5EQ1A

Crystal structure of the human brpf1 bromodomain in complex with seed12
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5eq1A00
5EWCA 4HXRA 5DFCA 5D3NA 5KTWA 2RI7A 4YYMA 4YAXA 4CL9A 5KO4A 5EICA 4BW4A 4ZC9A 1X0JA 4HXKA 4NRBA 2RNYA 2RO1A 3MXFA 4QSQA 4QSRA 4QUUA 4HBVA 4IR5A 4NR6A 5LKTA 4HXMA 4QEVA 5CUAA 5CRMA 5A85A 4TTEA 5ENFA 2OSSA 4HXLA 3UV2A 5BT3A 5CQ7A 4QSXA 5II2A 2DVRA 5BT5A 4BW1A 5FE0A 5CPEA 3MQMA 5EWVA 5C7NA 5ENJA 4CURA 4YH4A 3K2JA 4KV4A 2DATA 5HENA 3U5KA 2FSAA 5EK9A 4O71A 4YBTA 2NXBA 4FLPA 5IGLA 4O70A 4TT2A 4UYEA 5AMFA 4QYDA 5K29A 3UW9A 5DFBA 4TU6A 5E3DA 4A9IA 5BT4A 5LKXA 4PY6A 3DAIA 3Q2EA 4A9LA 5FE9A 2YELA 2I7KA 5L98A 5I83A 5LKZA 4O7CA 2YEMA 5E9LA 4UITA 3AADA 2F6JA 5EP7A 5CU8A 5E9IA 3O35A 4MR3A 5HEMA 2WP2A 4NRAA 4O7AA 5ENIA 5EV9A 4XY9A 4J3IA 2OO1A 5D0CA 1E6IA 4C66A 4CUPA 1EQFA 4NUCA 5A5SA 4HBWA 5F1LA 3MULA 3O34A 4NYWA 3HMEA 4J0SA 4Z1QA 3U5MA 5CQ5A 2DVSA 4N4IA 4N3WA 4PS5A 5EPRA 5G4SA 5HCLA 5HRXA 2L5EA 3O36A 5F25A 4LYSA 3JVKA 4UYDA 5AMEA 5I88A 4QC1A 4LZSA 5D25A 4LRGA 2E3KA 4NR5A 5F5ZA 4ALHA 4O74A 3Q2FA 5C87A 4YYHA 5I89A 5D3TA 4CLBA 4HXPA 5D3PA 1JSPB 5FDZA 4QY4A 3S91A 5ETBA 3RCWA 5DLXA 5HRVA 3UVWA 5EI4A 4NXJA 5KTXA 5HQ6A 4NYVA 5L97A 4WHUA 5LJ0A 5LKUA 5E9KA 5DKCA 4HXOA 4O72A 2RNWA 5AD3A 5A83A 5C4QA 5I86A 5CQ6A 4F3IA 4Z93A 3U5NA 5D3LA 2YEKA 4IR3A 5ETDA 2WP1A 5FB1A 4X2IA 5E7DA 4O77A 3ZYUA 4NS5A 3QZVA 4YK0A 2LSPB 3JVLA 4BJXA 3I3JA 3S92A 4QNSA 3SVGA 2R0YA 4QSVA 5KTUA 4CUSA 4UIVA 5EPSA 5FE5A 5CRZA 2N9GA 4RVRA 4Q0OA 4AKNA 5ENEA 4IOOA 2F6NA 3O33A 5IG6A 5L99A 5TB6A 5DKHA 3SVHA 5EWDA 5I40A 5H1VA 5LJ1A 5D3HA 3P5OA 2RFJA 5FE1A 2YQDA 4QR3A 3P1DA 2DVQA 2I8NA 5F61A 4A9MA 4XY8A 5CUCA 5E9YA 5ACYA 3MB4A 4QC3A 4WIVA 5D24A 4IOQA 3NXBA 2RNXA 3P1CA 5CP5A 5CZGA 5EU1A 5HQ7A 4TQNA 4Y03A 5FG4A 3JVMA 4QSSA 4YYDA 4TU4A 5CQAA 4YYKA 5CQ3A 5H85A 4J0RA 4CUQA 5A5RA 4NR8A 5CTLA 5F63A 3UVYA 4A9FA 1N72A 3UVDA 5D3JA 5E9VA 3G0JA 5H1TA 5A5PA 4NYXA 5E73A 3LQJA 5FH8A 4NR9A 4YABA 4UIZA 2YYNA 4HBYA 3IU6A 4QR5A 4HBXA 5CUEA 5DBMA 5D7XA 4MEPA 5I80A 4N4FA 3U5OA 4CUTA 4QUTA 3UV5A 4BW3A 2D82A 5CUGA 5I7XA 4N4HA 4LR6A 3LJWA 5HJCA 4YYGA 5CQTA 2E7NA 5HM0A 3HMHA 5IGKA 3U5PA 2GRCA 4TS8A 5LJ2A 5HFQA 4N4GA 5F2PA 1JM4B 3JVJA 5EPBA 5FE8A 4HXSA 4Z1SA 5KHMA 2DKWA 3HMFA 3QZSA 5A5NA 2DWWA 5J0DA 5I29A 4TT4A 2L85A 1WUGA 4MR6A 5F60A 4E96A 5DKDA 4O78A 5JI8A 2RS9B 4O7FA 4TYLA 4WHWA 3UVXA 5AD2A 4PTBA 4LDFA 4NUEA 4ZW1A 4NUDA 5FG5A 4Z6HA 5FE7A 4TZ8A 5IBNA 4UIWA 3IU5A 4NRCA 4ALGA 4YADA 4UYFA 4O75A 2E7OA 4OGJA 3UV4A 4NR7A 5DYXA 1WUMA 5EM3A 4KCXA 4YH3A 4OGIA 4Z6IA 5LUUA 5F62A 3D7CA 5DW2A 4YY6A 2H60A 5DLZA 4A9EA 4NQMA 2G4AA 4NQNA 5C89A 3U5JA 5FFWA 2OUOA 2DVVA 5A5OA 2YW5A 5COIA 2MJVB 3U5LA 4YATA 5KU3A 4HXNA 4Q0NA 4QSPA 5IGNA 4YBSA 4GPJA 4IR4A 5DW1A 3P1EA 3DWYA 3QZTA 4QZSA 4C67A 5FG6A 3SVFA 5IGMA 4LC2A 5E3GA 5FFYA 5CFWA 4QR4A 5LVRA 5II1A 4TZ2A 5I7YA 5DX4A 4UIUA 4UIXA 5EQ1A 4XUBA 4LYWA 4KV1A 5FBXA 5DYAA 4PCIA 5DFDA 4MEOA 5FH6A 4NR4A 4YBMA 4IR6A 5ENHA 5EVAA 4YYNA 5A7CA 4A9HA 4MR5A 4J1PA 5EWHA 4LZRA 4PCEA 5LVQA 5DYUA 3LQIA 5CQ8A 5EWWA 4LYIA 4YY4A 5F3AA 4ZQLA 5I1QA 5C8GA 4O76A 4YC9A 1ZS5A 4UYHA 4A9KA 5E74A 5CGPA 3O37A 5CY9A 4OUFA 5FB0A 5CQ4A 3GG3A 4QSWA 4YYJA 5HFRA 3P1FA 5FE2A 5HLSA 4O7BA 4QBMA 4QB3A 4QYLA 3ONIA 5CS8A 4MR4A 2R0VA 4IORA 4QEUA 5ENGA 4UYGA 5A5QA 5FFVA 4QEWA 4UIYA 5L8TA 5CUBA 2R10A 4MEQA 5EA1A 4TT6A 4CUUA 5IIDA 3G0LA 5HELA 4UYFB 5FE3A 5G4RA 4MENA 5DY7A 3MB3A 4YYIA 5EGUA 2KTBB 4DONA 4A9JA 3FKMX 4A9NA 4XUAA 5D3RA 5FE6A 4QSUA 3LXJA 3MUKA 2YDWA 4XYAA 5E9MA 5FH7A 5F36A 4A9OA 5E0RA 4CFLA 4O7EA 5EISA 5HQ5A 5DYCA 5FE4A 5L8UA 4PKLA 5A81A 2D9EA 5D3SA 4BW2A 5CUDA 5L96A 5ENCA 2L84A 4QSTA 5HRWA 5JWMA 4LZ2A 5ENBA 1F68A 5H1UA 4BHWA 3LQHA 5TCMA 3AQAA 4CFKA 3TLPA 2R0SA 5F1HA 5C85A 5A82A 5D26A
