4A9IA

N-terminal bromodomain of human brd2 with 3-methyl-1,2,3,4- tetrahydroquinazolin-2-one
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
110
structure length
110
Chain Sequence
b'VTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN CONTAINING 2
publication title Fragment-Based Discovery of Bromodomain Inhibitors Part 1: Inhibitor Binding Modes and Implications for Lead Discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 37
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4a9iA00
4QSXA 2L5EA 5KTXA 4PS5A 4LDFA 4KV4A 5HRXA 4UYGA 5LKUA 3U5PA 4YYKA 3IU5A 3U5NA 4IR3A 2WP1A 5CQ8A 3UV5A 1X0JA 5L99A 5HRVA 4UYHA 5I89A 5FE6A 3RCWA 5A82A 4A9JA 5E74A 5FE0A 3AADA 4WHWA 4E96A 4IOOA 5I86A 1F68A 5F5ZA 4CUPA 4QUUA 4MEOA 4DONA 4ZQLA 4YBTA 5CY9A 4O74A 2DWWA 2D9EA 4TZ8A 5DKHA 2KTBB 5E9YA 5II1A 4ZC9A 4NYVA 4A9LA 4OUFA 2G4AA 4CURA 4QSQA 4YY6A 4O70A 3NXBA 4QUTA 5FE3A 4HXOA 4LR6A 2YYNA 5CQ7A 3I3JA 4MR4A 5C7NA 3O34A 5EWVA 5FB0A 5I7XA 3TLPA 4MEPA 4HXRA 2DKWA 4LZSA 5FE1A 4Q0NA 4XY8A 5DYCA 2MJVB 5E9MA 5ENGA 5ACYA 5CS8A 3K2JA 4HBWA 4YBSA 5C85A 4IORA 3O37A 1WUGA 5HELA 4CL9A 5EVAA 4TTEA 5HEMA 5CQ6A 5AMEA 5I1QA 4A9OA 5BT4A 2I8NA 5HCLA 3AQAA 5EWHA 2R0YA 5IGLA 5F1LA 3P1CA 5H1TA 4HBVA 4QC3A 5ENCA 4A9FA 1E6IA 2E7OA 4IR5A 5D7XA 2OUOA 3O36A 5F36A 5IBNA 2F6JA 5FH7A 5D3HA 5ENFA 5II2A 5A5OA 2NXBA 4N4FA 3G0LA 4CUUA 5E0RA 2R0VA 2RNWA 5ETBA 3U5LA 5A83A 3U5JA 5EPBA 5HJCA 5D3JA 4A9IA 4QSRA 4OGIA 5DLXA 4HXPA 3P1DA 5D3LA 3UW9A 4LRGA 5KTUA 2E7NA 3DAIA 4OGJA 2DVQA 4O7BA 5E9LA 3JVLA 4NS5A 5EISA 4A9KA 5EWCA 4NRCA 5E9KA 5LKZA 5E9IA 4UYEA 4NYXA 4UYFA 5DFBA 4YC9A 5ENIA 2RI7A 5CUGA 5C8GA 5TB6A 2E3KA 4O77A 3S91A 5A5SA 5A5NA 5DYAA 3MUKA 3LXJA 4PTBA 4XUBA 5D3RA 3P5OA 5DW2A 5H1VA 3UVYA 3QZSA 5CQ4A 4CUSA 5D3TA 5CPEA 4XY9A 5LKXA 4NR6A 5EP7A 4N3WA 3UV2A 5JI8A 5D26A 5CZGA 5CQTA 5A85A 4BW1A 4LZRA 2H60A 4MR5A 5L97A 5I88A 5D25A 5HFRA 