4YYNA

Crystal structure of taf1 bd2 bromodomain bound to a crotonyllysine peptide
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
DDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription initiation factor TFIID subunit 1
publication title A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 54
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4yynA00
3AADA 3MXFA 5L98A 2R0SA 4O72A 4IR4A 5CY9A 4NR6A 4UYFB 3ZYUA 2L5EA 4YYKA 5HM0A 3G0JA 5EISA 5C85A 3P1DA 4QR5A 3UVYA 2H60A 3DWYA 5I40A 4J1PA 3U5LA 4QYLA 5HENA 4UIYA 5FE7A 5COIA 4HBVA 4LRGA 5II1A 4RVRA 3S91A 4UIUA 5FFYA 1EQFA 5ENJA 4QYDA 5HQ7A 5DFCA 5E9KA 5F3AA 1N72A 5F1LA 4BHWA 4QEVA 5C87A 5IIDA 2RNWA 4MEOA 4BW4A 5HFRA 4XUAA 3LQJA 5FE2A 4N3WA 2OUOA 5ENHA 5F25A 3MB4A 3O34A 4O74A 2DVQA 4PCEA 5ETDA 4TT4A 3MUKA 4QSWA 5AMEA 4E96A 4QSUA 5I80A 3P1CA 4LC2A 4YK0A 4NQNA 5F63A 4HXMA 2GRCA 5D3RA 4HBYA 5D7XA 2L84A 4O7FA 3JVJA 3QZVA 5HEMA 5F62A 3MULA 4Z1QA 5I89A 3U5KA 5CP5A 5FFVA 3U5NA 2E7NA 5DY7A 4TZ2A 4UIXA 5DKCA 5CUDA 4MR4A 2RS9B 2RNYA 3GG3A 1X0JA 3JVLA 4NR5A 3SVHA 5ENGA 3UVXA 5D3JA 4QZSA 5HELA 5EWWA 4OGJA 4TTEA 4BW1A 5FB1A 5ENIA 5IGNA 5F1HA 5LKTA 5IGKA 5LKXA 2R10A 5D3NA 4O76A 4QSVA 2DATA 2RFJA 4O77A 3UVDA 4QC3A 5E9IA 4HXLA 5CQ3A 3Q2EA 4CLBA 5D0CA 4TU4A 5A5QA 2YW5A 4IOOA 4NUCA 4YBMA 5HQ6A 3P1EA 5JI8A 3O33A 3SVGA 3UVWA 3FKMX 5I83A 5AMFA 2E3KA 5CQ5A 2N9GA 3NXBA 5CQAA 5A5OA 4NR7A 5C89A 4TU6A 4Z1SA 5FG4A 4MR6A 4YYNA 4UYHA 5FE1A 4CL9A 5FBXA 4LYIA 5DFBA 4HBXA 4QEUA 4A9OA 5L97A 4QR4A 5CRMA 5DKHA 5EWCA 4UIZA 5H1VA 4YYJA 5A7CA 4C67A 5E74A 5CUCA 5LJ2A 5E73A 4WHUA 3O37A 5ACYA 5ENEA 1E6IA 4LZ2A 5C7NA 4YYGA 4NXJA 4BW2A 5EV9A 5I7XA 5I29A 5K29A 2YELA 4QSTA 2YEMA 4QSXA 4QC1A 4YATA 5DW2A 5CFWA 4NRCA 5E0RA 5D3LA 5F36A 5CUGA 3K2JA 4O7EA 4NR4A 3LJWA 4UYDA 4UIVA 4PTBA 4A9JA 5FE9A 5FE6A 4Z6HA 4CUUA 5EK9A 5DX4A 3UV5A 4J0RA 5D26A 4QB3A 4HXRA 2DKWA 2RNXA 4KV1A 4BJXA 3O35A 5DYCA 2E7OA 5I7YA 5A81A 2DVRA 4NYVA 3DAIA 5LUUA 4NYXA 4C66A 5IGLA 5FE3A 4LYSA 5EA1A 4WHWA 5A5SA 2D9EA 5A82A 4Z93A 4X2IA 5LJ1A 5E3DA 2DWWA 5J0DA 4XYAA 2OO1A 3UV4A 2YYNA 3U5MA 5A5NA 5EWHA 3MB3A 4A9LA 5CQTA 2RI7A 4NRAA 5EPSA 2I7KA 4XY8A 4NR9A 4YBSA 3I3JA 4UITA 5EP7A 3IU5A 5F5ZA 4QUTA 5DBMA 4TQNA 5A5RA 4NS5A 3Q2FA 5EICA 4LDFA 3G0LA 4LZRA 4A9HA 5EQ1A 5F2PA 4YYMA 4ZC9A 5A85A 5LKUA 4LZSA 5D24A 5DLZA 3P5OA 2R0VA 4QSQA 5IGMA 5E9VA 4OUFA 4TT6A 5FDZA 2R0YA 5JWMA 5H1TA 4PCIA 5D3HA 4CURA 4QSSA 2DVVA 4TS8A 4N4IA 5ENCA 4TT2A 3O36A 4WIVA 4NQMA 4YYHA 4CUSA 4NYWA 4MENA 5D3TA 5CTLA 3U5OA 4CUPA 4HXPA 5FE8A 4PY6A 3RCWA 4YABA 5H85A 5DKDA 5HLSA 4ZQLA 4LYWA 4ZW1A 5DYAA 4KV4A 4ALGA 5EGUA 5FG5A 4IR5A 4A9KA 4DONA 4IOQA 4CUQA 5D3PA 3U5PA 5L99A 5LKZA 5BT3A 5IBNA 2G4AA 3AQAA 4O7CA 3QZSA 5BT5A 5CU8A 5KTXA 5E3GA 5D3SA 5L8TA 1JSPB 3D7CA 3ONIA 3UV2A 2LSPB 5LJ0A 5DLXA 4YAXA 3U5JA 5DYXA 2YEKA 5L96A 5I88A 4YYIA 2KTBB 2OSSA 5CQ7A 4YH3A 4NRBA 4QBMA 5CQ6A 4YADA 5HJCA 4CUTA 4MR5A 4F3IA 2YQDA 2I8NA 4YYDA 2NXBA 4PKLA 2L85A 3P1FA 4LR6A 4HXKA 5I86A 5ENFA 5CGPA 5FH8A 5FE0A 5E9YA 5CPEA 5FH6A 5EVAA 5KTUA 2FSAA 5HRVA 5CQ4A 4TZ8A 4BW3A 4IR3A 4HXNA 4TYLA 4Z6IA 5FFWA 4UYEA 3UW9A 4O7AA 4O70A 4QSRA 4QNSA 5CUBA 5DFDA 5F61A 5CS8A 5HQ5A 4NUDA 5G4SA 4O7BA 4QSPA 4KCXA 4MEPA 5E9LA 5L8UA 2D82A 3MQMA 5ENBA 4HBWA 5ETBA 2WP2A 2RO1A 5DYUA 5II2A 3TLPA 4N4FA 5KTWA 5I1QA 4IR6A 4A9FA 4XUBA 4Y03A 5FE4A 5BT4A 4QEWA 5TB6A 4YY6A 1F68A 5FE5A 5KHMA 4NUEA 2F6JA 3IU6A 4UYGA 4HXSA 4A9IA 5CRZA 5E7DA 4Q0OA 4A9NA 4Q0NA 5C4QA 4J3IA 5C8GA 4ALHA 3HMFA 4O78A 2DVSA 1WUMA 5IG6A 4AKNA 4A9EA 5E9MA 2YDWA 4YBTA 3JVMA 5TCMA 3QZTA 5CUEA 2F6NA 4N4GA 5CQ8A 4O71A 5CZGA 5D25A 4QUUA 5EPRA 4QY4A 4HXOA 4OGIA 4NR8A 4YC9A 5A5PA 4J0SA 5HCLA 4PS5A 4CFKA 5HRWA 1WUGA 5G4RA 5A83A 3HMHA 2MJVB 4XY9A 5EI4A 5CUAA 1ZS5A 3HMEA 5HRXA 4QR3A 5FH7A 4YY4A 5DW1A 3LQHA 5LVRA 5EM3A 4UIWA 3SVFA 4CFLA 3LQIA 5FG6A 5EWVA 2WP1A 5AD2A 3LXJA 5LVQA 4MEQA 4FLPA 5FB0A 4YH4A 1JM4B 5KO4A 3S92A 3JVKA 5EWDA 5EPBA 4IORA 5F60A 4A9MA 4N4HA 5AD3A 4GPJA 5KU3A 5HFQA 4O75A 4MR3A 5H1UA 5EU1A 4UYFA