chains in the Genus database with same CATH superfamily
5EWCA 4HXRA 5DFCA 2EJNA 5D3NA 5KTWA 2RI7A 4YYMA 3VKHA 4YAXA 4CL9A 5KO4A 5EICA 4BW4A 4ZC9A 1X0JA 4HXKA 4NRBA 2RNYA 2RO1A 3MXFA 4QSQA 4QSRA 4QUUA 4HBVA 4IR5A 4NR6A 5LKTA 4HXMA 4QEVA 5CUAA 5CRMA 5A85A 4TTEA 5ENFA 2OSSA 4HXLA 3UV2A 5BT3A 5CQ7A 4QSXA 5II2A 2DVRA 5BT5A 4BW1A 5FE0A 5CPEA 3MQMA 5EWVA 5C7NA 5ENJA 4CURA 4YH4A 3K2JA 4KV4A 2DATA 5HENA 3U5KA 2FSAA 5EK9A 4O71A 4YBTA 2NXBA 4FLPA 5IGLA 4O70A 4TT2A 4UYEA 5AMFA 4QYDA 5K29A 3UW9A 5DFBA 4TU6A 5E3DA 4A9IA 5BT4A 5LKXA 4PY6A 3DAIA 3Q2EA 4A9LA 5FE9A 2YELA 2I7KA 5L98A 5I83A 5LKZA 4O7CA 3ERRA 2YEMA 5E9LA 4UITA 3AADA 2F6JA 5EP7A 5CU8A 5E9IA 3O35A 4MR3A 5HEMA 2WP2A 4NRAA 4O7AA 5ENIA 5EV9A 4XY9A 4J3IA 2OO1A 5D0CA 1E6IA 4C66A 4CUPA 1EQFA 4NUCA 5A5SA 4HBWA 5F1LA 3MULA 3O34A 4NYWA 4AI6A 3HMEA 4J0SA 4Z1QA 3U5MA 5CQ5A 2DVSA 4N4IA 4N3WA 4PS5A 5EPRA 5G4SA 5HCLA 5HRXA 2L5EA 3O36A 5F25A 4LYSA 3JVKA 4UYDA 5AMEA 5I88A 4QC1A 4LZSA 5D25A 4LRGA 2E3KA 4NR5A 5F5ZA 4ALHA 4O74A 3Q2FA 5C87A 4YYHA 5I89A 5D3TA 4CLBA 4HXPA 5D3PA 1JSPB 5FDZA 4QY4A 3S91A 5ETBA 3RCWA 5DLXA 5HRVA 3UVWA 5EI4A 4NXJA 5KTXA 5HQ6A 4NYVA 5L97A 4WHUA 5LJ0A 5LKUA 5E9KA 5DKCA 4HXOA 4O72A 2RNWA 5AD3A 5A83A 5C4QA 5I86A 4AKHA 5CQ6A 4F3IA 4Z93A 3U5NA 5D3LA 2YEKA 4IR3A 5ETDA 2WP1A 5FB1A 4X2IA 5E7DA 4O77A 3ZYUA 4NS5A 3QZVA 4YK0A 2LSPB 3JVLA 4BJXA 3I3JA 3S92A 4QNSA 3SVGA 2R0YA 4QSVA 5KTUA 4CUSA 4UIVA 5EPSA 4AKGA 5FE5A 5CRZA 2N9GA 4RVRA 4Q0OA 4AKNA 5ENEA 4IOOA 2F6NA 3O33A 5IG6A 5L99A 5TB6A 5DKHA 3SVHA 5EWDA 5I40A 5H1VA 5LJ1A 4AKIA 5D3HA 3P5OA 2RFJA 5FE1A 2YQDA 4QR3A 1PUOA 3P1DA 2DVQA 2I8NA 5F61A 4A9MA 4XY8A 5CUCA 5E9YA 5ACYA 3MB4A 4QC3A 4WIVA 5D24A 4IOQA 3NXBA 2RNXA 3P1CA 5CP5A 5CZGA 5EU1A 5HQ7A 4TQNA 4Y03A 5FG4A 3JVMA 4QSSA 4YYDA 4TU4A 5CQAA 4YYKA 5CQ3A 5H85A 4J0RA 4CUQA 5A5RA 4NR8A 5CTLA 5F63A 3UVYA 4A9FA 1N72A 3UVDA 5D3JA 5E9VA 3G0JA 5H1TA 5A5PA 4NYXA 5E73A 3LQJA 5FH8A 4NR9A 4YABA 4UIZA 2YYNA 4HBYA 3IU6A 4QR5A 4HBXA 5CUEA 5DBMA 5D7XA 4MEPA 5I80A 4N4FA 3U5OA 4CUTA 4QUTA 3UV5A 4BW3A 2D82A 5CUGA 5I7XA 4N4HA 4LR6A 3LJWA 5HJCA 4YYGA 5CQTA 2E7NA 5HM0A 3HMHA 5IGKA 3U5PA 2GRCA 4TS8A 5LJ2A 5HFQA 4N4GA 5F2PA 1JM4B 3JVJA 5EPBA 5FE8A 4HXSA 4Z1SA 5KHMA 2DKWA 3HMFA 3QZSA 5A5NA 2DWWA 5J0DA 5I29A 4TT4A 2L85A 1WUGA 4MR6A 5F60A 4E96A 5DKDA 4O78A 5JI8A 2RS9B 4O7FA 4TYLA 4WHWA 3UVXA 5AD2A 4PTBA 4LDFA 4NUEA 4ZW1A 4NUDA 5FG5A 4Z6HA 5FE7A 4TZ8A 5IBNA 4UIWA 3IU5A 4NRCA 4ALGA 4YADA 4UYFA 4O75A 2E7OA 4OGJA 3UV4A 4NR7A 5DYXA 1WUMA 5EM3A 4KCXA 4YH3A 4OGIA 4Z6IA 5LUUA 5F62A 3D7CA 5DW2A 4YY6A 3D1DA 2H60A 5DLZA 4A9EA 3D1BA 2G4AA 4NQMA 4NQNA 5C89A 3U5JA 5FFWA 2OUOA 2DVVA 5A5OA 2YW5A 5COIA 2MJVB 3U5LA 4YATA 5KU3A 4HXNA 4Q0NA 4QSPA 5IGNA 4YBSA 4GPJA 4IR4A 5DW1A 3P1EA 3DWYA 3QZTA 4QZSA 4C67A 5FG6A 3SVFA 5IGMA 4LC2A 5E3GA 5FFYA 5CFWA 4QR4A 5LVRA 5II1A 4TZ2A 5I7YA 5DX4A 4UIUA 4UIXA 5EQ1A 4XUBA 4LYWA 4KV1A 5FBXA 5DYAA 4PCIA 5DFDA 1ZKRA 4MEOA 5FH6A 4NR4A 4YBMA 4IR6A 5ENHA 5EVAA 4YYNA 5A7CA 4A9HA 4MR5A 4J1PA 5EWHA 4LZRA 4PCEA 5LVQA 5DYUA 3LQIA 5CQ8A 5EWWA 4LYIA 4YY4A 5F3AA 4ZQLA 5I1QA 5C8GA 4O76A 4YC9A 1ZS5A 4UYHA 4A9KA 5E74A 5CGPA 3O37A 5CY9A 4OUFA 5FB0A 5CQ4A 3GG3A 4QSWA 4YYJA 5HFRA 