4QSUA 5DFDA 5TCMA 4NQNA 3LJWA 5FFWA 2L84A 4HXKA 4KCXA 4TU6A 4Y03A 5COIA 5E3GA 5L96A 5CQAA 4YADA 4YK0A 3SVHA 2L85A 3ONIA 5FDZA 1ZS5A 4FLPA 4O7FA 5L98A 4C67A 4Q0OA 1N72A 4XYAA 5EU1A 5IG6A 4QR5A 5CGPA 2I7KA 4QSTA 5IGMA 4HBXA 4YYIA 4YYDA 5H85A 3MB3A 4IOQA 4QEWA 5FG4A 4O7CA 4YYJA 4O7AA 5CRMA 2YEMA 4Z93A 4F3IA 4NYWA 5CUDA 4YATA 4O78A 4HXNA 2RNYA 4UIUA 5CU8A 3O35A 5I83A 1JSPB 3U5KA 4HXMA 3GG3A 4NXJA 4RVRA 4PCIA 5FFVA 4UIXA 5I40A 4BJXA 3FKMX 3O33A 4YYGA 5CP5A 5I7YA 4CFKA 5FE8A 5AD3A 4UITA 2WP2A 4Z6HA 3JVKA 4QSSA 4LYIA 5CTLA 5EA1A 5F2PA 4MENA 3QZTA 4TT6A 2F6NA 5CUCA 5IIDA 5LUUA 4QBMA 3MB4A 4HXLA 5D24A 4Z1SA 4Z1QA 5F60A 4NUEA 5KTWA 5ENJA 3UVWA 5CQ5A 4UIVA 4YY4A 4QR3A 4PCEA 5CUEA 5LKTA 4ALHA 5DY7A 3P1FA 4LC2A 2RO1A 5CUAA 4CFLA 5BT3A 5L8UA 2YDWA 5I80A 5LVRA 5FG5A 3SVGA 4KV1A 4N4GA 4BW4A 5CFWA 4A9MA 4UYDA 2YW5A 5HQ7A 3DWYA 4TYLA 4YYNA 4O75A 2R0SA 4A9EA 5KHMA 2YQDA 3UV4A 4TT2A 4Z6IA 5ENHA 4A9NA 5HLSA 5FE9A 3JVJA 3U5OA 3HMHA 5F61A 4NUDA 5F3AA 5I29A 4QSVA 3HMEA 5DYUA 2R10A 4YH4A 5C87A 5FFYA 5EV9A 3LQJA 4QYLA 4QY4A 2FSAA 4YYHA 4QEVA 4QSPA 4QZSA 5C4QA 5FBXA 4NRBA 2D82A 2YELA 5FH6A 4X2IA 4XUAA 4TZ2A 5E7DA 4IR6A 5FE2A 4QNSA 3D7CA 5F63A 5FE7A 5LJ0A 5EICA 4J0SA 4YYMA 5D0CA 4O76A 4NR9A 1JM4B 2GRCA 3HMFA 5LJ1A 5J0DA 5JWMA 5C89A 5HQ6A 5HQ5A 2OSSA 4LYWA 4QC1A 3MXFA 5DW1A 4CLBA 4IR4A 4N4HA 4NUCA 5BT5A 4YAXA 4TS8A 5H1UA 4NR5A 4NR4A 4QR4A 4QB3A 5IGKA 4TU4A 5EWDA 5G4RA 4NQMA 5CRZA 4J1PA 4YBMA 4GPJA 4PKLA 5EK9A 5FH8A 5FG6A 3JVMA 4WIVA 4YH3A 4A9HA 5FB1A 5FE4A 4MR3A 4ZW1A 4NR8A 4QYDA 5HENA 3P1EA 1WUMA 5CQ3A 5FE5A 4J0RA 5DYXA 3MQMA 4TT4A 5E9VA 5ENEA 4J3IA 4N4IA 4MEQA 3UVDA 5K29A 5E3DA 4UIWA 5DX4A 4NR7A 3LQIA 5EQ1A 5KO4A 5D3PA 5AD2A 3U5MA 5CUBA 2RS9B 5DLZA 2LSPB 5HFQA 4HXSA 5A81A 5DBMA 2RFJA 4ALGA 5LVQA 4WHUA 2N9GA 3IU6A 5F25A 4UIZA 4LZ2A 3QZVA 5DKCA 5E73A 5ENBA 2RNXA 5HRWA 2DVVA 5AMFA 5IGNA 2DVRA 5EWWA 4C66A 2OO1A 2DATA 4BHWA 4UIYA 