chains in the Genus database with same CATH superfamily
3AADA 3MXFA 5L98A 2R0SA 4O72A 4IR4A 5CY9A 4NR6A 4UYFB 3ZYUA 2L5EA 4AKGA 4YYKA 5HM0A 3G0JA 5EISA 5C85A 3P1DA 4QR5A 3UVYA 2H60A 3DWYA 5I40A 4J1PA 3U5LA 4QYLA 5HENA 4UIYA 5FE7A 5COIA 4HBVA 4LRGA 5II1A 4RVRA 3S91A 4UIUA 5FFYA 1EQFA 5ENJA 4QYDA 5HQ7A 5DFCA 5E9KA 5F3AA 1N72A 5F1LA 4BHWA 4QEVA 5C87A 5IIDA 2RNWA 4MEOA 4BW4A 5HFRA 4XUAA 3LQJA 5FE2A 4N3WA 2OUOA 5ENHA 5F25A 3VKHA 3MB4A 3O34A 4O74A 2DVQA 4PCEA 5ETDA 4TT4A 3MUKA 4QSWA 5AMEA 4E96A 4QSUA 5I80A 3P1CA 4LC2A 4YK0A 4NQNA 5F63A 4HXMA 2GRCA 5D3RA 4HBYA 5D7XA 2L84A 4O7FA 3JVJA 3QZVA 5HEMA 5F62A 3MULA 4Z1QA 5I89A 3U5KA 5CP5A 5FFVA 3U5NA 2E7NA 5DY7A 4TZ2A 4UIXA 5DKCA 5CUDA 4MR4A 2RS9B 2RNYA 3GG3A 1X0JA 3JVLA 4NR5A 3SVHA 5ENGA 3UVXA 5D3JA 4QZSA 5HELA 5EWWA 4OGJA 4TTEA 4BW1A 5FB1A 5ENIA 5IGNA 5F1HA 5LKTA 5IGKA 5LKXA 2R10A 5D3NA 4O76A 4QSVA 2DATA 2RFJA 4O77A 3UVDA 4QC3A 5E9IA 4HXLA 1PUOA 5CQ3A 3Q2EA 4CLBA 5D0CA 4TU4A 5A5QA 2YW5A 4IOOA 4NUCA 4YBMA 5HQ6A 3P1EA 5JI8A 3O33A 3SVGA 3UVWA 3FKMX 5I83A 5AMFA 2E3KA 5CQ5A 2N9GA 3NXBA 5CQAA 5A5OA 4NR7A 5C89A 4TU6A 4Z1SA 5FG4A 4MR6A 4YYNA 4UYHA 5FE1A 4CL9A 5FBXA 4LYIA 5DFBA 4HBXA 4QEUA 4A9OA 5L97A 4QR4A 5CRMA 5DKHA 5EWCA 4UIZA 5H1VA 4YYJA 5A7CA 4C67A 5E74A 5CUCA 5LJ2A 5E73A 4WHUA 4AI6A 3O37A 5ACYA 5ENEA 1E6IA 4LZ2A 2EJNA 5C7NA 4YYGA 4NXJA 4BW2A 1ZKRA 5EV9A 5I7XA 5I29A 5K29A 2YELA 4QSTA 2YEMA 4QSXA 4QC1A 4YATA 5DW2A 5CFWA 4NRCA 5E0RA 5D3LA 5F36A 5CUGA 3K2JA 4O7EA 4NR4A 3LJWA 4UYDA 4UIVA 4PTBA 4A9JA 5FE9A 3D1BA 5FE6A 4Z6HA 4CUUA 5EK9A 5DX4A 3UV5A 4J0RA 5D26A 4QB3A 4HXRA 2DKWA 2RNXA 4KV1A 4BJXA 3VKGA 3O35A 5DYCA 2E7OA 5I7YA 5A81A 2DVRA 4NYVA 3DAIA 5LUUA 4NYXA 3ERRA 4C66A 5IGLA 5FE3A 4LYSA 5EA1A 4WHWA 4AKIA 5A5SA 2D9EA 5A82A 4Z93A 4X2IA 5LJ1A 5E3DA 2DWWA 5J0DA 4XYAA 2OO1A 3UV4A 2YYNA 3U5MA 5A5NA 5EWHA 3MB3A 4A9LA 5CQTA 2RI7A 4NRAA 5EPSA 2I7KA 4XY8A 4NR9A 4YBSA 3I3JA 4UITA 5EP7A 3IU5A 5F5ZA 4QUTA 5DBMA 4TQNA 5A5RA 4NS5A 3Q2FA 5EICA 4AKHA 4LDFA 3G0LA 4LZRA 4A9HA 5EQ1A 5F2PA 4YYMA 4ZC9A 5A85A 5LKUA 4LZSA 5D24A 5DLZA 3P5OA 2R0VA 4QSQA 5IGMA 5E9VA 4OUFA 4TT6A 5FDZA 2R0YA 5JWMA 5H1TA 4PCIA 5D3HA 4CURA 4QSSA 2DVVA 4TS8A 4N4IA 5ENCA 4TT2A 3O36A 4WIVA 4NQMA 4YYHA 4CUSA 4NYWA 4MENA 5D3TA 5CTLA 3U5OA 4CUPA 4HXPA 5FE8A 4PY6A 3RCWA 4YABA 5H85A 5DKDA 5HLSA 4ZQLA 4LYWA 4ZW1A 5DYAA 4KV4A 4ALGA 5EGUA 5FG5A 4IR5A 4A9KA 4DONA 4IOQA 4CUQA 5D3PA 3U5PA 5L99A 5LKZA 5BT3A 5IBNA 2G4AA 3AQAA 4O7CA 3QZSA 5BT5A 5CU8A 5KTXA 5E3GA 5D3SA 3D1DA 5L8TA 1JSPB 3D7CA 3ONIA 3UV2A 2LSPB 5LJ0A 5DLXA 4YAXA 3U5JA 5DYXA 2YEKA 5L96A 5I88A 4YYIA 2KTBB 2OSSA 5CQ7A 4YH3A 4NRBA 4QBMA 5CQ6A 4YADA 5HJCA 4CUTA 4MR5A 4F3IA 2YQDA 2I8NA 4YYDA 2NXBA 4PKLA 2L85A 3P1FA 4LR6A 4HXKA 5I86A 5ENFA 5CGPA 5FH8A 5FE0A 5E9YA 5CPEA 5FH6A 5EVAA 5KTUA 2FSAA 5HRVA 5CQ4A 4TZ8A 4BW3A 4IR3A 4HXNA 4TYLA 4Z6IA 5FFWA 4UYEA 3UW9A 4O7AA 4O70A 4QSRA 4QNSA 5CUBA 5DFDA 5F61A 5CS8A 5HQ5A 4NUDA 5G4SA 4O7BA 4QSPA 4KCXA 4MEPA 5E9LA 5L8UA 2D82A 3MQMA 5ENBA 4HBWA 5ETBA 