5I86A 3UW9A 4TZ2A 2MJVB 4KV4A 1E6IA 4CL9A 2RNWA 4OUFA 4E96A 3U5PA 5BT3A 4J3IA 3TLPA 2L85A 2E3KA 3GG3A 3G0LA 3MB3A 4Z1QA 5CQ3A 5CPEA 4BW1A 5DFDA 4YYDA 5D25A 5DLZA 3O33A 4QEVA 4MR5A 5F36A 4QSVA 5EWHA 4N4GA 4AKNA 5LKXA 2WP2A 5IBNA 5IGKA 5KU3A 4QEWA 5LJ2A 4CURA 3UVWA 5E3GA 5ENHA 4TS8A 3SVFA 3P1FA 5EPSA 5F3AA 5A5SA 4IR4A 5IG6A 4PKLA 3NXBA 4LZRA 5DYXA 3I3JA 4PTBA 5HFQA 3UVDA 4A9EA 4MENA 4IR6A 5A5RA 4LZSA 5D3HA 5BT5A 5D7XA 5FE1A 3UV2A 3RCWA 5BT4A 5EWVA 5FG6A 4PCEA 5F60A 5CZGA 5II2A 4O7FA 4O76A 2RFJA 2I7KA 5FE9A 4CUSA 3SVHA 4MR6A 5EICA 5D3JA 3QZTA 2WP1A 5CTLA 3P1DA 1PUOA 5FG4A 1EQFA 3ONIA 5F61A 5A83A 4UYGA 4IOOA 5ENCA 5G4SA 4NR6A 2E7OA 4ZW1A 4PCIA 3AADA 4A9KA 5L97A 4TQNA 4N4IA 4ALGA 5LKZA 5LJ0A 3K2JA 5HQ5A 5EA1A 2L84A 4X2IA 4TT4A 4CFKA
chains in the Genus database with same CATH topology
2D9EA 2OUOA 4LDFA 4O78A 3UV5A 4WHWA 3ZYUA 4QSWA 5KTUA 4A9IA 5FFVA 4UIXA 5E7DA 5F62A 2RI7A 4MEOA 5HRXA 4YY6A 4NYWA 5FE6A 5LKUA 3UVXA 2F6JA 3MB4A 4NRBA 4O7CA 5II1A 5HQ6A 5A5QA 4O7EA 3UVYA 2YDWA 4TTEA 3S91A 5HQ7A 5DKHA 4BW2A 5C7NA 5FH8A 5A7CA 5F25A 2LSPB 2RO1A 2NXBA 5FE8A 4QSSA 4YADA 4ZC9A 2DVSA 4QB3A 5CGPA 4LYIA 5F2PA 5ENBA 2OO1A 3U5JA 5A85A 5IIDA 5IGMA 4NR5A 3JVKA 5AD2A 4PS5A 4QSPA 5H1TA 3SVGA 2YYNA 2YEKA 5I80A 3Q2EA 1JM4B 5JI8A 4LYWA 5A5OA 5HFRA 3D7CA 4HBXA 4N4FA 4UIUA 5ETDA 4PY6A 3IU5A 4TYLA 5D3TA 5I29A 5FFWA 3G0JA 2G4AA 5L98A 4NS5A 5EWWA 4N3WA 2D82A 5F5ZA 5E9IA 4WHUA 4QSRA 5AMFA 5H1UA 5IGNA 5DYAA 4CFLA 4TU4A 1WUMA 5LKTA 3JVMA 2F6NA 5CS8A 3JVLA 4IOQA 5CUEA 5FG5A 5LVRA 4HBVA 5FB1A 3O35A 4YYKA 3Q2FA 5LJ1A 1X0JA 3O36A 5I40A 4UYDA 4XYAA 5D3PA 3P1CA 4HXOA 3MXFA 5FE7A 2DVQA 3QZVA 4C67A 5C89A 5D24A 5HENA 5FH6A 4NQMA 2RNXA 4UIWA 4QSXA 5EQ1A 5D3SA 2GRCA 5ENFA 4OGIA 5I88A 5EK9A 2DVVA 4YBMA 5JWMA 2YELA 4UIZA 1JSPB 5KTXA 5DYUA 3P1EA 4QYLA 5HRVA 2R0YA 4QEUA 5E3DA 3UV4A 5EPRA 4HBWA 4YBTA 4QNSA 4DONA 5L96A 5CQTA 5DYCA 4NR4A 2DWWA 5KHMA 5CUDA 5A5NA 2YEMA 5COIA 4YYMA 5HELA 3HMHA 4A9LA 3MUKA 5TCMA 4YABA 4O74A 4NQNA 3LJWA 5LUUA 2DVRA 4HXPA 4F3IA 4YYJA 4NYXA 4YYNA 4QSUA 4IR5A 4MR3A 4QC1A 4YY4A 5A5PA 5LVQA 5CUCA 4CLBA 4GPJA 5D26A 1F68A 4O77A 3LQHA 4NUCA 5DW1A 3U5LA 4ZQLA 5DFCA 5FBXA 4ALHA 5C8GA 4O72A 4YYHA 4NR7A 3S92A 5CU8A 3U5KA 5CQ8A 5FB0A 5EV9A 5CUGA 4BHWA 4QY4A 4KV1A 4YYGA 4QBMA 4MR4A 5C4QA 4LC2A 4LRGA 5CRZA 5DKCA 4Z1SA 1WUGA 5I7YA 4QUTA 5CFWA 5EPBA 4C66A 4UITA 5E0RA 5HEMA 4HBYA 4XUBA 2FSAA 4YATA 5HM0A 4CUPA 5FH7A 5FE3A 5E9YA 5HRWA 4XY8A 5CP5A 5EVAA 5FE4A 4MEPA 5CQ5A 2R0SA 3LXJA 4A9OA 5HCLA 4OGJA 5HJCA 5CQAA 4QSQA 4HXNA 5FFYA 4MEQA 4BW3A 4QR3A 2DATA 5E73A 3MQMA 2OSSA 5DBMA 5E9MA 3P5OA 4Q0OA 5D3RA 2E7NA 2YQDA 