3P1FA 5FE2A 5HLSA 4O7BA 4QBMA 4QB3A 4QYLA 3ONIA 5CS8A 4MR4A 3VKGA 2R0VA 4IORA 4QEUA 5ENGA 4UYGA 5A5QA 5FFVA 4QEWA 4UIYA 5L8TA 5CUBA 2R10A 4MEQA 5EA1A 4TT6A 4CUUA 5IIDA 3G0LA 5HELA 4UYFB 5FE3A 5G4RA 4MENA 5DY7A 3MB3A 4YYIA 5EGUA 2KTBB 4DONA 4A9JA 3FKMX 4A9NA 4XUAA 5D3RA 5FE6A 4QSUA 3LXJA 3MUKA 2YDWA 4XYAA 5E9MA 5FH7A 5F36A 4A9OA 5E0RA 4CFLA 4O7EA 5EISA 5HQ5A 5DYCA 5FE4A 5L8UA 4PKLA 5A81A 2D9EA 5D3SA 4BW2A 5CUDA 5L96A 5ENCA 2L84A 4QSTA 5HRWA 5JWMA 4LZ2A 5ENBA 1F68A 5H1UA 4BHWA 3LQHA 5TCMA 3AQAA 4CFKA 3TLPA 2R0SA 5F1HA 5C85A 5A82A 5D26A
chains in the Genus database with same CATH topology
5EWCA 4HXRA 5DFCA 5D3NA 5KTWA 2RI7A 4YYMA 4YAXA 4CL9A 5KO4A 5EICA 4BW4A 4ZC9A 1X0JA 4HXKA 4NRBA 2RNYA 2RO1A 3MXFA 4QSQA 4QSRA 4QUUA 4HBVA 4IR5A 4NR6A 5LKTA 4HXMA 4QEVA 5CUAA 5CRMA 5A85A 4TTEA 5ENFA 2OSSA 4HXLA 3UV2A 5BT3A 5CQ7A 4QSXA 5II2A 2DVRA 5BT5A 4BW1A 5FE0A 5CPEA 3MQMA 5EWVA 5C7NA 5ENJA 4CURA 4YH4A 3K2JA 4KV4A 2DATA 5HENA 3U5KA 2FSAA 5EK9A 4O71A 4YBTA 2NXBA 4FLPA 5IGLA 4O70A 4TT2A 4UYEA 5AMFA 4QYDA 5K29A 3UW9A 5DFBA 4TU6A 5E3DA 4A9IA 5BT4A 5LKXA 4PY6A 3DAIA 3Q2EA 4A9LA 5FE9A 2YELA 2I7KA 5L98A 5I83A 5LKZA 4O7CA 2YEMA 5E9LA 4UITA 3AADA 2F6JA 5EP7A 5CU8A 5E9IA 3O35A 4MR3A 5HEMA 2WP2A 4NRAA 4O7AA 5ENIA 5EV9A 4XY9A 4J3IA 2OO1A 5D0CA 1E6IA 4C66A 4CUPA 1EQFA 4NUCA 5A5SA 4HBWA 5F1LA 3MULA 3O34A 4NYWA 3HMEA 4J0SA 4Z1QA 3U5MA 5CQ5A 2DVSA 4N4IA 4N3WA 4PS5A 5EPRA 5G4SA 5HCLA 5HRXA 2L5EA 3O36A 5F25A 4LYSA 3JVKA 4UYDA 5AMEA 5I88A 4QC1A 4LZSA 5D25A 4LRGA 2E3KA 4NR5A 5F5ZA 4ALHA 4O74A 3Q2FA 5C87A 4YYHA 5I89A 5D3TA 4CLBA 4HXPA 5D3PA 1JSPB 5FDZA 4QY4A 3S91A 5ETBA 3RCWA 5DLXA 5HRVA 3UVWA 5EI4A 4NXJA 5KTXA 5HQ6A 4NYVA 5L97A 4WHUA 5LJ0A 5LKUA 5E9KA 5DKCA 4HXOA 4O72A 2RNWA 5AD3A 5A83A 5C4QA 5I86A 5CQ6A 4F3IA 4Z93A 3U5NA 5D3LA 2YEKA 4IR3A 5ETDA 2WP1A 5FB1A 4X2IA 5E7DA 4O77A 3ZYUA 4NS5A 3QZVA 4YK0A 2LSPB 3JVLA 4BJXA 3I3JA 3S92A 4QNSA 3SVGA 2R0YA 4QSVA 5KTUA 4CUSA 4UIVA 5EPSA 5FE5A 5CRZA 2N9GA 4RVRA 4Q0OA 4AKNA 5ENEA 4IOOA 2F6NA 3O33A 5IG6A 5L99A 5TB6A 5DKHA 3SVHA 5EWDA 5I40A 5H1VA 5LJ1A 5D3HA 3P5OA 2RFJA 5FE1A 2YQDA 4QR3A 3P1DA 2DVQA 2I8NA 5F61A 4A9MA 4XY8A 5CUCA 5E9YA 5ACYA 3MB4A 4QC3A 4WIVA 5D24A 4IOQA 3NXBA 2RNXA 3P1CA 5CP5A 5CZGA 5EU1A 5HQ7A 4TQNA 4Y03A 5FG4A 3JVMA 4QSSA 4YYDA 4TU4A 5CQAA 4YYKA 5CQ3A 5H85A 4J0RA 4CUQA 5A5RA 4NR8A 5CTLA 5F63A 3UVYA 4A9FA 1N72A 3UVDA 5D3JA 5E9VA 3G0JA 5H1TA 5A5PA 4NYXA 5E73A 3LQJA 5FH8A 4NR9A 4YABA 4UIZA 2YYNA 4HBYA 3IU6A 4QR5A 4HBXA 5CUEA 5DBMA 5D7XA 4MEPA 5I80A 4N4FA 3U5OA 4CUTA 4QUTA 3UV5A 4BW3A 2D82A 5CUGA 5I7XA 4N4HA 4LR6A 3LJWA 5HJCA 4YYGA 5CQTA 2E7NA 5HM0A 3HMHA 5IGKA 3U5PA 2GRCA 4TS8A 5LJ2A 5HFQA 4N4GA 5F2PA 1JM4B 3JVJA 5EPBA 5FE8A 4HXSA 4Z1SA 5KHMA 2DKWA 3HMFA 3QZSA 5A5NA 2DWWA 5J0DA 5I29A 4TT4A 2L85A 1WUGA 4MR6A 5F60A 4E96A 5DKDA 4O78A 5JI8A 2RS9B 4O7FA 4TYLA 4WHWA 3UVXA 5AD2A 4PTBA 4LDFA 4NUEA 4ZW1A 4NUDA 5FG5A 4Z6HA 5FE7A 4TZ8A 5IBNA 4UIWA 3IU5A 4NRCA 4ALGA 4YADA 4UYFA 4O75A 2E7OA 4OGJA 3UV4A 4NR7A 5DYXA 1WUMA 5EM3A 4KCXA 4YH3A 4OGIA 4Z6IA 5LUUA 5F62A 3D7CA 5DW2A 4YY6A 2H60A 5DLZA 4A9EA 4NQMA 2G4AA 4NQNA 5C89A 3U5JA 5FFWA 2OUOA 2DVVA 5A5OA 2YW5A 5COIA 2MJVB 3U5LA 4YATA 5KU3A 4HXNA 4Q0NA 4QSPA 5IGNA 4YBSA 4GPJA 4IR4A 5DW1A 3P1EA 3DWYA 3QZTA 4QZSA 4C67A 5FG6A 3SVFA 5IGMA 4LC2A 5E3GA 5FFYA 5CFWA 4QR4A 5LVRA 5II1A 4TZ2A 5I7YA 5DX4A 4UIUA 4UIXA 5EQ1A 4XUBA 4LYWA 4KV1A 5FBXA 5DYAA 4PCIA 5DFDA 4MEOA 5FH6A 4NR4A 4YBMA 4IR6A 5ENHA 5EVAA 4YYNA 5A7CA 4A9HA 