5A5PA 4YABA 5EPSA 4BW3A 5EGUA 4O71A 5DKDA 5L8TA 5A7CA 5ETDA 5F1HA 3UVXA 4NRAA 3Q2EA 5D3NA 4UYFB 2YEKA 5G4SA 5F62A 3G0JA 4HBYA 5D3SA 4MR6A 1EQFA 5A5QA 4PY6A 4QSWA 3Q2FA 3LQHA 5LJ2A 5EI4A 4TQNA 2DVSA 5EM3A 4O7EA 4O72A 3ZYUA 3SVFA 5DFCA 5HM0A 4AKNA 3MULA 5A5RA 4CUTA 4QEUA 3S92A 4BW2A 4LYSA 4CUQA 5KU3A 5EPRA
chains in the Genus database with same CATH superfamily
4QSXA 2L5EA 5KTXA 4PS5A 4LDFA 4KV4A 5HRXA 4UYGA 5LKUA 3U5PA 4YYKA 3IU5A 3U5NA 4IR3A 2WP1A 5CQ8A 3UV5A 1X0JA 5L99A 5HRVA 4UYHA 5I89A 5FE6A 3RCWA 5A82A 4A9JA 5E74A 5FE0A 3AADA 4WHWA 4E96A 4IOOA 5I86A 1F68A 5F5ZA 4CUPA 4QUUA 4MEOA 4DONA 4ZQLA 4YBTA 5CY9A 4O74A 2DWWA 2D9EA 4TZ8A 5DKHA 3VKHA 2KTBB 5E9YA 5II1A 4ZC9A 4NYVA 4A9LA 4OUFA 2G4AA 4CURA 4QSQA 4YY6A 4O70A 3NXBA 4QUTA 5FE3A 4HXOA 4LR6A 2YYNA 5CQ7A 3I3JA 4MR4A 5C7NA 3O34A 5EWVA 5FB0A 5I7XA 3TLPA 4MEPA 4HXRA 2DKWA 4LZSA 5FE1A 4Q0NA 4XY8A 5DYCA 2MJVB 5E9MA 5ENGA 5ACYA 5CS8A 3K2JA 4HBWA 4YBSA 5C85A 4IORA 3O37A 1WUGA 5HELA 4CL9A 5EVAA 4TTEA 5HEMA 5CQ6A 5AMEA 5I1QA 4A9OA 5BT4A 2I8NA 5HCLA 3AQAA 2EJNA 2R0YA 5EWHA 5IGLA 5F1LA 3P1CA 3D1DA 5H1TA 4HBVA 4QC3A 5ENCA 4A9FA 1E6IA 2E7OA 4IR5A 5D7XA 2OUOA 3O36A 5F36A 5IBNA 2F6JA 5FH7A 5D3HA 5ENFA 5II2A 5A5OA 2NXBA 4N4FA 3G0LA 4CUUA 5E0RA 2R0VA 2RNWA 5ETBA 3U5LA 5A83A 3U5JA 5EPBA 5HJCA 5D3JA 4A9IA 4QSRA 4OGIA 5DLXA 4HXPA 4AI6A 3P1DA 5D3LA 3UW9A 4LRGA 5KTUA 2E7NA 3DAIA 4OGJA 2DVQA 4O7BA 5E9LA 3JVLA 4NS5A 5EISA 4A9KA 4AKHA 5EWCA 4NRCA 5E9KA 5LKZA 5E9IA 4UYEA 4NYXA 4UYFA 5DFBA 4YC9A 5ENIA 2RI7A 5CUGA 5C8GA 5TB6A 2E3KA 4O77A 3S91A 5A5SA 5A5NA 5DYAA 3MUKA 3LXJA 4PTBA 4XUBA 5D3RA 3P5OA 5DW2A 5H1VA 3UVYA 3QZSA 5CQ4A 4CUSA 5D3TA 5CPEA 4XY9A 5LKXA 4NR6A 5EP7A 4N3WA 3UV2A 5JI8A 5D26A 5CZGA 5CQTA 5A85A 4BW1A 4LZRA 2H60A 4MR5A 5L97A 5I88A 5D25A 5HFRA 4QSUA 5DFDA 5TCMA 4NQNA 3LJWA 5FFWA 2L84A 4HXKA 4KCXA 4TU6A 4Y03A 5COIA 5E3GA 5L96A 5CQAA 4YADA 4YK0A 3SVHA 2L85A 3ONIA 