5EM3A 5EU1A 5FDZA 5D3NA 5EISA 3MULA 4O7AA 5I7XA 3O34A 3AQAA 5CQ7A 4CUTA 4YK0A 5F1LA 1N72A 3O37A 3U5OA 5C85A 4UYFB 5L99A 5EWCA 4NRCA 4HXSA 4QR5A 4LR6A 4HXRA 4QSTA 5L8UA 5I1QA 4NRAA 5FE2A 2RNYA 4O7BA 5ENEA 5FE5A 2RS9B 4YH4A 5CUAA 3QZSA 5EWDA 4O75A 4N4HA 5EP7A 4UYFA 4YYIA 2H60A 4RVRA 3U5NA 4TT6A 4CUUA 5HLSA 5ENGA 5D3LA 5CQ6A 5FE0A 4CUQA 5I83A 5KO4A 4NUDA 4XUAA 4BW4A 5G4RA 4WIVA 3DAIA 3FKMX 5IGLA 4J0RA 4UYHA 5E9LA 2DKWA 5DFBA 4NYVA 5CQ4A 2KTBB 3U5MA 4YC9A 4O70A 4TT2A 5TB6A 5EGUA 5D0CA 4A9MA 4TZ8A 2I8NA 3LQIA 4NUEA 4A9FA 5AMEA 5H85A 5E74A 4HXKA 4Q0NA 5DW2A 4FLPA 5ETBA 4QR4A 3JVJA 4Z93A 3HMEA 4QYDA 4QZSA 4IORA 4YBSA 5ENJA 2YW5A 3IU6A 5K29A 5CUBA 5F63A 4UIVA 4Y03A 4YAXA 5DKDA 4O71A 5AD3A 5KTWA 4NXJA 4BJXA 5H1VA 1ZS5A 4TU6A 4A9NA 5E9VA 3HMFA 4J1PA 5CY9A 3LQJA 4LYSA 2R10A 3DWYA 5CRMA 5E9KA 4QUUA 5A81A 4XY9A 4Z6HA 4KCXA 5ACYA 4NR9A 2R0VA 4J0SA 5DLXA 4Z6IA 5C87A 4NR8A 5F1HA 5DX4A 5DY7A 4YH3A 5I89A 5A82A 5J0DA 2N9GA 4LZ2A 4UYEA 5L8TA 2L5EA 4QC3A 4UIYA 4HXMA 4HXLA 4A9HA 5EI4A 4IR3A 5ENIA 4A9JA 5I86A 3UW9A 4TZ2A 2MJVB 4KV4A 1E6IA 4CL9A 2RNWA 4OUFA 4E96A 3U5PA 5BT3A 4J3IA 3TLPA 2L85A 2E3KA 3GG3A 3G0LA 3MB3A 4Z1QA 5CQ3A 5CPEA 4BW1A 5DFDA 4YYDA 5D25A 5DLZA 3O33A 4QEVA 4MR5A 5F36A 4QSVA 5EWHA 4N4GA 4AKNA 5LKXA 2WP2A 5IBNA 5IGKA 5KU3A 4QEWA 5LJ2A 4CURA 3UVWA 5E3GA 5ENHA 4TS8A 3SVFA 3P1FA 5EPSA 5F3AA 5A5SA 4IR4A 5IG6A 4PKLA 3NXBA 4LZRA 5DYXA 3I3JA 4PTBA 5HFQA 3UVDA 4A9EA 4MENA 4IR6A 5A5RA 4LZSA 5D3HA 5BT5A 5D7XA 5FE1A 3UV2A 3RCWA 5BT4A 5EWVA 5FG6A 4PCEA 5F60A 5CZGA 5II2A 4O7FA 4O76A 2RFJA 2I7KA 5FE9A 4CUSA 3SVHA 4MR6A 5EICA 5D3JA 3QZTA 2WP1A 5CTLA 3P1DA 5FG4A 1EQFA 3ONIA 5F61A 5A83A 4UYGA 4IOOA 5ENCA 5G4SA 4NR6A 2E7OA 4ZW1A 4PCIA 3AADA 4A9KA 5L97A 4TQNA 4N4IA 4ALGA 5LKZA 5LJ0A 3K2JA 5HQ5A 5EA1A 2L84A 4X2IA 4TT4A 4CFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9E A;  2OUO A;  4LDF A;  4O78 A;  3UV5 A;  4WHW A;  3ZYU A;  4QSW A;  5KTU A;  4A9I A;  5FFV A;  4UIX A;  5E7D A;  5F62 A;  2RI7 A;  4MEO A;  5HRX A;  4YY6 A;  4NYW A;  5FE6 A;  5LKU A;  3UVX A;  2F6J A;  3MB4 A;  4NRB A;  4O7C A;  5II1 A;  5HQ6 A;  5A5Q A;  4O7E A;  3UVY A;  2YDW A;  4TTE A;  3S91 A;  5HQ7 A;  5DKH A;  4BW2 A;  5C7N A;  5FH8 A;  5A7C A;  5F25 A;  2LSP B;  2RO1 A;  2NXB A;  5FE8 A;  4QSS A;  4YAD A;  4ZC9 A;  2DVS A;  4QB3 A;  5CGP A;  4LYI A;  5F2P A;  5ENB A;  2OO1 A;  3U5J A;  5A85 A;  5IID A;  5IGM A;  4NR5 A;  3JVK A;  5AD2 A;  4PS5 A;  4QSP A;  5H1T A;  3SVG A;  2YYN A;  2YEK A;  5I80 A;  3Q2E A;  1JM4 B;  5JI8 A;  4LYW A;  5A5O A;  5HFR A;  3D7C A;  4HBX A;  4N4F A;  4UIU A;  5ETD A;  4PY6 A;  