2WP2A 2RO1A 5DYUA 5II2A 3TLPA 4N4FA 5KTWA 5I1QA 4IR6A 4A9FA 4XUBA 4Y03A 5FE4A 5BT4A 4QEWA 5TB6A 4YY6A 1F68A 5FE5A 5KHMA 4NUEA 2F6JA 3IU6A 4UYGA 4HXSA 4A9IA 5CRZA 5E7DA 4Q0OA 4A9NA 4Q0NA 5C4QA 4J3IA 5C8GA 4ALHA 3HMFA 4O78A 2DVSA 1WUMA 5IG6A 4AKNA 4A9EA 5E9MA 2YDWA 4YBTA 3JVMA 5TCMA 3QZTA 5CUEA 2F6NA 4N4GA 5CQ8A 4O71A 5CZGA 5D25A 4QUUA 5EPRA 4QY4A 4HXOA 4OGIA 4NR8A 4YC9A 5A5PA 4J0SA 5HCLA 4PS5A 4CFKA 5HRWA 1WUGA 5G4RA 5A83A 3HMHA 2MJVB 4XY9A 5EI4A 5CUAA 1ZS5A 3HMEA 5HRXA 4QR3A 5FH7A 4YY4A 5DW1A 3LQHA 5LVRA 5EM3A 4UIWA 3SVFA 4CFLA 3LQIA 5FG6A 5EWVA 2WP1A 5AD2A 3LXJA 5LVQA 4MEQA 4FLPA 5FB0A 4YH4A 1JM4B 5KO4A 3S92A 3JVKA 5EWDA 5EPBA 4IORA 5F60A 4A9MA 4N4HA 5AD3A 4GPJA 5KU3A 5HFQA 4O75A 4MR3A 5H1UA 5EU1A 4UYFA
chains in the Genus database with same CATH topology
3AADA 3MXFA 5L98A 2R0SA 4O72A 4IR4A 5CY9A 4NR6A 4UYFB 3ZYUA 2L5EA 4YYKA 5HM0A 3G0JA 5EISA 5C85A 3P1DA 4QR5A 3UVYA 2H60A 3DWYA 5I40A 4J1PA 3U5LA 4QYLA 5HENA 4UIYA 5FE7A 5COIA 4HBVA 4LRGA 5II1A 4RVRA 3S91A 4UIUA 5FFYA 1EQFA 5ENJA 4QYDA 5HQ7A 5DFCA 5E9KA 5F3AA 1N72A 5F1LA 4BHWA 4QEVA 5C87A 5IIDA 2RNWA 4MEOA 4BW4A 5HFRA 4XUAA 3LQJA 5FE2A 4N3WA 2OUOA 5ENHA 5F25A 3MB4A 3O34A 4O74A 2DVQA 4PCEA 5ETDA 4TT4A 3MUKA 4QSWA 5AMEA 4E96A 4QSUA 5I80A 3P1CA 4LC2A 4YK0A 4NQNA 5F63A 4HXMA 2GRCA 5D3RA 4HBYA 5D7XA 2L84A 4O7FA 3JVJA 3QZVA 5HEMA 5F62A 3MULA 4Z1QA 5I89A 3U5KA 5CP5A 5FFVA 3U5NA 2E7NA 5DY7A 4TZ2A 4UIXA 5DKCA 5CUDA 4MR4A 2RS9B 2RNYA 3GG3A 1X0JA 3JVLA 4NR5A 3SVHA 5ENGA 3UVXA 5D3JA 4QZSA 5HELA 5EWWA 4OGJA 4TTEA 4BW1A 5FB1A 5ENIA 5IGNA 5F1HA 5LKTA 5IGKA 5LKXA 2R10A 5D3NA 4O76A 4QSVA 2DATA 2RFJA 4O77A 3UVDA 4QC3A 5E9IA 4HXLA 5CQ3A 3Q2EA 4CLBA 5D0CA 4TU4A 5A5QA 2YW5A 4IOOA 4NUCA 4YBMA 5HQ6A 3P1EA 5JI8A 3O33A 3SVGA 3UVWA 3FKMX 5I83A 5AMFA 2E3KA 5CQ5A 2N9GA 3NXBA 5CQAA 5A5OA 4NR7A 5C89A 4TU6A 4Z1SA 5FG4A 4MR6A 4YYNA 4UYHA 5FE1A 4CL9A 5FBXA 4LYIA 5DFBA 4HBXA 4QEUA 4A9OA 5L97A 4QR4A 5CRMA 5DKHA 5EWCA 4UIZA 5H1VA 4YYJA 5A7CA 4C67A 5E74A 5CUCA 5LJ2A 5E73A 4WHUA 3O37A 5ACYA 5ENEA 1E6IA 4LZ2A 5C7NA 4YYGA 4NXJA 4BW2A 5EV9A 5I7XA 5I29A 5K29A 2YELA 4QSTA 2YEMA 4QSXA 4QC1A 4YATA 5DW2A 5CFWA 4NRCA 5E0RA 5D3LA 5F36A 5CUGA 3K2JA 4O7EA 4NR4A 3LJWA 4UYDA 4UIVA 4PTBA 4A9JA 5FE9A 5FE6A 4Z6HA 4CUUA 5EK9A 5DX4A 3UV5A 4J0RA 5D26A 4QB3A 4HXRA 2DKWA 2RNXA 4KV1A 4BJXA 3O35A 5DYCA 2E7OA 5I7YA 5A81A 2DVRA 4NYVA 3DAIA 5LUUA 4NYXA 4C66A 5IGLA 5FE3A 4LYSA 5EA1A 4WHWA 5A5SA 2D9EA 5A82A 4Z93A 4X2IA 5LJ1A 5E3DA 2DWWA 5J0DA 4XYAA 2OO1A 3UV4A 2YYNA 3U5MA 5A5NA 5EWHA 3MB3A 4A9LA 5CQTA 2RI7A 4NRAA 5EPSA 2I7KA 4XY8A 4NR9A 4YBSA 3I3JA 4UITA 5EP7A 3IU5A 5F5ZA 4QUTA 5DBMA 4TQNA 5A5RA 4NS5A 3Q2FA 5EICA 4LDFA 3G0LA 4LZRA 4A9HA 5EQ1A 5F2PA 4YYMA 4ZC9A 5A85A 5LKUA 4LZSA 5D24A 5DLZA 3P5OA 2R0VA 4QSQA 5IGMA 5E9VA 4OUFA 4TT6A 5FDZA 2R0YA 5JWMA 5H1TA 4PCIA 5D3HA 4CURA 4QSSA 2DVVA 4TS8A 4N4IA 5ENCA 4TT2A 3O36A 4WIVA 4NQMA 4YYHA 4CUSA 4NYWA 4MENA 5D3TA 5CTLA 3U5OA 4CUPA 4HXPA 5FE8A 4PY6A 3RCWA 4YABA 5H85A 5DKDA 5HLSA 4ZQLA 4LYWA 4ZW1A 5DYAA 4KV4A 4ALGA 5EGUA 5FG5A 4IR5A 4A9KA 4DONA 4IOQA 4CUQA 5D3PA 3U5PA 5L99A 5LKZA 5BT3A 5IBNA 2G4AA 3AQAA 4O7CA 3QZSA 5BT5A 5CU8A 5KTXA 5E3GA 5D3SA 5L8TA 1JSPB 3D7CA 3ONIA 3UV2A 2LSPB 5LJ0A 5DLXA 4YAXA 3U5JA 5DYXA 2YEKA 5L96A 5I88A 4YYIA 2KTBB 2OSSA 5CQ7A 4YH3A 4NRBA 4QBMA 5CQ6A 4YADA 5HJCA 4CUTA 4MR5A 4F3IA 2YQDA 2I8NA 4YYDA 2NXBA 4PKLA 2L85A 3P1FA 4LR6A 4HXKA 5I86A 5ENFA 5CGPA 5FH8A 5FE0A 5E9YA 5CPEA 5FH6A 5EVAA 5KTUA 2FSAA 5HRVA 5CQ4A 4TZ8A 4BW3A 4IR3A 4HXNA 