4MR5A 4J1PA 5EWHA 4LZRA 4PCEA 5LVQA 5DYUA 3LQIA 5CQ8A 5EWWA 4LYIA 4YY4A 5F3AA 4ZQLA 5I1QA 5C8GA 4O76A 4YC9A 1ZS5A 4UYHA 4A9KA 5E74A 5CGPA 3O37A 5CY9A 4OUFA 5FB0A 5CQ4A 3GG3A 4QSWA 4YYJA 5HFRA 3P1FA 5FE2A 5HLSA 4O7BA 4QBMA 4QB3A 4QYLA 3ONIA 5CS8A 4MR4A 2R0VA 4IORA 4QEUA 5ENGA 4UYGA 5A5QA 5FFVA 4QEWA 4UIYA 5L8TA 5CUBA 2R10A 4MEQA 5EA1A 4TT6A 4CUUA 5IIDA 3G0LA 5HELA 4UYFB 5FE3A 5G4RA 4MENA 5DY7A 3MB3A 4YYIA 5EGUA 2KTBB 4DONA 4A9JA 3FKMX 4A9NA 4XUAA 5D3RA 5FE6A 4QSUA 3LXJA 3MUKA 2YDWA 4XYAA 5E9MA 5FH7A 5F36A 4A9OA 5E0RA 4CFLA 4O7EA 5EISA 5HQ5A 5DYCA 5FE4A 5L8UA 4PKLA 5A81A 2D9EA 5D3SA 4BW2A 5CUDA 5L96A 5ENCA 2L84A 4QSTA 5HRWA 5JWMA 4LZ2A 5ENBA 1F68A 5H1UA 4BHWA 3LQHA 5TCMA 3AQAA 4CFKA 3TLPA 2R0SA 5F1HA 5C85A 5A82A 5D26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWC A;  4HXR A;  5DFC A;  5D3N A;  5KTW A;  2RI7 A;  4YYM A;  4YAX A;  4CL9 A;  5KO4 A;  5EIC A;  4BW4 A;  4ZC9 A;  1X0J A;  4HXK A;  4NRB A;  2RNY A;  2RO1 A;  3MXF A;  4QSQ A;  4QSR A;  4QUU A;  4HBV A;  4IR5 A;  4NR6 A;  5LKT A;  4HXM A;  4QEV A;  5CUA A;  5CRM A;  5A85 A;  4TTE A;  5ENF A;  2OSS A;  4HXL A;  3UV2 A;  5BT3 A;  5CQ7 A;  4QSX A;  5II2 A;  2DVR A;  5BT5 A;  4BW1 A;  5FE0 A;  5CPE A;  3MQM A;  5EWV A;  5C7N A;  5ENJ A;  4CUR A;  4YH4 A;  3K2J A;  4KV4 A;  2DAT A;  5HEN A;  3U5K A;  2FSA A;  5EK9 A;  4O71 A;  4YBT A;  2NXB A;  4FLP A;  5IGL A;  4O70 A;  4TT2 A;  4UYE A;  5AMF A;  4QYD A;  5K29 A;  3UW9 A;  5DFB A;  4TU6 A;  5E3D A;  4A9I A;  5BT4 A;  5LKX A;  4PY6 A;  3DAI A;  3Q2E A;  4A9L A;  5FE9 A;  2YEL A;  2I7K A;  5L98 A;  5I83 A;  5LKZ A;  4O7C A;  2YEM A;  5E9L A;  4UIT A;  3AAD A;  2F6J A;  5EP7 A;  5CU8 A;  5E9I A;  3O35 A;  4MR3 A;  5HEM A;  2WP2 A;  4NRA A;  4O7A A;  5ENI A;  5EV9 A;  4XY9 A;  4J3I A;  2OO1 A;  5D0C A;  1E6I A;  4C66 A;  4CUP A;  1EQF A;  4NUC A;  5A5S A;  4HBW A;  5F1L A;  3MUL A;  3O34 A;  4NYW A;  3HME A;  4J0S A;  4Z1Q A;  3U5M A;  5CQ5 A;  2DVS A;  4N4I A;  4N3W A;  4PS5 A;  5EPR A;  5G4S A;  5HCL A;  5HRX A;  2L5E A;  3O36 A;  5F25 A;  4LYS A;  3JVK A;  4UYD A;  5AME A;  5I88 A;  4QC1 A;  4LZS A;  5D25 A;  4LRG A;  2E3K A;  4NR5 A;  5F5Z A;  4ALH A;  4O74 A;  3Q2F A;  5C87 A;  4YYH A;  5I89 A;  5D3T A;  4CLB A;  4HXP A;  5D3P A;  1JSP B;  5FDZ A;  4QY4 A;  3S91 A;  5ETB A;  3RCW A;  5DLX A;  5HRV A;  3UVW A;  5EI4 A;  4NXJ A;  5KTX A;  5HQ6 A;  4NYV A;  5L97 A;  4WHU A;  5LJ0 A;  5LKU A;  5E9K A;  5DKC A;  4HXO A;  4O72 A;  2RNW A;  5AD3 A;  5A83 A;  5C4Q A;  5I86 A;  5CQ6 A;  4F3I A;  4Z93 A;  3U5N A;  5D3L A;  2YEK A;  4IR3 A;  5ETD A;  2WP1 A;  5FB1 A;  4X2I A;  5E7D A;  4O77 A;  3ZYU A;  4NS5 A;  3QZV A;  4YK0 A;  2LSP B;  3JVL A;  4BJX A;  3I3J A;  3S92 A;  4QNS A;  3SVG A;  2R0Y A;  4QSV A;  5KTU A;  4CUS A;  4UIV A;  5EPS A;  5FE5 A;  5CRZ A;  2N9G A;  4RVR A;  4Q0O A;  4AKN A;  5ENE A;  4IOO A;  2F6N A;  3O33 A;  5IG6 A;  5L99 A;  5TB6 A;  5DKH A;  3SVH A;  5EWD A;  5I40 A;  5H1V A;  5LJ1 A;  5D3H A;  3P5O A;  2RFJ A;  5FE1 A;  2YQD A;  4QR3 A;  3P1D A;  2DVQ A;  2I8N A;  5F61 A;  4A9M A;  4XY8 A;  5CUC A;  5E9Y A;  5ACY A;  3MB4 A;  4QC3 A;  4WIV A;  5D24 A;  4IOQ A;  3NXB A;  2RNX A;  3P1C A;  5CP5 A;  5CZG A;  5EU1 A;  5HQ7 A;  4TQN A;  4Y03 A;  5FG4 A;  3JVM A;  4QSS A;  4YYD A;  4TU4 A;  5CQA A;  4YYK A;  5CQ3 A;  5H85 A;  4J0R A;  4CUQ A;  5A5R A;  4NR8 A;  5CTL A;  5F63 A;  3UVY A;  4A9F A;  1N72 A;  3UVD A;  5D3J A;  5E9V A;  