3IU5 A;  4TYL A;  5D3T A;  5I29 A;  5FFW A;  3G0J A;  2G4A A;  5L98 A;  4NS5 A;  5EWW A;  4N3W A;  2D82 A;  5F5Z A;  5E9I A;  4WHU A;  4QSR A;  5AMF A;  5H1U A;  5IGN A;  5DYA A;  4CFL A;  4TU4 A;  1WUM A;  5LKT A;  3JVM A;  2F6N A;  5CS8 A;  3JVL A;  4IOQ A;  5CUE A;  5FG5 A;  5LVR A;  4HBV A;  5FB1 A;  3O35 A;  4YYK A;  3Q2F A;  5LJ1 A;  1X0J A;  3O36 A;  5I40 A;  4UYD A;  4XYA A;  5D3P A;  3P1C A;  4HXO A;  3MXF A;  5FE7 A;  2DVQ A;  3QZV A;  4C67 A;  5C89 A;  5D24 A;  5HEN A;  5FH6 A;  4NQM A;  2RNX A;  4UIW A;  4QSX A;  5EQ1 A;  5D3S A;  2GRC A;  5ENF A;  4OGI A;  5I88 A;  5EK9 A;  2DVV A;  4YBM A;  5JWM A;  2YEL A;  4UIZ A;  1JSP B;  5KTX A;  5DYU A;  3P1E A;  4QYL A;  5HRV A;  2R0Y A;  4QEU A;  5E3D A;  3UV4 A;  5EPR A;  4HBW A;  4YBT A;  4QNS A;  4DON A;  5L96 A;  5CQT A;  5DYC A;  4NR4 A;  2DWW A;  5KHM A;  5CUD A;  5A5N A;  2YEM A;  5COI A;  4YYM A;  5HEL A;  3HMH A;  4A9L A;  3MUK A;  5TCM A;  4YAB A;  4O74 A;  4NQN A;  3LJW A;  5LUU A;  2DVR A;  4HXP A;  4F3I A;  4YYJ A;  4NYX A;  4YYN A;  4QSU A;  4IR5 A;  4MR3 A;  4QC1 A;  4YY4 A;  5A5P A;  5LVQ A;  5CUC A;  4CLB A;  4GPJ A;  5D26 A;  1F68 A;  4O77 A;  3LQH A;  4NUC A;  5DW1 A;  3U5L A;  4ZQL A;  5DFC A;  5FBX A;  4ALH A;  5C8G A;  4O72 A;  4YYH A;  4NR7 A;  3S92 A;  5CU8 A;  3U5K A;  5CQ8 A;  5FB0 A;  5EV9 A;  5CUG A;  4BHW A;  4QY4 A;  4KV1 A;  4YYG A;  4QBM A;  4MR4 A;  5C4Q A;  4LC2 A;  4LRG A;  5CRZ A;  5DKC A;  4Z1S A;  1WUG A;  5I7Y A;  4QUT A;  5CFW A;  5EPB A;  4C66 A;  4UIT A;  5E0R A;  5HEM A;  4HBY A;  4XUB A;  2FSA A;  4YAT A;  5HM0 A;  4CUP A;  5FH7 A;  5FE3 A;  5E9Y A;  5HRW A;  4XY8 A;  5CP5 A;  5EVA A;  5FE4 A;  4MEP A;  5CQ5 A;  2R0S A;  3LXJ A;  4A9O A;  5HCL A;  4OGJ A;  5HJC A;  5CQA A;  4QSQ A;  4HXN A;  5FFY A;  4MEQ A;  4BW3 A;  4QR3 A;  2DAT A;  5E73 A;  3MQM A;  2OSS A;  5DBM A;  5E9M A;  3P5O A;  4Q0O A;  5D3R A;  2E7N A;  2YQD A;  5EM3 A;  5EU1 A;  5FDZ A;  5D3N A;  5EIS A;  3MUL A;  4O7A A;  5I7X A;  3O34 A;  3AQA A;  5CQ7 A;  4CUT A;  4YK0 A;  5F1L A;  1N72 A;  3O37 A;  3U5O A;  5C85 A;  4UYF B;  5L99 A;  5EWC A;  4NRC A;  4HXS A;  4QR5 A;  4LR6 A;  4HXR A;  4QST A;  5L8U A;  5I1Q A;  4NRA A;  5FE2 A;  2RNY A;  4O7B A;  5ENE A;  5FE5 A;  2RS9 B;  4YH4 A;  5CUA A;  3QZS A;  5EWD A;  4O75 A;  4N4H A;  5EP7 A;  4UYF A;  4YYI A;  2H60 A;  4RVR A;  3U5N A;  4TT6 A;  4CUU A;  5HLS A;  5ENG A;  5D3L A;  5CQ6 A;  5FE0 A;  4CUQ A;  5I83 A;  5KO4 A;  4NUD A;  4XUA A;  4BW4 A;  5G4R A;  4WIV A;  3DAI A;  3FKM X;  5IGL A;  4J0R A;  4UYH A;  5E9L A;  2DKW A;  5DFB A;  4NYV A;  5CQ4 A;  