4TYLA 4Z6IA 5FFWA 4UYEA 3UW9A 4O7AA 4O70A 4QSRA 4QNSA 5CUBA 5DFDA 5F61A 5CS8A 5HQ5A 4NUDA 5G4SA 4O7BA 4QSPA 4KCXA 4MEPA 5E9LA 5L8UA 2D82A 3MQMA 5ENBA 4HBWA 5ETBA 2WP2A 2RO1A 5DYUA 5II2A 3TLPA 4N4FA 5KTWA 5I1QA 4IR6A 4A9FA 4XUBA 4Y03A 5FE4A 5BT4A 4QEWA 5TB6A 4YY6A 1F68A 5FE5A 5KHMA 4NUEA 2F6JA 3IU6A 4UYGA 4HXSA 4A9IA 5CRZA 5E7DA 4Q0OA 4A9NA 4Q0NA 5C4QA 4J3IA 5C8GA 4ALHA 3HMFA 4O78A 2DVSA 1WUMA 5IG6A 4AKNA 4A9EA 5E9MA 2YDWA 4YBTA 3JVMA 5TCMA 3QZTA 5CUEA 2F6NA 4N4GA 5CQ8A 4O71A 5CZGA 5D25A 4QUUA 5EPRA 4QY4A 4HXOA 4OGIA 4NR8A 4YC9A 5A5PA 4J0SA 5HCLA 4PS5A 4CFKA 5HRWA 1WUGA 5G4RA 5A83A 3HMHA 2MJVB 4XY9A 5EI4A 5CUAA 1ZS5A 3HMEA 5HRXA 4QR3A 5FH7A 4YY4A 5DW1A 3LQHA 5LVRA 5EM3A 4UIWA 3SVFA 4CFLA 3LQIA 5FG6A 5EWVA 2WP1A 5AD2A 3LXJA 5LVQA 4MEQA 4FLPA 5FB0A 4YH4A 1JM4B 5KO4A 3S92A 3JVKA 5EWDA 5EPBA 4IORA 5F60A 4A9MA 4N4HA 5AD3A 4GPJA 5KU3A 5HFQA 4O75A 4MR3A 5H1UA 5EU1A 4UYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAD A;  3MXF A;  5L98 A;  2R0S A;  4O72 A;  4IR4 A;  5CY9 A;  4NR6 A;  4UYF B;  3ZYU A;  2L5E A;  4YYK A;  5HM0 A;  3G0J A;  5EIS A;  5C85 A;  3P1D A;  4QR5 A;  3UVY A;  2H60 A;  3DWY A;  5I40 A;  4J1P A;  3U5L A;  4QYL A;  5HEN A;  4UIY A;  5FE7 A;  5COI A;  4HBV A;  4LRG A;  5II1 A;  4RVR A;  3S91 A;  4UIU A;  5FFY A;  1EQF A;  5ENJ A;  4QYD A;  5HQ7 A;  5DFC A;  5E9K A;  5F3A A;  1N72 A;  5F1L A;  4BHW A;  4QEV A;  5C87 A;  5IID A;  2RNW A;  4MEO A;  4BW4 A;  5HFR A;  4XUA A;  3LQJ A;  5FE2 A;  4N3W A;  2OUO A;  5ENH A;  5F25 A;  3MB4 A;  3O34 A;  4O74 A;  2DVQ A;  4PCE A;  5ETD A;  4TT4 A;  3MUK A;  4QSW A;  5AME A;  4E96 A;  4QSU A;  5I80 A;  3P1C A;  4LC2 A;  4YK0 A;  4NQN A;  5F63 A;  4HXM A;  2GRC A;  5D3R A;  4HBY A;  5D7X A;  2L84 A;  4O7F A;  3JVJ A;  3QZV A;  5HEM A;  5F62 A;  3MUL A;  4Z1Q A;  5I89 A;  3U5K A;  5CP5 A;  5FFV A;  3U5N A;  2E7N A;  5DY7 A;  4TZ2 A;  4UIX A;  5DKC A;  5CUD A;  4MR4 A;  2RS9 B;  2RNY A;  3GG3 A;  1X0J A;  3JVL A;  4NR5 A;  3SVH A;  5ENG A;  3UVX A;  5D3J A;  4QZS A;  5HEL A;  5EWW A;  4OGJ A;  4TTE A;  4BW1 A;  5FB1 A;  5ENI A;  5IGN A;  5F1H A;  5LKT A;  5IGK A;  5LKX A;  2R10 A;  5D3N A;  4O76 A;  4QSV A;  2DAT A;  2RFJ A;  4O77 A;  3UVD A;  4QC3 A;  5E9I A;  4HXL A;  5CQ3 A;  3Q2E A;  4CLB A;  5D0C A;  4TU4 A;  5A5Q A;  2YW5 A;  4IOO A;  4NUC A;  4YBM A;  5HQ6 A;  3P1E A;  5JI8 A;  3O33 A;  3SVG A;  3UVW A;  3FKM X;  5I83 A;  5AMF A;  2E3K A;  5CQ5 A;  2N9G A;  3NXB A;  5CQA A;  5A5O A;  4NR7 A;  5C89 A;  4TU6 A;  4Z1S A;  5FG4 A;  4MR6 A;  4YYN A;  4UYH A;  5FE1 A;  4CL9 A;  5FBX A;  4LYI A;  5DFB A;  4HBX A;  4QEU A;  4A9O A;  5L97 A;  4QR4 A;  5CRM A;  5DKH A;  5EWC A;  4UIZ A;  5H1V A;  4YYJ A;  5A7C A;  4C67 A;  5E74 A;  5CUC A;  5LJ2 A;  5E73 A;  4WHU A;  3O37 A;  5ACY A;  5ENE A;  1E6I A;  4LZ2 A;  5C7N A;  4YYG A;  4NXJ A;  4BW2 A;  5EV9 A;  5I7X A;  5I29 A;  5K29 A;  2YEL A;  4QST A;  2YEM A;  4QSX A;  4QC1 A;  4YAT A;  5DW2 A;  5CFW A;  4NRC A;  5E0R A;  5D3L A;  5F36 A;  5CUG A;  3K2J A;  4O7E A;  4NR4 A;  3LJW A;  4UYD A;  4UIV A;  4PTB A;  4A9J A;  5FE9 A;  5FE6 A;  4Z6H A;  4CUU A;  5EK9 A;  5DX4 A;  3UV5 A;  4J0R A;  5D26 A;  4QB3 A;  4HXR A;  2DKW A;  2RNX A;  4KV1 A;  4BJX A;  3O35 A;  5DYC A;  2E7O A;  5I7Y A;  5A81 A;  2DVR A;  4NYV A;  3DAI A;  5LUU A;  4NYX A;  4C66 A;  5IGL A;  5FE3 A;  4LYS A;  5EA1 A;  4WHW A;  5A5S A;  2D9E A;  5A82 A;  4Z93 A;  4X2I A;  5LJ1 A;  5E3D A;  2DWW A;  5J0D A;  4XYA A;  2OO1 A;  