5FDZA 1ZS5A 4FLPA 4O7FA 5L98A 4C67A 4Q0OA 1N72A 4XYAA 5EU1A 5IG6A 4QR5A 5CGPA 2I7KA 4QSTA 5IGMA 4HBXA 4YYIA 4YYDA 5H85A 3MB3A 4IOQA 4QEWA 5FG4A 4O7CA 4YYJA 4O7AA 5CRMA 2YEMA 4Z93A 4F3IA 4NYWA 5CUDA 4YATA 4O78A 4HXNA 2RNYA 4UIUA 5CU8A 3O35A 5I83A 1JSPB 3U5KA 4HXMA 3GG3A 4NXJA 4RVRA 3D1BA 4PCIA 5FFVA 4UIXA 5I40A 4BJXA 3FKMX 3O33A 4YYGA 5CP5A 5I7YA 4CFKA 5FE8A 5AD3A 4UITA 2WP2A 4Z6HA 3JVKA 4QSSA 4LYIA 5CTLA 5EA1A 5F2PA 4MENA 3QZTA 4TT6A 2F6NA 5CUCA 5IIDA 5LUUA 4QBMA 3MB4A 4HXLA 5D24A 4Z1SA 4Z1QA 5F60A 4NUEA 5KTWA 5ENJA 3UVWA 5CQ5A 4UIVA 4YY4A 4QR3A 4PCEA 5CUEA 5LKTA 4ALHA 5DY7A 3P1FA 4LC2A 2RO1A 5CUAA 4CFLA 5BT3A 5L8UA 2YDWA 5I80A 5LVRA 5FG5A 3SVGA 4KV1A 4N4GA 4BW4A 5CFWA 4A9MA 4UYDA 2YW5A 5HQ7A 3DWYA 4TYLA 4YYNA 4O75A 2R0SA 4A9EA 5KHMA 2YQDA 3UV4A 4TT2A 4Z6IA 5ENHA 4A9NA 5HLSA 5FE9A 3JVJA 3U5OA 3HMHA 5F61A 4NUDA 5F3AA 5I29A 4QSVA 3HMEA 5DYUA 2R10A 4YH4A 5C87A 5FFYA 5EV9A 3LQJA 4QYLA 4QY4A 2FSAA 4YYHA 4QEVA 4QSPA 4QZSA 5C4QA 5FBXA 1ZKRA 4NRBA 2D82A 2YELA 5FH6A 4X2IA 4XUAA 4TZ2A 5E7DA 4IR6A 5FE2A 4QNSA 3D7CA 5F63A 5FE7A 5LJ0A 5EICA 4J0SA 4YYMA 5D0CA 4O76A 4NR9A 1JM4B 2GRCA 3HMFA 5LJ1A 5J0DA 5JWMA 5C89A 5HQ6A 5HQ5A 2OSSA 4LYWA 4QC1A 3MXFA 5DW1A 4CLBA 4IR4A 4N4HA 4NUCA 5BT5A 4YAXA 4TS8A 5H1UA 4NR5A 4NR4A 4QR4A 4QB3A 5IGKA 4TU4A 5EWDA 5G4RA 4NQMA 5CRZA 4J1PA 4YBMA 4GPJA 4PKLA 5EK9A 5FH8A 5FG6A 3JVMA 4WIVA 4YH3A 4A9HA 5FB1A 5FE4A 4MR3A 4ZW1A 4NR8A 4AKIA 4QYDA 5HENA 3P1EA 1WUMA 5CQ3A 5FE5A 4J0RA 5DYXA 3MQMA 4TT4A 5E9VA 5ENEA 4J3IA 4N4IA 4MEQA 3UVDA 5K29A 5E3DA 4UIWA 5DX4A 4NR7A 3LQIA 5EQ1A 5KO4A 5D3PA 3VKGA 5AD2A 3U5MA 5CUBA 2RS9B 5DLZA 2LSPB 5HFQA 4HXSA 5A81A 5DBMA 2RFJA 4ALGA 5LVQA 4WHUA 4AKGA 2N9GA 3IU6A 5F25A 4UIZA 4LZ2A 3QZVA 5DKCA 5E73A 5ENBA 2RNXA 5HRWA 2DVVA 5AMFA 5IGNA 2DVRA 5EWWA 4C66A 2OO1A 2DATA 4BHWA 4UIYA 5A5PA 4YABA 5EPSA 4BW3A 5EGUA 4O71A 5DKDA 5L8TA 5A7CA 5ETDA 5F1HA 3UVXA 4NRAA 3Q2EA 5D3NA 4UYFB 2YEKA 5G4SA 5F62A 3G0JA 4HBYA 5D3SA 4MR6A 1EQFA 5A5QA 4PY6A 4QSWA 3Q2FA 3LQHA 5LJ2A 5EI4A 4TQNA 2DVSA 5EM3A 4O7EA 4O72A 3ZYUA 3ERRA 3SVFA 1PUOA 5DFCA 5HM0A 4AKNA 3MULA 5A5RA 4CUTA 4QEUA 3S92A 4BW2A 4LYSA 4CUQA 5KU3A 5EPRA