2KTB B;  3U5M A;  4YC9 A;  4O70 A;  4TT2 A;  5TB6 A;  5EGU A;  5D0C A;  4A9M A;  4TZ8 A;  2I8N A;  3LQI A;  4NUE A;  4A9F A;  5AME A;  5H85 A;  5E74 A;  4HXK A;  4Q0N A;  5DW2 A;  4FLP A;  5ETB A;  4QR4 A;  3JVJ A;  4Z93 A;  3HME A;  4QYD A;  4QZS A;  4IOR A;  4YBS A;  5ENJ A;  2YW5 A;  3IU6 A;  5K29 A;  5CUB A;  5F63 A;  4UIV A;  4Y03 A;  4YAX A;  5DKD A;  4O71 A;  5AD3 A;  5KTW A;  4NXJ A;  4BJX A;  5H1V A;  1ZS5 A;  4TU6 A;  4A9N A;  5E9V A;  3HMF A;  4J1P A;  5CY9 A;  3LQJ A;  4LYS A;  2R10 A;  3DWY A;  5CRM A;  5E9K A;  4QUU A;  5A81 A;  4XY9 A;  4Z6H A;  4KCX A;  5ACY A;  4NR9 A;  2R0V A;  4J0S A;  5DLX A;  4Z6I A;  5C87 A;  4NR8 A;  5F1H A;  5DX4 A;  5DY7 A;  4YH3 A;  5I89 A;  5A82 A;  5J0D A;  2N9G A;  4LZ2 A;  4UYE A;  5L8T A;  2L5E A;  4QC3 A;  4UIY A;  4HXM A;  4HXL A;  4A9H A;  5EI4 A;  4IR3 A;  5ENI A;  4A9J A;  5I86 A;  3UW9 A;  4TZ2 A;  2MJV B;  4KV4 A;  1E6I A;  4CL9 A;  2RNW A;  4OUF A;  4E96 A;  3U5P A;  5BT3 A;  4J3I A;  3TLP A;  2L85 A;  2E3K A;  3GG3 A;  3G0L A;  3MB3 A;  4Z1Q A;  5CQ3 A;  5CPE A;  4BW1 A;  5DFD A;  4YYD A;  5D25 A;  5DLZ A;  3O33 A;  4QEV A;  4MR5 A;  5F36 A;  4QSV A;  5EWH A;  4N4G A;  4AKN A;  5LKX A;  2WP2 A;  5IBN A;  5IGK A;  5KU3 A;  4QEW A;  5LJ2 A;  4CUR A;  3UVW A;  5E3G A;  5ENH A;  4TS8 A;  3SVF A;  3P1F A;  5EPS A;  5F3A A;  5A5S A;  4IR4 A;  5IG6 A;  4PKL A;  3NXB A;  4LZR A;  5DYX A;  3I3J A;  4PTB A;  5HFQ A;  3UVD A;  4A9E A;  4MEN A;  4IR6 A;  5A5R A;  4LZS A;  5D3H A;  5BT5 A;  5D7X A;  5FE1 A;  3UV2 A;  3RCW A;  5BT4 A;  5EWV A;  5FG6 A;  4PCE A;  5F60 A;  5CZG A;  5II2 A;  4O7F A;  4O76 A;  2RFJ A;  2I7K A;  5FE9 A;  4CUS A;  3SVH A;  4MR6 A;  5EIC A;  5D3J A;  3QZT A;  2WP1 A;  5CTL A;  3P1D A;  5FG4 A;  1EQF A;  3ONI A;  5F61 A;  5A83 A;  4UYG A;  4IOO A;  5ENC A;  5G4S A;  4NR6 A;  2E7O A;  4ZW1 A;  4PCI A;  3AAD A;  4A9K A;  5L97 A;  4TQN A;  4N4I A;  4ALG A;  5LKZ A;  5LJ0 A;  3K2J A;  5HQ5 A;  5EA1 A;  2L84 A;  4X2I A;  4TT4 A;  4CFK A; 
#chains in the Genus database with same CATH topology
 2D9E A;  2OUO A;  4LDF A;  4O78 A;  3UV5 A;  4WHW A;  3ZYU A;  4QSW A;  5KTU A;  4A9I A;  5FFV A;  4UIX A;  5E7D A;  5F62 A;  2RI7 A;  4MEO A;  5HRX A;  4YY6 A;  4NYW A;  3D1D A;  5FE6 A;  5LKU A;  3UVX A;  2F6J A;  3MB4 A;  4NRB A;  4O7C A;  5II1 A;  5HQ6 A;  5A5Q A;  4O7E A;  3UVY A;  2YDW A;  4TTE A;  3S91 A;  5HQ7 A;  5DKH A;  4BW2 A;  5C7N A;  5FH8 A;  5A7C A;  5F25 A;  2LSP B;  2RO1 A;  2NXB A;  3ERR A;  5FE8 A;  4QSS A;  4YAD A;  4ZC9 A;  2DVS A;  4QB3 A;  5CGP A;  4LYI A;  5F2P A;  5ENB A;  2OO1 A;  3U5J A;  