3UV4 A;  2YYN A;  3U5M A;  5A5N A;  5EWH A;  3MB3 A;  4A9L A;  5CQT A;  2RI7 A;  4NRA A;  5EPS A;  2I7K A;  4XY8 A;  4NR9 A;  4YBS A;  3I3J A;  4UIT A;  5EP7 A;  3IU5 A;  5F5Z A;  4QUT A;  5DBM A;  4TQN A;  5A5R A;  4NS5 A;  3Q2F A;  5EIC A;  4LDF A;  3G0L A;  4LZR A;  4A9H A;  5EQ1 A;  5F2P A;  4YYM A;  4ZC9 A;  5A85 A;  5LKU A;  4LZS A;  5D24 A;  5DLZ A;  3P5O A;  2R0V A;  4QSQ A;  5IGM A;  5E9V A;  4OUF A;  4TT6 A;  5FDZ A;  2R0Y A;  5JWM A;  5H1T A;  4PCI A;  5D3H A;  4CUR A;  4QSS A;  2DVV A;  4TS8 A;  4N4I A;  5ENC A;  4TT2 A;  3O36 A;  4WIV A;  4NQM A;  4YYH A;  4CUS A;  4NYW A;  4MEN A;  5D3T A;  5CTL A;  3U5O A;  4CUP A;  4HXP A;  5FE8 A;  4PY6 A;  3RCW A;  4YAB A;  5H85 A;  5DKD A;  5HLS A;  4ZQL A;  4LYW A;  4ZW1 A;  5DYA A;  4KV4 A;  4ALG A;  5EGU A;  5FG5 A;  4IR5 A;  4A9K A;  4DON A;  4IOQ A;  4CUQ A;  5D3P A;  3U5P A;  5L99 A;  5LKZ A;  5BT3 A;  5IBN A;  2G4A A;  3AQA A;  4O7C A;  3QZS A;  5BT5 A;  5CU8 A;  5KTX A;  5E3G A;  5D3S A;  5L8T A;  1JSP B;  3D7C A;  3ONI A;  3UV2 A;  2LSP B;  5LJ0 A;  5DLX A;  4YAX A;  3U5J A;  5DYX A;  2YEK A;  5L96 A;  5I88 A;  4YYI A;  2KTB B;  2OSS A;  5CQ7 A;  4YH3 A;  4NRB A;  4QBM A;  5CQ6 A;  4YAD A;  5HJC A;  4CUT A;  4MR5 A;  4F3I A;  2YQD A;  2I8N A;  4YYD A;  2NXB A;  4PKL A;  2L85 A;  3P1F A;  4LR6 A;  4HXK A;  5I86 A;  5ENF A;  5CGP A;  5FH8 A;  5FE0 A;  5E9Y A;  5CPE A;  5FH6 A;  5EVA A;  5KTU A;  2FSA A;  5HRV A;  5CQ4 A;  4TZ8 A;  4BW3 A;  4IR3 A;  4HXN A;  4TYL A;  4Z6I A;  5FFW A;  4UYE A;  3UW9 A;  4O7A A;  4O70 A;  4QSR A;  4QNS A;  5CUB A;  5DFD A;  5F61 A;  5CS8 A;  5HQ5 A;  4NUD A;  5G4S A;  4O7B A;  4QSP A;  4KCX A;  4MEP A;  5E9L A;  5L8U A;  2D82 A;  3MQM A;  5ENB A;  4HBW A;  5ETB A;  2WP2 A;  2RO1 A;  5DYU A;  5II2 A;  3TLP A;  4N4F A;  5KTW A;  5I1Q A;  4IR6 A;  4A9F A;  4XUB A;  4Y03 A;  5FE4 A;  5BT4 A;  4QEW A;  5TB6 A;  4YY6 A;  1F68 A;  5FE5 A;  5KHM A;  4NUE A;  2F6J A;  3IU6 A;  4UYG A;  4HXS A;  4A9I A;  5CRZ A;  5E7D A;  4Q0O A;  4A9N A;  4Q0N A;  5C4Q A;  4J3I A;  5C8G A;  4ALH A;  3HMF A;  4O78 A;  2DVS A;  1WUM A;  5IG6 A;  4AKN A;  4A9E A;  5E9M A;  2YDW A;  4YBT A;  3JVM A;  5TCM A;  3QZT A;  5CUE A;  2F6N A;  4N4G A;  5CQ8 A;  4O71 A;  5CZG A;  5D25 A;  4QUU A;  5EPR A;  4QY4 A;  4HXO A;  4OGI A;  4NR8 A;  4YC9 A;  5A5P A;  4J0S A;  5HCL A;  4PS5 A;  4CFK A;  5HRW A;  1WUG A;  5G4R A;  5A83 A;  3HMH A;  2MJV B;  4XY9 A;  5EI4 A;  5CUA A;  1ZS5 A;  3HME A;  5HRX A;  4QR3 A;  5FH7 A;  4YY4 A;  5DW1 A;  3LQH A;  5LVR A;  5EM3 A;  4UIW A;  3SVF A;  4CFL A;  3LQI A;  5FG6 A;  5EWV A;  2WP1 A;  5AD2 A;  3LXJ A;  5LVQ A;  4MEQ A;  4FLP A;  5FB0 A;  4YH4 A;  1JM4 B;  5KO4 A;  3S92 A;  3JVK A;  5EWD A;  5EPB A;  4IOR A;  5F60 A;  4A9M A;  4N4H A;  5AD3 A;  4GPJ A;  5KU3 A;  5HFQ A;  4O75 A;  4MR3 A;  5H1U A;  5EU1 A;  4UYF A; 
#chains in the Genus database with same CATH topology
 3AAD A;  3MXF A;  5L98 A;  2R0S A;  4O72 A;  4IR4 A;  5CY9 A;  4NR6 A;  4UYF B;  3ZYU A;  2L5E A;  4AKG A;  4YYK A;  5HM0 A;  3G0J A;  5EIS A;  5C85 A;  3P1D A;  4QR5 A;  3UVY A;  2H60 A;  3DWY A;  5I40 A;  4J1P A;  3U5L A;  4QYL A;  5HEN A;  4UIY A;  5FE7 A;  5COI A;  4HBV A;  4LRG A;  5II1 A;  4RVR A;  3S91 A;  4UIU A;  5FFY A;  1EQF A;  5ENJ A;  4QYD A;  5HQ7 A;  5DFC A;  5E9K A;  5F3A A;  1N72 A;  5F1L A;  4BHW A;  4QEV A;  5C87 A;  5IID A;  2RNW A;  4MEO A;  4BW4 A;  5HFR A;  4XUA A;  3LQJ A;  5FE2 A;  4N3W A;  2OUO A;  5ENH