3G0J A;  5H1T A;  5A5P A;  4NYX A;  5E73 A;  3LQJ A;  5FH8 A;  4NR9 A;  4YAB A;  4UIZ A;  2YYN A;  4HBY A;  3IU6 A;  4QR5 A;  4HBX A;  5CUE A;  5DBM A;  5D7X A;  4MEP A;  5I80 A;  4N4F A;  3U5O A;  4CUT A;  4QUT A;  3UV5 A;  4BW3 A;  2D82 A;  5CUG A;  5I7X A;  4N4H A;  4LR6 A;  3LJW A;  5HJC A;  4YYG A;  5CQT A;  2E7N A;  5HM0 A;  3HMH A;  5IGK A;  3U5P A;  2GRC A;  4TS8 A;  5LJ2 A;  5HFQ A;  4N4G A;  5F2P A;  1JM4 B;  3JVJ A;  5EPB A;  5FE8 A;  4HXS A;  4Z1S A;  5KHM A;  2DKW A;  3HMF A;  3QZS A;  5A5N A;  2DWW A;  5J0D A;  5I29 A;  4TT4 A;  2L85 A;  1WUG A;  4MR6 A;  5F60 A;  4E96 A;  5DKD A;  4O78 A;  5JI8 A;  2RS9 B;  4O7F A;  4TYL A;  4WHW A;  3UVX A;  5AD2 A;  4PTB A;  4LDF A;  4NUE A;  4ZW1 A;  4NUD A;  5FG5 A;  4Z6H A;  5FE7 A;  4TZ8 A;  5IBN A;  4UIW A;  3IU5 A;  4NRC A;  4ALG A;  4YAD A;  4UYF A;  4O75 A;  2E7O A;  4OGJ A;  3UV4 A;  4NR7 A;  5DYX A;  1WUM A;  5EM3 A;  4KCX A;  4YH3 A;  4OGI A;  4Z6I A;  5LUU A;  5F62 A;  3D7C A;  5DW2 A;  4YY6 A;  2H60 A;  5DLZ A;  4A9E A;  4NQM A;  2G4A A;  4NQN A;  5C89 A;  3U5J A;  5FFW A;  2OUO A;  2DVV A;  5A5O A;  2YW5 A;  5COI A;  2MJV B;  3U5L A;  4YAT A;  5KU3 A;  4HXN A;  4Q0N A;  4QSP A;  5IGN A;  4YBS A;  4GPJ A;  4IR4 A;  5DW1 A;  3P1E A;  3DWY A;  3QZT A;  4QZS A;  4C67 A;  5FG6 A;  3SVF A;  5IGM A;  4LC2 A;  5E3G A;  5FFY A;  5CFW A;  4QR4 A;  5LVR A;  5II1 A;  4TZ2 A;  5I7Y A;  5DX4 A;  4UIU A;  4UIX A;  5EQ1 A;  4XUB A;  4LYW A;  4KV1 A;  5FBX A;  5DYA A;  4PCI A;  5DFD A;  4MEO A;  5FH6 A;  4NR4 A;  4YBM A;  4IR6 A;  5ENH A;  5EVA A;  4YYN A;  5A7C A;  4A9H A;  4MR5 A;  4J1P A;  5EWH A;  4LZR A;  4PCE A;  5LVQ A;  5DYU A;  3LQI A;  5CQ8 A;  5EWW A;  4LYI A;  4YY4 A;  5F3A A;  4ZQL A;  5I1Q A;  5C8G A;  4O76 A;  4YC9 A;  1ZS5 A;  4UYH A;  4A9K A;  5E74 A;  5CGP A;  3O37 A;  5CY9 A;  4OUF A;  5FB0 A;  5CQ4 A;  3GG3 A;  4QSW A;  4YYJ A;  5HFR A;  3P1F A;  5FE2 A;  5HLS A;  4O7B A;  4QBM A;  4QB3 A;  4QYL A;  3ONI A;  5CS8 A;  4MR4 A;  2R0V A;  4IOR A;  4QEU A;  5ENG A;  4UYG A;  5A5Q A;  5FFV A;  4QEW A;  4UIY A;  5L8T A;  5CUB A;  2R10 A;  4MEQ A;  5EA1 A;  4TT6 A;  4CUU A;  5IID A;  3G0L A;  5HEL A;  4UYF B;  5FE3 A;  5G4R A;  4MEN A;  5DY7 A;  3MB3 A;  4YYI A;  5EGU A;  2KTB B;  4DON A;  4A9J A;  3FKM X;  4A9N A;  4XUA A;  5D3R A;  5FE6 A;  4QSU A;  3LXJ A;  3MUK A;  2YDW A;  4XYA A;  5E9M A;  5FH7 A;  5F36 A;  4A9O A;  5E0R A;  4CFL A;  4O7E A;  5EIS A;  5HQ5 A;  5DYC A;  5FE4 A;  5L8U A;  4PKL A;  5A81 A;  2D9E A;  5D3S A;  4BW2 A;  5CUD A;  5L96 A;  5ENC A;  2L84 A;  4QST A;  5HRW A;  5JWM A;  4LZ2 A;  5ENB A;  1F68 A;  5H1U A;  4BHW A;  3LQH A;  5TCM A;  3AQA A;  4CFK A;  3TLP A;  2R0S A;  5F1H A;  5C85 A;  5A82 A;  5D26 A; 
#chains in the Genus database with same CATH topology
 5EWC A;  4HXR A;  5DFC A;  2EJN A;  5D3N A;  5KTW A;  2RI7 A;  4YYM A;  3VKH A;  4YAX A;  4CL9 A;  5KO4 A;  5EIC A;  4BW4 A;  4ZC9 A;  1X0J A;  4HXK A;  4NRB A;  2RNY A;  2RO1 A;  3MXF A;  4QSQ A;  4QSR A;  4QUU A;  4HBV A;  4IR5 A;  4NR6 A;  5LKT A;  4HXM A;  4QEV A;  5CUA A;  5CRM A;  5A85 A;  4TTE A;  5ENF A;  2OSS A;  4HXL A;  3UV2 A;  5BT3 A;  5CQ7 A;  4QSX A;  5II2 A;  2DVR A;  5BT5 A;  4BW1 A;  5FE0 A;  5CPE A;  3MQM A;  5EWV A;  5C7N A;  5ENJ A;  4CUR A;  4YH4 A;  3K2J A;  4KV4 A;  2DAT A;  5HEN A;  3U5K A;  2FSA A;  5EK9 A;  4O71 A;  4YBT A;  2NXB A;  4FLP A;  5IGL A;  4O70 A;  4TT2 A;  4UYE A;  5AMF A;  