5A85 A;  5IID A;  5IGM A;  4NR5 A;  3JVK A;  5AD2 A;  4PS5 A;  4QSP A;  5H1T A;  3SVG A;  2YYN A;  2YEK A;  5I80 A;  3Q2E A;  1JM4 B;  5JI8 A;  4LYW A;  5A5O A;  5HFR A;  3D7C A;  4HBX A;  4N4F A;  4UIU A;  5ETD A;  4PY6 A;  3IU5 A;  4TYL A;  5D3T A;  5I29 A;  5FFW A;  3G0J A;  2G4A A;  5L98 A;  4NS5 A;  5EWW A;  4N3W A;  2D82 A;  5F5Z A;  5E9I A;  4AKH A;  4WHU A;  4QSR A;  5AMF A;  5H1U A;  5IGN A;  5DYA A;  4CFL A;  4TU4 A;  1WUM A;  5LKT A;  3JVM A;  2F6N A;  5CS8 A;  3JVL A;  4IOQ A;  5CUE A;  5FG5 A;  5LVR A;  4HBV A;  5FB1 A;  3O35 A;  4YYK A;  3Q2F A;  5LJ1 A;  1X0J A;  3O36 A;  3VKG A;  5I40 A;  4UYD A;  4XYA A;  5D3P A;  3P1C A;  4HXO A;  3MXF A;  5FE7 A;  2DVQ A;  3QZV A;  4C67 A;  5C89 A;  5D24 A;  5HEN A;  5FH6 A;  4NQM A;  2RNX A;  4UIW A;  4QSX A;  5EQ1 A;  5D3S A;  2GRC A;  5ENF A;  4OGI A;  5I88 A;  5EK9 A;  2DVV A;  4YBM A;  5JWM A;  2YEL A;  4UIZ A;  1JSP B;  5KTX A;  5DYU A;  3P1E A;  4QYL A;  5HRV A;  2R0Y A;  4QEU A;  5E3D A;  3UV4 A;  5EPR A;  4HBW A;  4YBT A;  4QNS A;  4DON A;  5L96 A;  5CQT A;  5DYC A;  4NR4 A;  2DWW A;  5KHM A;  5CUD A;  5A5N A;  2YEM A;  5COI A;  4YYM A;  5HEL A;  3HMH A;  4A9L A;  3MUK A;  5TCM A;  4YAB A;  4AKI A;  4O74 A;  4NQN A;  3LJW A;  5LUU A;  2DVR A;  4HXP A;  4F3I A;  4YYJ A;  4NYX A;  4YYN A;  4QSU A;  4IR5 A;  4MR3 A;  4QC1 A;  4YY4 A;  5A5P A;  5LVQ A;  5CUC A;  4CLB A;  4GPJ A;  5D26 A;  1F68 A;  4O77 A;  3LQH A;  4NUC A;  5DW1 A;  3U5L A;  4ZQL A;  5DFC A;  5FBX A;  4ALH A;  5C8G A;  4O72 A;  4YYH A;  3D1B A;  4NR7 A;  3S92 A;  5CU8 A;  3U5K A;  5CQ8 A;  5FB0 A;  5EV9 A;  5CUG A;  4BHW A;  4QY4 A;  4KV1 A;  4YYG A;  4QBM A;  4MR4 A;  5C4Q A;  4LC2 A;  4LRG A;  5CRZ A;  5DKC A;  4Z1S A;  1WUG A;  5I7Y A;  4QUT A;  5CFW A;  5EPB A;  4C66 A;  4UIT A;  5E0R A;  5HEM A;  4HBY A;  4XUB A;  2FSA A;  4YAT A;  5HM0 A;  4CUP A;  5FH7 A;  5FE3 A;  5E9Y A;  5HRW A;  4AI6 A;  4XY8 A;  5CP5 A;  5EVA A;  5FE4 A;  4MEP A;  5CQ5 A;  2R0S A;  3LXJ A;  4A9O A;  5HCL A;  4OGJ A;  5HJC A;  5CQA A;  4QSQ A;  4HXN A;  5FFY A;  4MEQ A;  4BW3 A;  4QR3 A;  2DAT A;  5E73 A;  3MQM A;  2OSS A;  5DBM A;  5E9M A;  3P5O A;  4Q0O A;  5D3R A;  2E7N A;  2YQD A;  5EM3 A;  5EU1 A;  1ZKR A;  5FDZ A;  5D3N A;  5EIS A;  3MUL A;  4O7A A;  5I7X A;  3O34 A;  3AQA A;  5CQ7 A;  4CUT A;  4YK0 A;  5F1L A;  1N72 A;  3O37 A;  3U5O A;  5C85 A;  4UYF B;  5L99 A;  5EWC A;  4NRC A;  4HXS A;  4QR5 A;  4LR6 A;  4HXR A;  4QST A;  5L8U A;  5I1Q A;  4NRA A;  5FE2 A;  2RNY A;  4O7B A;  5ENE A;  5FE5 A;  2RS9 B;  4YH4 A;  5CUA A;  3QZS A;  5EWD A;  4AKG A;  4O75 A;  