A;  5F25 A;  3VKH A;  3MB4 A;  3O34 A;  4O74 A;  2DVQ A;  4PCE A;  5ETD A;  4TT4 A;  3MUK A;  4QSW A;  5AME A;  4E96 A;  4QSU A;  5I80 A;  3P1C A;  4LC2 A;  4YK0 A;  4NQN A;  5F63 A;  4HXM A;  2GRC A;  5D3R A;  4HBY A;  5D7X A;  2L84 A;  4O7F A;  3JVJ A;  3QZV A;  5HEM A;  5F62 A;  3MUL A;  4Z1Q A;  5I89 A;  3U5K A;  5CP5 A;  5FFV A;  3U5N A;  2E7N A;  5DY7 A;  4TZ2 A;  4UIX A;  5DKC A;  5CUD A;  4MR4 A;  2RS9 B;  2RNY A;  3GG3 A;  1X0J A;  3JVL A;  4NR5 A;  3SVH A;  5ENG A;  3UVX A;  5D3J A;  4QZS A;  5HEL A;  5EWW A;  4OGJ A;  4TTE A;  4BW1 A;  5FB1 A;  5ENI A;  5IGN A;  5F1H A;  5LKT A;  5IGK A;  5LKX A;  2R10 A;  5D3N A;  4O76 A;  4QSV A;  2DAT A;  2RFJ A;  4O77 A;  3UVD A;  4QC3 A;  5E9I A;  4HXL A;  1PUO A;  5CQ3 A;  3Q2E A;  4CLB A;  5D0C A;  4TU4 A;  5A5Q A;  2YW5 A;  4IOO A;  4NUC A;  4YBM A;  5HQ6 A;  3P1E A;  5JI8 A;  3O33 A;  3SVG A;  3UVW A;  3FKM X;  5I83 A;  5AMF A;  2E3K A;  5CQ5 A;  2N9G A;  3NXB A;  5CQA A;  5A5O A;  4NR7 A;  5C89 A;  4TU6 A;  4Z1S A;  5FG4 A;  4MR6 A;  4YYN A;  4UYH A;  5FE1 A;  4CL9 A;  5FBX A;  4LYI A;  5DFB A;  4HBX A;  4QEU A;  4A9O A;  5L97 A;  4QR4 A;  5CRM A;  5DKH A;  5EWC A;  4UIZ A;  5H1V A;  4YYJ A;  5A7C A;  4C67 A;  5E74 A;  5CUC A;  5LJ2 A;  5E73 A;  4WHU A;  4AI6 A;  3O37 A;  5ACY A;  5ENE A;  1E6I A;  4LZ2 A;  2EJN A;  5C7N A;  4YYG A;  4NXJ A;  4BW2 A;  1ZKR A;  5EV9 A;  5I7X A;  5I29 A;  5K29 A;  2YEL A;  4QST A;  2YEM A;  4QSX A;  4QC1 A;  4YAT A;  5DW2 A;  5CFW A;  4NRC A;  5E0R A;  5D3L A;  5F36 A;  5CUG A;  3K2J A;  4O7E A;  4NR4 A;  3LJW A;  4UYD A;  4UIV A;  4PTB A;  4A9J A;  5FE9 A;  3D1B A;  5FE6 A;  4Z6H A;  4CUU A;  5EK9 A;  5DX4 A;  3UV5 A;  4J0R A;  5D26 A;  4QB3 A;  4HXR A;  2DKW A;  2RNX A;  4KV1 A;  4BJX A;  3VKG A;  3O35 A;  5DYC A;  2E7O A;  5I7Y A;  5A81 A;  2DVR A;  4NYV A;  3DAI A;  5LUU A;  4NYX A;  3ERR A;  4C66 A;  5IGL A;  5FE3 A;  4LYS A;  5EA1 A;  4WHW A;  4AKI A;  5A5S A;  2D9E A;  5A82 A;  4Z93 A;  4X2I A;  5LJ1 A;  5E3D A;  2DWW A;  5J0D A;  4XYA A;  2OO1 A;  3UV4 A;  2YYN A;  3U5M A;  5A5N A;  5EWH A;  3MB3 A;  4A9L A;  5CQT A;  2RI7 A;  4NRA A;  5EPS A;  2I7K A;  4XY8 A;  4NR9 A;  4YBS A;  3I3J A;  4UIT A;  5EP7 A;  3IU5 A;  5F5Z A;  4QUT A;  5DBM A;  4TQN A;  5A5R A;  4NS5 A;  3Q2F A;  5EIC A;  4AKH A;  4LDF A;  3G0L A;  4LZR A;  4A9H A;  5EQ1 A;  5F2P A;  4YYM A;  4ZC9 A;  5A85 A;  5LKU A;  4LZS A;  5D24 A;  5DLZ A;  3P5O A;  2R0V A;  4QSQ A;  5IGM A;  5E9V A;  4OUF A;  4TT6 A;  5FDZ A;  2R0Y A;  5JWM A;  5H1T A;  4PCI A;  5D3H A;  4CUR A;  4QSS A;  2DVV A;  4TS8 A;  4N4I A;  5ENC A;  4TT2 A;  3O36 A;  4WIV A;  4NQM A;  4YYH A;  4CUS A;  4NYW A;  4MEN A;  5D3T A;  5CTL A;  3U5O A;  4CUP A;  4HXP A;  5FE8 A;  4PY6 A;  3RCW A;  4YAB A;  5H85 A;  5DKD A;  5HLS A;  4ZQL A;  4LYW A;  4ZW1 A;  5DYA A;  4KV4 A;  4ALG A;  5EGU A;  5FG5 A;  4IR5 A;  4A9K A;  4DON A;  4IOQ A;  4CUQ A;  5D3P A;  3U5P A;  5L99 A;  5LKZ A;  5BT3 A;  5IBN A;  2G4A A;  3AQA A;  4O7C A;  3QZS A;  5BT5 A;  5CU8 A;  5KTX A;  5E3G A;  5D3S A;  3D1D A;  5L8T A;  1JSP B;  3D7C A;  3ONI A;  3UV2 A;  2LSP B;  5LJ0 A;  5DLX A;  4YAX A;  3U5J A;  5DYX A;  2YEK A;  5L96 A;  5I88 A;  4YYI A;  2KTB B;  2OSS A;  5CQ7 A;  4YH3 A;  4NRB A;  4QBM A;  5CQ6 A;  4YAD A;  5HJC A;  4CUT A;  4MR5 A;  4F3I A;  2YQD A;  2I8N A;  4YYD A;  2NXB A;  4PKL A;  2L85 A;  3P1F A;  4LR6 A;  4HXK A;  5I86 A;  5ENF A;  5CGP A;  5FH8 A;  5FE0 A;  5E9Y A;  5CPE A;  