4QYD A;  5K29 A;  3UW9 A;  5DFB A;  4TU6 A;  5E3D A;  4A9I A;  5BT4 A;  5LKX A;  4PY6 A;  3DAI A;  3Q2E A;  4A9L A;  5FE9 A;  2YEL A;  2I7K A;  5L98 A;  5I83 A;  5LKZ A;  4O7C A;  3ERR A;  2YEM A;  5E9L A;  4UIT A;  3AAD A;  2F6J A;  5EP7 A;  5CU8 A;  5E9I A;  3O35 A;  4MR3 A;  5HEM A;  2WP2 A;  4NRA A;  4O7A A;  5ENI A;  5EV9 A;  4XY9 A;  4J3I A;  2OO1 A;  5D0C A;  1E6I A;  4C66 A;  4CUP A;  1EQF A;  4NUC A;  5A5S A;  4HBW A;  5F1L A;  3MUL A;  3O34 A;  4NYW A;  4AI6 A;  3HME A;  4J0S A;  4Z1Q A;  3U5M A;  5CQ5 A;  2DVS A;  4N4I A;  4N3W A;  4PS5 A;  5EPR A;  5G4S A;  5HCL A;  5HRX A;  2L5E A;  3O36 A;  5F25 A;  4LYS A;  3JVK A;  4UYD A;  5AME A;  5I88 A;  4QC1 A;  4LZS A;  5D25 A;  4LRG A;  2E3K A;  4NR5 A;  5F5Z A;  4ALH A;  4O74 A;  3Q2F A;  5C87 A;  4YYH A;  5I89 A;  5D3T A;  4CLB A;  4HXP A;  5D3P A;  1JSP B;  5FDZ A;  4QY4 A;  3S91 A;  5ETB A;  3RCW A;  5DLX A;  5HRV A;  3UVW A;  5EI4 A;  4NXJ A;  5KTX A;  5HQ6 A;  4NYV A;  5L97 A;  4WHU A;  5LJ0 A;  5LKU A;  5E9K A;  5DKC A;  4HXO A;  4O72 A;  2RNW A;  5AD3 A;  5A83 A;  5C4Q A;  5I86 A;  4AKH A;  5CQ6 A;  4F3I A;  4Z93 A;  3U5N A;  5D3L A;  2YEK A;  4IR3 A;  5ETD A;  2WP1 A;  5FB1 A;  4X2I A;  5E7D A;  4O77 A;  3ZYU A;  4NS5 A;  3QZV A;  4YK0 A;  2LSP B;  3JVL A;  4BJX A;  3I3J A;  3S92 A;  4QNS A;  3SVG A;  2R0Y A;  4QSV A;  5KTU A;  4CUS A;  4UIV A;  5EPS A;  4AKG A;  5FE5 A;  5CRZ A;  2N9G A;  4RVR A;  4Q0O A;  4AKN A;  5ENE A;  4IOO A;  2F6N A;  3O33 A;  5IG6 A;  5L99 A;  5TB6 A;  5DKH A;  3SVH A;  5EWD A;  5I40 A;  5H1V A;  5LJ1 A;  4AKI A;  5D3H A;  3P5O A;  2RFJ A;  5FE1 A;  2YQD A;  4QR3 A;  1PUO A;  3P1D A;  2DVQ A;  2I8N A;  5F61 A;  4A9M A;  4XY8 A;  5CUC A;  5E9Y A;  5ACY A;  3MB4 A;  4QC3 A;  4WIV A;  5D24 A;  4IOQ A;  3NXB A;  2RNX A;  3P1C A;  5CP5 A;  5CZG A;  5EU1 A;  5HQ7 A;  4TQN A;  4Y03 A;  5FG4 A;  3JVM A;  4QSS A;  4YYD A;  4TU4 A;  5CQA A;  4YYK A;  5CQ3 A;  5H85 A;  4J0R A;  4CUQ A;  5A5R A;  4NR8 A;  5CTL A;  5F63 A;  3UVY A;  4A9F A;  1N72 A;  3UVD A;  5D3J A;  5E9V A;  3G0J A;  5H1T A;  5A5P A;  4NYX A;  5E73 A;  3LQJ A;  5FH8 A;  4NR9 A;  4YAB A;  4UIZ A;  2YYN A;  4HBY A;  3IU6 A;  4QR5 A;  4HBX A;  5CUE A;  5DBM A;  5D7X A;  4MEP A;  5I80 A;  4N4F A;  3U5O A;  4CUT A;  4QUT A;  3UV5 A;  4BW3 A;  2D82 A;  5CUG A;  5I7X A;  4N4H A;  4LR6 A;  3LJW A;  5HJC A;  4YYG A;  5CQT A;  2E7N A;  5HM0 A;  3HMH A;  5IGK A;  3U5P A;  2GRC A;  4TS8 A;  5LJ2 A;  5HFQ A;  4N4G A;  5F2P A;  1JM4 B;  3JVJ A;  5EPB A;  5FE8 A;  4HXS A;  4Z1S A;  5KHM A;  2DKW A;  3HMF A;  3QZS A;  5A5N A;  2DWW A;  5J0D A;  5I29 A;  4TT4 A;  2L85 A;  1WUG A;  4MR6 A;  5F60 A;  4E96 A;  5DKD A;  4O78 A;  5JI8 A;  2RS9 B;  4O7F A;  4TYL A;  4WHW A;  3UVX A;  5AD2 A;  4PTB A;  4LDF A;  4NUE A;  4ZW1 A;  4NUD A;  5FG5 A;  4Z6H A;  5FE7 A;  4TZ8 A;  5IBN A;  4UIW A;  3IU5 A;  4NRC A;  4ALG A;  4YAD A;  4UYF A;  4O75 A;  2E7O A;  4OGJ A;  3UV4 A;  4NR7 A;  5DYX A;  1WUM A;  5EM3 A;  4KCX A;  4YH3 A;  4OGI A;  4Z6I A;  5LUU A;  5F62 A;  3D7C A;  5DW2 A;  4YY6 A;  3D1D A;  2H60 A;  5DLZ A;  4A9E A;  3D1B A;  2G4A A;  4NQM A;  4NQN A;  5C89 A;  3U5J A;  5FFW A;  2OUO A;  2DVV A;  5A5O A;  2YW5 A;  5COI A;  2MJV B;  3U5L A;  4YAT A;  5KU3 A;  4HXN A;  4Q0N A;  4QSP A;  5IGN A;  4YBS A;  4GPJ A;  4IR4 A;  5DW1 A;  3P1E A;  3DWY A;  3QZT A;  4QZS A;  4C67 A;  5FG6 A;  3SVF A;  5IGM A;  4LC2 A;  5E3G A;  5FFY A;  