4N4H A;  5EP7 A;  4UYF A;  4YYI A;  2H60 A;  4RVR A;  3U5N A;  4TT6 A;  4CUU A;  5HLS A;  5ENG A;  5D3L A;  5CQ6 A;  5FE0 A;  4CUQ A;  5I83 A;  5KO4 A;  4NUD A;  4XUA A;  4BW4 A;  5G4R A;  4WIV A;  3DAI A;  3FKM X;  5IGL A;  4J0R A;  4UYH A;  5E9L A;  2DKW A;  5DFB A;  4NYV A;  5CQ4 A;  2KTB B;  3U5M A;  4YC9 A;  4O70 A;  4TT2 A;  5TB6 A;  5EGU A;  5D0C A;  4A9M A;  4TZ8 A;  2I8N A;  3LQI A;  4NUE A;  4A9F A;  5AME A;  5H85 A;  5E74 A;  4HXK A;  4Q0N A;  5DW2 A;  4FLP A;  5ETB A;  4QR4 A;  3JVJ A;  4Z93 A;  3HME A;  4QYD A;  4QZS A;  4IOR A;  4YBS A;  5ENJ A;  2YW5 A;  3IU6 A;  5K29 A;  5CUB A;  5F63 A;  4UIV A;  4Y03 A;  4YAX A;  5DKD A;  4O71 A;  5AD3 A;  5KTW A;  4NXJ A;  4BJX A;  5H1V A;  1ZS5 A;  4TU6 A;  4A9N A;  5E9V A;  3HMF A;  4J1P A;  5CY9 A;  3LQJ A;  4LYS A;  2R10 A;  3DWY A;  5CRM A;  5E9K A;  3VKH A;  4QUU A;  5A81 A;  2EJN A;  4XY9 A;  4KCX A;  4Z6H A;  5ACY A;  4NR9 A;  2R0V A;  4J0S A;  5DLX A;  4Z6I A;  5C87 A;  4NR8 A;  5F1H A;  5DX4 A;  5DY7 A;  4YH3 A;  5I89 A;  5A82 A;  5J0D A;  2N9G A;  4LZ2 A;  4UYE A;  5L8T A;  2L5E A;  4QC3 A;  4UIY A;  4HXM A;  4HXL A;  4A9H A;  5EI4 A;  4IR3 A;  5ENI A;  4A9J A;  5I86 A;  3UW9 A;  4TZ2 A;  2MJV B;  4KV4 A;  1E6I A;  4CL9 A;  2RNW A;  4OUF A;  4E96 A;  3U5P A;  5BT3 A;  4J3I A;  3TLP A;  2L85 A;  2E3K A;  3GG3 A;  3G0L A;  3MB3 A;  4Z1Q A;  5CQ3 A;  5CPE A;  4BW1 A;  5DFD A;  4YYD A;  5D25 A;  5DLZ A;  3O33 A;  4QEV A;  4MR5 A;  5F36 A;  4QSV A;  5EWH A;  4N4G A;  4AKN A;  5LKX A;  2WP2 A;  5IBN A;  5IGK A;  5KU3 A;  4QEW A;  5LJ2 A;  4CUR A;  3UVW A;  5E3G A;  5ENH A;  4TS8 A;  3SVF A;  3P1F A;  5EPS A;  5F3A A;  5A5S A;  4IR4 A;  5IG6 A;  4PKL A;  3NXB A;  4LZR A;  5DYX A;  3I3J A;  4PTB A;  5HFQ A;  3UVD A;  4A9E A;  4MEN A;  4IR6 A;  5A5R A;  4LZS A;  5D3H A;  5BT5 A;  5D7X A;  5FE1 A;  3UV2 A;  3RCW A;  5BT4 A;  5EWV A;  5FG6 A;  4PCE A;  5F60 A;  5CZG A;  5II2 A;  4O7F A;  4O76 A;  2RFJ A;  2I7K A;  5FE9 A;  4CUS A;  3SVH A;  4MR6 A;  5EIC A;  5D3J A;  3QZT A;  2WP1 A;  5CTL A;  3P1D A;  1PUO A;  5FG4 A;  1EQF A;  3ONI A;  5F61 A;  5A83 A;  4UYG A;  4IOO A;  5ENC A;  5G4S A;  4NR6 A;  2E7O A;  4ZW1 A;  4PCI A;  3AAD A;  4A9K A;  5L97 A;  4TQN A;  4N4I A;  4ALG A;  5LKZ A;  5LJ0 A;  3K2J A;  5HQ5 A;  5EA1 A;  2L84 A;  4X2I A;  4TT4 A;  4CFK A; 
#chains in the Genus database with same CATH homology