5FH6 A;  5EVA A;  5KTU A;  2FSA A;  5HRV A;  5CQ4 A;  4TZ8 A;  4BW3 A;  4IR3 A;  4HXN A;  4TYL A;  4Z6I A;  5FFW A;  4UYE A;  3UW9 A;  4O7A A;  4O70 A;  4QSR A;  4QNS A;  5CUB A;  5DFD A;  5F61 A;  5CS8 A;  5HQ5 A;  4NUD A;  5G4S A;  4O7B A;  4QSP A;  4KCX A;  4MEP A;  5E9L A;  5L8U A;  2D82 A;  3MQM A;  5ENB A;  4HBW A;  5ETB A;  2WP2 A;  2RO1 A;  5DYU A;  5II2 A;  3TLP A;  4N4F A;  5KTW A;  5I1Q A;  4IR6 A;  4A9F A;  4XUB A;  4Y03 A;  5FE4 A;  5BT4 A;  4QEW A;  5TB6 A;  4YY6 A;  1F68 A;  5FE5 A;  5KHM A;  4NUE A;  2F6J A;  3IU6 A;  4UYG A;  4HXS A;  4A9I A;  5CRZ A;  5E7D A;  4Q0O A;  4A9N A;  4Q0N A;  5C4Q A;  4J3I A;  5C8G A;  4ALH A;  3HMF A;  4O78 A;  2DVS A;  1WUM A;  5IG6 A;  4AKN A;  4A9E A;  5E9M A;  2YDW A;  4YBT A;  3JVM A;  5TCM A;  3QZT A;  5CUE A;  2F6N A;  4N4G A;  5CQ8 A;  4O71 A;  5CZG A;  5D25 A;  4QUU A;  5EPR A;  4QY4 A;  4HXO A;  4OGI A;  4NR8 A;  4YC9 A;  5A5P A;  4J0S A;  5HCL A;  4PS5 A;  4CFK A;  5HRW A;  1WUG A;  5G4R A;  5A83 A;  3HMH A;  2MJV B;  4XY9 A;  5EI4 A;  5CUA A;  1ZS5 A;  3HME A;  5HRX A;  4QR3 A;  5FH7 A;  4YY4 A;  5DW1 A;  3LQH A;  5LVR A;  5EM3 A;  4UIW A;  3SVF A;  4CFL A;  3LQI A;  5FG6 A;  5EWV A;  2WP1 A;  5AD2 A;  3LXJ A;  5LVQ A;  4MEQ A;  4FLP A;  5FB0 A;  4YH4 A;  1JM4 B;  5KO4 A;  3S92 A;  3JVK A;  5EWD A;  5EPB A;  4IOR A;  5F60 A;  4A9M A;  4N4H A;  5AD3 A;  4GPJ A;  5KU3 A;  5HFQ A;  4O75 A;  4MR3 A;  5H1U A;  5EU1 A;  4UYF A; 
#chains in the Genus database with same CATH homology
 3AAD A;  3MXF A;  5L98 A;  2R0S A;  4O72 A;  4IR4 A;  5CY9 A;  4NR6 A;  4UYF B;  3ZYU A;  2L5E A;  4YYK A;  5HM0 A;  3G0J A;  5EIS A;  5C85 A;  3P1D A;  4QR5 A;  3UVY A;  2H60 A;  3DWY A;  5I40 A;  4J1P A;  3U5L A;  4QYL A;  5HEN A;  4UIY A;  5FE7 A;  5COI A;  4HBV A;  4LRG A;  5II1 A;  4RVR A;  3S91 A;  4UIU A;  5FFY A;  1EQF A;  5ENJ A;  4QYD A;  5HQ7 A;  5DFC A;  5E9K A;  5F3A A;  1N72 A;  5F1L A;  4BHW A;  4QEV A;  5C87 A;  5IID A;  2RNW A;  4MEO A;  4BW4 A;  5HFR A;  4XUA A;  3LQJ A;  5FE2 A;  4N3W A;  2OUO A;  5ENH A;  5F25 A;  3MB4 A;  3O34 A;  4O74 A;  2DVQ A;  4PCE A;  5ETD A;  4TT4 A;  3MUK A;  4QSW A;  5AME A;  4E96 A;  4QSU A;  5I80 A;  3P1C A;  4LC2 A;  4YK0 A;  4NQN A;  5F63 A;  4HXM A;  2GRC A;  5D3R A;  4HBY A;  5D7X A;  2L84 A;  4O7F A;  3JVJ A;  3QZV A;  5HEM A;  5F62 A;  3MUL A;  4Z1Q A;  5I89 A;  3U5K A;  5CP5 A;  5FFV A;  3U5N A;  2E7N A;  5DY7 A;  4TZ2 A;  4UIX A;  5DKC A;  5CUD A;  4MR4 A;  2RS9 B;  2RNY A;  3GG3 A;  1X0J A;  3JVL A;  4NR5 A;  3SVH A;  5ENG A;  3UVX A;  5D3J A;  4QZS A;  5HEL A;  5EWW A;  4OGJ A;  4TTE A;  4BW1 A;  5FB1 A;  5ENI A;  5IGN A;  5F1H A;  5LKT A;  5IGK A;  5LKX A;  2R10 A;  5D3N A;  4O76 A;  4QSV A;  2DAT A;  2RFJ A;  4O77 A;  3UVD A;  4QC3 A;  5E9I A;  4HXL A;  5CQ3 A;  3Q2E A;  4CLB A;  5D0C A;  4TU4 A;  5A5Q A;  2YW5 A;  4IOO A;  4NUC A;  4YBM A;  5HQ6 A;  3P1E A;  5JI8 A;  3O33 A;  3SVG A;  3UVW A;  3FKM X;  5I83 A;  5AMF A;  2E3K A;  5CQ5 A;  2N9G A;  3NXB A;  5CQA A;  5A5O A;  4NR7 A;  5C89 A;  4TU6 A;  4Z1S A;  5FG4 A;  4MR6 A;  4YYN A;  4UYH A;  5FE1 A;  4CL9 A;  5FBX A;  4LYI A;  5DFB A;  4HBX A;  4QEU A;  4A9O A;  5L97 A;  4QR4 A;  5CRM A;  5DKH A;  5EWC A;  4UIZ A;  5H1V A;  4YYJ A;  5A7C A;  4C67 A;  5E74 A;  5CUC A;  5LJ2 A;  5E73 A;  4WHU A;  3O37 A;  5ACY A;  5ENE A;  1E6I A;  4LZ2 A;  5C7N A;  4YYG A;  4NXJ A;  4BW2 A;  5EV9 A;  5I7X A;  5I29 A;  5K29 A;  2YEL A;  4QST A;  2YEM A;  