5CFW A;  4QR4 A;  5LVR A;  5II1 A;  4TZ2 A;  5I7Y A;  5DX4 A;  4UIU A;  4UIX A;  5EQ1 A;  4XUB A;  4LYW A;  4KV1 A;  5FBX A;  5DYA A;  4PCI A;  5DFD A;  1ZKR A;  4MEO A;  5FH6 A;  4NR4 A;  4YBM A;  4IR6 A;  5ENH A;  5EVA A;  4YYN A;  5A7C A;  4A9H A;  4MR5 A;  4J1P A;  5EWH A;  4LZR A;  4PCE A;  5LVQ A;  5DYU A;  3LQI A;  5CQ8 A;  5EWW A;  4LYI A;  4YY4 A;  5F3A A;  4ZQL A;  5I1Q A;  5C8G A;  4O76 A;  4YC9 A;  1ZS5 A;  4UYH A;  4A9K A;  5E74 A;  5CGP A;  3O37 A;  5CY9 A;  4OUF A;  5FB0 A;  5CQ4 A;  3GG3 A;  4QSW A;  4YYJ A;  5HFR A;  3P1F A;  5FE2 A;  5HLS A;  4O7B A;  4QBM A;  4QB3 A;  4QYL A;  3ONI A;  5CS8 A;  4MR4 A;  3VKG A;  2R0V A;  4IOR A;  4QEU A;  5ENG A;  4UYG A;  5A5Q A;  5FFV A;  4QEW A;  4UIY A;  5L8T A;  5CUB A;  2R10 A;  4MEQ A;  5EA1 A;  4TT6 A;  4CUU A;  5IID A;  3G0L A;  5HEL A;  4UYF B;  5FE3 A;  5G4R A;  4MEN A;  5DY7 A;  3MB3 A;  4YYI A;  5EGU A;  2KTB B;  4DON A;  4A9J A;  3FKM X;  4A9N A;  4XUA A;  5D3R A;  5FE6 A;  4QSU A;  3LXJ A;  3MUK A;  2YDW A;  4XYA A;  5E9M A;  5FH7 A;  5F36 A;  4A9O A;  5E0R A;  4CFL A;  4O7E A;  5EIS A;  5HQ5 A;  5DYC A;  5FE4 A;  5L8U A;  4PKL A;  5A81 A;  2D9E A;  5D3S A;  4BW2 A;  5CUD A;  5L96 A;  5ENC A;  2L84 A;  4QST A;  5HRW A;  5JWM A;  4LZ2 A;  5ENB A;  1F68 A;  5H1U A;  4BHW A;  3LQH A;  5TCM A;  3AQA A;  4CFK A;  3TLP A;  2R0S A;  5F1H A;  5C85 A;  5A82 A;  5D26 A; 
#chains in the Genus database with same CATH homology
 5EWC A;  4HXR A;  5DFC A;  5D3N A;  5KTW A;  2RI7 A;  4YYM A;  4YAX A;  4CL9 A;  5KO4 A;  5EIC A;  4BW4 A;  4ZC9 A;  1X0J A;  4HXK A;  4NRB A;  2RNY A;  2RO1 A;  3MXF A;  4QSQ A;  4QSR A;  4QUU A;  4HBV A;  4IR5 A;  4NR6 A;  5LKT A;  4HXM A;  4QEV A;  5CUA A;  5CRM A;  5A85 A;  4TTE A;  5ENF A;  2OSS A;  4HXL A;  3UV2 A;  5BT3 A;  5CQ7 A;  4QSX A;  5II2 A;  2DVR A;  5BT5 A;  4BW1 A;  5FE0 A;  5CPE A;  3MQM A;  5EWV A;  5C7N A;  5ENJ A;  4CUR A;  4YH4 A;  3K2J A;  4KV4 A;  2DAT A;  5HEN A;  3U5K A;  2FSA A;  5EK9 A;  4O71 A;  4YBT A;  2NXB A;  4FLP A;  5IGL A;  4O70 A;  4TT2 A;  4UYE A;  5AMF A;  4QYD A;  5K29 A;  3UW9 A;  5DFB A;  4TU6 A;  5E3D A;  4A9I A;  5BT4 A;  5LKX A;  4PY6 A;  3DAI A;  3Q2E A;  4A9L A;  5FE9 A;  2YEL A;  2I7K A;  5L98 A;  5I83 A;  5LKZ A;  4O7C A;  2YEM A;  5E9L A;  4UIT A;  3AAD A;  2F6J A;  5EP7 A;  5CU8 A;  5E9I A;  3O35 A;  4MR3 A;  5HEM A;  2WP2 A;  4NRA A;  4O7A A;  5ENI A;  5EV9 A;  4XY9 A;  4J3I A;  2OO1 A;  5D0C A;  1E6I A;  4C66 A;  4CUP A;  1EQF A;  4NUC A;  5A5S A;  4HBW A;  5F1L A;  3MUL A;  3O34 A;  4NYW A;  3HME A;  4J0S A;  4Z1Q A;  3U5M A;  5CQ5 A;  2DVS A;  4N4I A;  4N3W A;  4PS5 A;  5EPR A;  5G4S A;  5HCL A;  5HRX A;  2L5E A;  3O36 A;  5F25 A;  4LYS A;  3JVK A;  4UYD A;  5AME A;  5I88 A;  4QC1 A;  4LZS A;  5D25 A;  4LRG A;  2E3K A;  4NR5 A;  5F5Z A;  4ALH A;  4O74 A;  3Q2F A;  5C87 A;  4YYH A;  5I89 A;  5D3T A;  4CLB A;  4HXP A;  5D3P A;  1JSP B;  5FDZ A;  4QY4 A;  3S91 A;  5ETB A;  3RCW A;  5DLX A;  5HRV A;  3UVW A;  5EI4 A;  4NXJ A;  5KTX A;  5HQ6 A;  4NYV A;  5L97 A;  4WHU A;  5LJ0 A;  5LKU A;  5E9K A;  5DKC A;  4HXO A;  4O72 A;  2RNW A;  5AD3 A;  5A83 A;  5C4Q A;  5I86 A;  5CQ6 A;  4F3I A;  4Z93 A;  3U5N A;  5D3L A;  2YEK A;  4IR3 A;  5ETD A;  2WP1 A;  5FB1 A;  4X2I A;  5E7D A;  4O77 A;  3ZYU A;  4NS5 A;  3QZV A;  4YK0 A;  2LSP B;  3JVL A;  4BJX A;  3I3J A;  3S92 A;  4QNS A;  3SVG A;  2R0Y A;  4QSV A;  5KTU A;  4CUS A;  4UIV A;  5EPS