 2D9E A;  2OUO A;  4LDF A;  4O78 A;  3UV5 A;  4WHW A;  3ZYU A;  4QSW A;  5KTU A;  4A9I A;  5FFV A;  4UIX A;  5E7D A;  5F62 A;  2RI7 A;  4MEO A;  5HRX A;  4YY6 A;  4NYW A;  5FE6 A;  5LKU A;  3UVX A;  2F6J A;  3MB4 A;  4NRB A;  4O7C A;  5II1 A;  5HQ6 A;  5A5Q A;  4O7E A;  3UVY A;  2YDW A;  4TTE A;  3S91 A;  5HQ7 A;  5DKH A;  4BW2 A;  5C7N A;  5FH8 A;  5A7C A;  5F25 A;  2LSP B;  2RO1 A;  2NXB A;  5FE8 A;  4QSS A;  4YAD A;  4ZC9 A;  2DVS A;  4QB3 A;  5CGP A;  4LYI A;  5F2P A;  5ENB A;  2OO1 A;  3U5J A;  5A85 A;  5IID A;  5IGM A;  4NR5 A;  3JVK A;  5AD2 A;  4PS5 A;  4QSP A;  5H1T A;  3SVG A;  2YYN A;  2YEK A;  5I80 A;  3Q2E A;  1JM4 B;  5JI8 A;  4LYW A;  5A5O A;  5HFR A;  3D7C A;  4HBX A;  4N4F A;  4UIU A;  5ETD A;  4PY6 A;  3IU5 A;  4TYL A;  5D3T A;  5I29 A;  5FFW A;  3G0J A;  2G4A A;  5L98 A;  4NS5 A;  5EWW A;  4N3W A;  2D82 A;  5F5Z A;  5E9I A;  4WHU A;  4QSR A;  5AMF A;  5H1U A;  5IGN A;  5DYA A;  4CFL A;  4TU4 A;  1WUM A;  5LKT A;  3JVM A;  2F6N A;  5CS8 A;  3JVL A;  4IOQ A;  5CUE A;  5FG5 A;  5LVR A;  4HBV A;  5FB1 A;  3O35 A;  4YYK A;  3Q2F A;  5LJ1 A;  1X0J A;  3O36 A;  5I40 A;  4UYD A;  4XYA A;  5D3P A;  3P1C A;  4HXO A;  3MXF A;  5FE7 A;  2DVQ A;  3QZV A;  4C67 A;  5C89 A;  5D24 A;  5HEN A;  5FH6 A;  4NQM A;  2RNX A;  4UIW A;  4QSX A;  5EQ1 A;  5D3S A;  2GRC A;  5ENF A;  4OGI A;  5I88 A;  5EK9 A;  2DVV A;  4YBM A;  5JWM A;  2YEL A;  4UIZ A;  1JSP B;  5KTX A;  5DYU A;  3P1E A;  4QYL A;  5HRV A;  2R0Y A;  4QEU A;  5E3D A;  3UV4 A;  5EPR A;  4HBW A;  4YBT A;  4QNS A;  4DON A;  5L96 A;  5CQT A;  5DYC A;  4NR4 A;  2DWW A;  5KHM A;  5CUD A;  5A5N A;  2YEM A;  5COI A;  4YYM A;  5HEL A;  3HMH A;  4A9L A;  3MUK A;  5TCM A;  4YAB A;  4O74 A;  4NQN A;  3LJW A;  5LUU A;  2DVR A;  4HXP A;  4F3I A;  4YYJ A;  4NYX A;  4YYN A;  4QSU A;  4IR5 A;  4MR3 A;  4QC1 A;  4YY4 A;  5A5P A;  5LVQ A;  5CUC A;  4CLB A;  4GPJ A;  5D26 A;  1F68 A;  4O77 A;  3LQH A;  4NUC A;  5DW1 A;  3U5L A;  4ZQL A;  5DFC A;  5FBX A;  4ALH A;  5C8G A;  4O72 A;  4YYH A;  4NR7 A;  3S92 A;  5CU8 A;  3U5K A;  5CQ8 A;  5FB0 A;  5EV9 A;  5CUG A;  4BHW A;  4QY4 A;  4KV1 A;  4YYG A;  4QBM A;  4MR4 A;  5C4Q A;  4LC2 A;  4LRG A;  5CRZ A;  5DKC A;  4Z1S A;  1WUG A;  5I7Y A;  4QUT A;  5CFW A;  5EPB A;  4C66 A;  4UIT A;  5E0R A;  5HEM A;  4HBY A;  4XUB A;  2FSA A;  4YAT A;  5HM0 A;  4CUP A;  5FH7 A;  5FE3 A;  5E9Y A;  5HRW A;  4XY8 A;  5CP5 A;  5EVA A;  5FE4 A;  4MEP A;  5CQ5 A;  2R0S A;  3LXJ A;  4A9O A;  5HCL A;  4OGJ A;  5HJC A;  5CQA A;  4QSQ A;  4HXN A;  5FFY A;  4MEQ A;  4BW3 A;  4QR3 A;  2DAT A;  5E73 A;  3MQM A;  2OSS A;  5DBM A;  5E9M A;  3P5O A;  4Q0O A;  5D3R A;  2E7N A;  2YQD A;  5EM3 A;  5EU1 A;  5FDZ A;  5D3N A;  5EIS A;  3MUL A;  4O7A A;  5I7X A;  3O34 A;  3AQA A;  5CQ7 A;  4CUT A;  4YK0 A;  5F1L A;  1N72 