4QSX A;  4QC1 A;  4YAT A;  5DW2 A;  5CFW A;  4NRC A;  5E0R A;  5D3L A;  5F36 A;  5CUG A;  3K2J A;  4O7E A;  4NR4 A;  3LJW A;  4UYD A;  4UIV A;  4PTB A;  4A9J A;  5FE9 A;  5FE6 A;  4Z6H A;  4CUU A;  5EK9 A;  5DX4 A;  3UV5 A;  4J0R A;  5D26 A;  4QB3 A;  4HXR A;  2DKW A;  2RNX A;  4KV1 A;  4BJX A;  3O35 A;  5DYC A;  2E7O A;  5I7Y A;  5A81 A;  2DVR A;  4NYV A;  3DAI A;  5LUU A;  4NYX A;  4C66 A;  5IGL A;  5FE3 A;  4LYS A;  5EA1 A;  4WHW A;  5A5S A;  2D9E A;  5A82 A;  4Z93 A;  4X2I A;  5LJ1 A;  5E3D A;  2DWW A;  5J0D A;  4XYA A;  2OO1 A;  3UV4 A;  2YYN A;  3U5M A;  5A5N A;  5EWH A;  3MB3 A;  4A9L A;  5CQT A;  2RI7 A;  4NRA A;  5EPS A;  2I7K A;  4XY8 A;  4NR9 A;  4YBS A;  3I3J A;  4UIT A;  5EP7 A;  3IU5 A;  5F5Z A;  4QUT A;  5DBM A;  4TQN A;  5A5R A;  4NS5 A;  3Q2F A;  5EIC A;  4LDF A;  3G0L A;  4LZR A;  4A9H A;  5EQ1 A;  5F2P A;  4YYM A;  4ZC9 A;  5A85 A;  5LKU A;  4LZS A;  5D24 A;  5DLZ A;  3P5O A;  2R0V A;  4QSQ A;  5IGM A;  5E9V A;  4OUF A;  4TT6 A;  5FDZ A;  2R0Y A;  5JWM A;  5H1T A;  4PCI A;  5D3H A;  4CUR A;  4QSS A;  2DVV A;  4TS8 A;  4N4I A;  5ENC A;  4TT2 A;  3O36 A;  4WIV A;  4NQM A;  4YYH A;  4CUS A;  4NYW A;  4MEN A;  5D3T A;  5CTL A;  3U5O A;  4CUP A;  4HXP A;  5FE8 A;  4PY6 A;  3RCW A;  4YAB A;  5H85 A;  5DKD A;  5HLS A;  4ZQL A;  4LYW A;  4ZW1 A;  5DYA A;  4KV4 A;  4ALG A;  5EGU A;  5FG5 A;  4IR5 A;  4A9K A;  4DON A;  4IOQ A;  4CUQ A;  5D3P A;  3U5P A;  5L99 A;  5LKZ A;  5BT3 A;  5IBN A;  2G4A A;  3AQA A;  4O7C A;  3QZS A;  5BT5 A;  5CU8 A;  5KTX A;  5E3G A;  5D3S A;  5L8T A;  1JSP B;  3D7C A;  3ONI A;  3UV2 A;  2LSP B;  5LJ0 A;  5DLX A;  4YAX A;  3U5J A;  5DYX A;  2YEK A;  5L96 A;  5I88 A;  4YYI A;  2KTB B;  2OSS A;  5CQ7 A;  4YH3 A;  4NRB A;  4QBM A;  5CQ6 A;  4YAD A;  5HJC A;  4CUT A;  4MR5 A;  4F3I A;  2YQD A;  2I8N A;  4YYD A;  2NXB A;  4PKL A;  2L85 A;  3P1F A;  4LR6 A;  4HXK A;  5I86 A;  5ENF A;  5CGP A;  5FH8 A;  5FE0 A;  5E9Y A;  5CPE A;  5FH6 A;  5EVA A;  5KTU A;  2FSA A;  5HRV A;  5CQ4 A;  4TZ8 A;  4BW3 A;  4IR3 A;  4HXN A;  4TYL A;  4Z6I A;  5FFW A;  4UYE A;  3UW9 A;  4O7A A;  4O70 A;  4QSR A;  4QNS A;  5CUB A;  5DFD A;  5F61 A;  5CS8 A;  5HQ5 A;  4NUD A;  5G4S A;  4O7B A;  4QSP A;  4KCX A;  4MEP A;  5E9L A;  5L8U A;  2D82 A;  3MQM A;  5ENB A;  4HBW A;  5ETB A;  2WP2 A;  2RO1 A;  5DYU A;  5II2 A;  3TLP A;  4N4F A;  5KTW A;  5I1Q A;  4IR6 A;  4A9F A;  4XUB A;  4Y03 A;  5FE4 A;  5BT4 A;  4QEW A;  5TB6 A;  4YY6 A;  1F68 A;  5FE5 A;  5KHM A;  4NUE A;  2F6J A;  3IU6 A;  4UYG A;  4HXS A;  4A9I A;  5CRZ A;  5E7D A;  4Q0O A;  4A9N A;  4Q0N A;  5C4Q A;  4J3I A;  5C8G A;  4ALH A;  3HMF A;  4O78 A;  2DVS A;  1WUM A;  5IG6 A;  4AKN A;  4A9E A;  5E9M A;  2YDW A;  4YBT A;  3JVM A;  5TCM A;  3QZT A;  5CUE A;  2F6N A;  4N4G A;  5CQ8 A;  4O71 A;  5CZG A;  5D25 A;  4QUU A;  5EPR A;  4QY4 A;  4HXO A;  4OGI A;  4NR8 A;  4YC9 A;  5A5P A;  4J0S A;  5HCL A;  4PS5 A;  4CFK A;  5HRW A;  1WUG A;  5G4R A;  5A83 A;  3HMH A;  2MJV B;  4XY9 A;  5EI4 A;  5CUA A;  1ZS5 A;  3HME A;  5HRX A;  4QR3 A;  5FH7 A;  4YY4 A;  5DW1 A;  3LQH A;  5LVR A;  5EM3 A;  4UIW A;  3SVF A;  4CFL A;  3LQI A;  5FG6 A;  5EWV A;  2WP1 A;  5AD2 A;  3LXJ A;  5LVQ A;  4MEQ A;  4FLP A;  5FB0 A;  4YH4 A;  1JM4 B;  5KO4 A;  3S92 A;  3JVK A;  5EWD A;  5EPB A;  4IOR A;  5F60 A;  4A9M A;  4N4H A;  5AD3 A;  4GPJ A;  5KU3 A;  5HFQ A;  4O75 A;  4MR3 A;  5H1U A;  5EU1 A;  4UYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...