A;  5FE5 A;  5CRZ A;  2N9G A;  4RVR A;  4Q0O A;  4AKN A;  5ENE A;  4IOO A;  2F6N A;  3O33 A;  5IG6 A;  5L99 A;  5TB6 A;  5DKH A;  3SVH A;  5EWD A;  5I40 A;  5H1V A;  5LJ1 A;  5D3H A;  3P5O A;  2RFJ A;  5FE1 A;  2YQD A;  4QR3 A;  3P1D A;  2DVQ A;  2I8N A;  5F61 A;  4A9M A;  4XY8 A;  5CUC A;  5E9Y A;  5ACY A;  3MB4 A;  4QC3 A;  4WIV A;  5D24 A;  4IOQ A;  3NXB A;  2RNX A;  3P1C A;  5CP5 A;  5CZG A;  5EU1 A;  5HQ7 A;  4TQN A;  4Y03 A;  5FG4 A;  3JVM A;  4QSS A;  4YYD A;  4TU4 A;  5CQA A;  4YYK A;  5CQ3 A;  5H85 A;  4J0R A;  4CUQ A;  5A5R A;  4NR8 A;  5CTL A;  5F63 A;  3UVY A;  4A9F A;  1N72 A;  3UVD A;  5D3J A;  5E9V A;  3G0J A;  5H1T A;  5A5P A;  4NYX A;  5E73 A;  3LQJ A;  5FH8 A;  4NR9 A;  4YAB A;  4UIZ A;  2YYN A;  4HBY A;  3IU6 A;  4QR5 A;  4HBX A;  5CUE A;  5DBM A;  5D7X A;  4MEP A;  5I80 A;  4N4F A;  3U5O A;  4CUT A;  4QUT A;  3UV5 A;  4BW3 A;  2D82 A;  5CUG A;  5I7X A;  4N4H A;  4LR6 A;  3LJW A;  5HJC A;  4YYG A;  5CQT A;  2E7N A;  5HM0 A;  3HMH A;  5IGK A;  3U5P A;  2GRC A;  4TS8 A;  5LJ2 A;  5HFQ A;  4N4G A;  5F2P A;  1JM4 B;  3JVJ A;  5EPB A;  5FE8 A;  4HXS A;  4Z1S A;  5KHM A;  2DKW A;  3HMF A;  3QZS A;  5A5N A;  2DWW A;  5J0D A;  5I29 A;  4TT4 A;  2L85 A;  1WUG A;  4MR6 A;  5F60 A;  4E96 A;  5DKD A;  4O78 A;  5JI8 A;  2RS9 B;  4O7F A;  4TYL A;  4WHW A;  3UVX A;  5AD2 A;  4PTB A;  4LDF A;  4NUE A;  4ZW1 A;  4NUD A;  5FG5 A;  4Z6H A;  5FE7 A;  4TZ8 A;  5IBN A;  4UIW A;  3IU5 A;  4NRC A;  4ALG A;  4YAD A;  4UYF A;  4O75 A;  2E7O A;  4OGJ A;  3UV4 A;  4NR7 A;  5DYX A;  1WUM A;  5EM3 A;  4KCX A;  4YH3 A;  4OGI A;  4Z6I A;  5LUU A;  5F62 A;  3D7C A;  5DW2 A;  4YY6 A;  2H60 A;  5DLZ A;  4A9E A;  4NQM A;  2G4A A;  4NQN A;  5C89 A;  3U5J A;  5FFW A;  2OUO A;  2DVV A;  5A5O A;  2YW5 A;  5COI A;  2MJV B;  3U5L A;  4YAT A;  5KU3 A;  4HXN A;  4Q0N A;  4QSP A;  5IGN A;  4YBS A;  4GPJ A;  4IR4 A;  5DW1 A;  3P1E A;  3DWY A;  3QZT A;  4QZS A;  4C67 A;  5FG6 A;  3SVF A;  5IGM A;  4LC2 A;  5E3G A;  5FFY A;  5CFW A;  4QR4 A;  5LVR A;  5II1 A;  4TZ2 A;  5I7Y A;  5DX4 A;  4UIU A;  4UIX A;  5EQ1 A;  4XUB A;  4LYW A;  4KV1 A;  5FBX A;  5DYA A;  4PCI A;  5DFD A;  4MEO A;  5FH6 A;  4NR4 A;  4YBM A;  4IR6 A;  5ENH A;  5EVA A;  4YYN A;  5A7C A;  4A9H A;  4MR5 A;  4J1P A;  5EWH A;  4LZR A;  4PCE A;  5LVQ A;  5DYU A;  3LQI A;  5CQ8 A;  5EWW A;  4LYI A;  4YY4 A;  5F3A A;  4ZQL A;  5I1Q A;  5C8G A;  4O76 A;  4YC9 A;  1ZS5 A;  4UYH A;  4A9K A;  5E74 A;  5CGP A;  3O37 A;  5CY9 A;  4OUF A;  5FB0 A;  5CQ4 A;  3GG3 A;  4QSW A;  4YYJ A;  5HFR A;  3P1F A;  5FE2 A;  5HLS A;  4O7B A;  4QBM A;  4QB3 A;  4QYL A;  3ONI A;  5CS8 A;  4MR4 A;  2R0V A;  4IOR A;  4QEU A;  5ENG A;  4UYG A;  5A5Q A;  5FFV A;  4QEW A;  4UIY A;  5L8T A;  5CUB A;  2R10 A;  4MEQ A;  5EA1 A;  4TT6 A;  4CUU A;  5IID A;  3G0L A;  5HEL A;  4UYF B;  5FE3 A;  5G4R A;  4MEN A;  5DY7 A;  3MB3 A;  4YYI A;  5EGU A;  2KTB B;  4DON A;  4A9J A;  3FKM X;  4A9N A;  4XUA A;  5D3R A;  5FE6 A;  4QSU A;  3LXJ A;  3MUK A;  2YDW A;  4XYA A;  5E9M A;  5FH7 A;  5F36 A;  4A9O A;  5E0R A;  4CFL A;  4O7E A;  5EIS A;  5HQ5 A;  5DYC A;  5FE4 A;  5L8U A;  4PKL A;  5A81 A;  2D9E A;  5D3S A;  4BW2 A;  5CUD A;  5L96 A;  5ENC A;  2L84 A;  4QST A;  5HRW A;  5JWM A;  4LZ2 A;  5ENB A;  1F68 A;  5H1U A;  4BHW A;  3LQH A;  5TCM A;  3AQA A;  4CFK A;  3TLP A;  2R0S A;  5F1H A;  5C85 A;  5A82 A;  5D26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...