A;  3O37 A;  3U5O A;  5C85 A;  4UYF B;  5L99 A;  5EWC A;  4NRC A;  4HXS A;  4QR5 A;  4LR6 A;  4HXR A;  4QST A;  5L8U A;  5I1Q A;  4NRA A;  5FE2 A;  2RNY A;  4O7B A;  5ENE A;  5FE5 A;  2RS9 B;  4YH4 A;  5CUA A;  3QZS A;  5EWD A;  4O75 A;  4N4H A;  5EP7 A;  4UYF A;  4YYI A;  2H60 A;  4RVR A;  3U5N A;  4TT6 A;  4CUU A;  5HLS A;  5ENG A;  5D3L A;  5CQ6 A;  5FE0 A;  4CUQ A;  5I83 A;  5KO4 A;  4NUD A;  4XUA A;  4BW4 A;  5G4R A;  4WIV A;  3DAI A;  3FKM X;  5IGL A;  4J0R A;  4UYH A;  5E9L A;  2DKW A;  5DFB A;  4NYV A;  5CQ4 A;  2KTB B;  3U5M A;  4YC9 A;  4O70 A;  4TT2 A;  5TB6 A;  5EGU A;  5D0C A;  4A9M A;  4TZ8 A;  2I8N A;  3LQI A;  4NUE A;  4A9F A;  5AME A;  5H85 A;  5E74 A;  4HXK A;  4Q0N A;  5DW2 A;  4FLP A;  5ETB A;  4QR4 A;  3JVJ A;  4Z93 A;  3HME A;  4QYD A;  4QZS A;  4IOR A;  4YBS A;  5ENJ A;  2YW5 A;  3IU6 A;  5K29 A;  5CUB A;  5F63 A;  4UIV A;  4Y03 A;  4YAX A;  5DKD A;  4O71 A;  5AD3 A;  5KTW A;  4NXJ A;  4BJX A;  5H1V A;  1ZS5 A;  4TU6 A;  4A9N A;  5E9V A;  3HMF A;  4J1P A;  5CY9 A;  3LQJ A;  4LYS A;  2R10 A;  3DWY A;  5CRM A;  5E9K A;  4QUU A;  5A81 A;  4XY9 A;  4Z6H A;  4KCX A;  5ACY A;  4NR9 A;  2R0V A;  4J0S A;  5DLX A;  4Z6I A;  5C87 A;  4NR8 A;  5F1H A;  5DX4 A;  5DY7 A;  4YH3 A;  5I89 A;  5A82 A;  5J0D A;  2N9G A;  4LZ2 A;  4UYE A;  5L8T A;  2L5E A;  4QC3 A;  4UIY A;  4HXM A;  4HXL A;  4A9H A;  5EI4 A;  4IR3 A;  5ENI A;  4A9J A;  5I86 A;  3UW9 A;  4TZ2 A;  2MJV B;  4KV4 A;  1E6I A;  4CL9 A;  2RNW A;  4OUF A;  4E96 A;  3U5P A;  5BT3 A;  4J3I A;  3TLP A;  2L85 A;  2E3K A;  3GG3 A;  3G0L A;  3MB3 A;  4Z1Q A;  5CQ3 A;  5CPE A;  4BW1 A;  5DFD A;  4YYD A;  5D25 A;  5DLZ A;  3O33 A;  4QEV A;  4MR5 A;  5F36 A;  4QSV A;  5EWH A;  4N4G A;  4AKN A;  5LKX A;  2WP2 A;  5IBN A;  5IGK A;  5KU3 A;  4QEW A;  5LJ2 A;  4CUR A;  3UVW A;  5E3G A;  5ENH A;  4TS8 A;  3SVF A;  3P1F A;  5EPS A;  5F3A A;  5A5S A;  4IR4 A;  5IG6 A;  4PKL A;  3NXB A;  4LZR A;  5DYX A;  3I3J A;  4PTB A;  5HFQ A;  3UVD A;  4A9E A;  4MEN A;  4IR6 A;  5A5R A;  4LZS A;  5D3H A;  5BT5 A;  5D7X A;  5FE1 A;  3UV2 A;  3RCW A;  5BT4 A;  5EWV A;  5FG6 A;  4PCE A;  5F60 A;  5CZG A;  5II2 A;  4O7F A;  4O76 A;  2RFJ A;  2I7K A;  5FE9 A;  4CUS A;  3SVH A;  4MR6 A;  5EIC A;  5D3J A;  3QZT A;  2WP1 A;  5CTL A;  3P1D A;  5FG4 A;  1EQF A;  3ONI A;  5F61 A;  5A83 A;  4UYG A;  4IOO A;  5ENC A;  5G4S A;  4NR6 A;  2E7O A;  4ZW1 A;  4PCI A;  3AAD A;  4A9K A;  5L97 A;  4TQN A;  4N4I A;  4ALG A;  5LKZ A;  5LJ0 A;  3K2J A;  5HQ5 A;  5EA1 A;  2L84 A;  4X2I A;  4TT4 A;  4CFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...