chains in the Genus database with same CATH topology
4QSXA 2L5EA 5KTXA 4PS5A 4LDFA 4KV4A 5HRXA 4UYGA 5LKUA 3U5PA 4YYKA 3IU5A 3U5NA 4IR3A 2WP1A 5CQ8A 3UV5A 1X0JA 5L99A 5HRVA 4UYHA 5I89A 5FE6A 3RCWA 5A82A 4A9JA 5E74A 5FE0A 3AADA 4WHWA 4E96A 4IOOA 5I86A 1F68A 5F5ZA 4CUPA 4QUUA 4MEOA 4DONA 4ZQLA 4YBTA 5CY9A 4O74A 2DWWA 2D9EA 4TZ8A 5DKHA 2KTBB 5E9YA 5II1A 4ZC9A 4NYVA 4A9LA 4OUFA 2G4AA 4CURA 4QSQA 4YY6A 4O70A 3NXBA 4QUTA 5FE3A 4HXOA 4LR6A 2YYNA 5CQ7A 3I3JA 4MR4A 5C7NA 3O34A 5EWVA 5FB0A 5I7XA 3TLPA 4MEPA 4HXRA 2DKWA 4LZSA 5FE1A 4Q0NA 4XY8A 5DYCA 2MJVB 5E9MA 5ENGA 5ACYA 5CS8A 3K2JA 4HBWA 4YBSA 5C85A 4IORA 3O37A 1WUGA 5HELA 4CL9A 5EVAA 4TTEA 5HEMA 5CQ6A 5AMEA 5I1QA 4A9OA 5BT4A 2I8NA 5HCLA 3AQAA 5EWHA 2R0YA 5IGLA 5F1LA 3P1CA 5H1TA 4HBVA 4QC3A 5ENCA 4A9FA 1E6IA 2E7OA 4IR5A 5D7XA 2OUOA 3O36A 5F36A 5IBNA 2F6JA 5FH7A 5D3HA 5ENFA 5II2A 5A5OA 2NXBA 4N4FA 3G0LA 4CUUA 5E0RA 2R0VA 2RNWA 5ETBA 3U5LA 5A83A 3U5JA 5EPBA 5HJCA 5D3JA 4A9IA 4QSRA 4OGIA 5DLXA 4HXPA 3P1DA 5D3LA 3UW9A 4LRGA 5KTUA 2E7NA 3DAIA 4OGJA 2DVQA 4O7BA 5E9LA 3JVLA 4NS5A 5EISA 4A9KA 5EWCA 4NRCA 5E9KA 5LKZA 5E9IA 4UYEA 4NYXA 4UYFA 5DFBA 4YC9A 5ENIA 2RI7A 5CUGA 5C8GA 5TB6A 2E3KA 4O77A 3S91A 5A5SA 5A5NA 5DYAA 3MUKA 3LXJA 4PTBA 4XUBA 5D3RA 3P5OA 5DW2A 5H1VA 3UVYA 3QZSA 5CQ4A 4CUSA 5D3TA 5CPEA 4XY9A 5LKXA 4NR6A 5EP7A 4N3WA 3UV2A 5JI8A 5D26A 5CZGA 5CQTA 5A85A 4BW1A 4LZRA 2H60A 4MR5A 5L97A 5I88A 5D25A 5HFRA 4QSUA 5DFDA 5TCMA 4NQNA 3LJWA 5FFWA 2L84A 4HXKA 4KCXA 4TU6A 4Y03A 5COIA 5E3GA 5L96A 5CQAA 4YADA 4YK0A 3SVHA 2L85A 3ONIA 5FDZA 1ZS5A 4FLPA 4O7FA 5L98A 4C67A 4Q0OA 1N72A 4XYAA 5EU1A 5IG6A 4QR5A 5CGPA 2I7KA 4QSTA 5IGMA 4HBXA 4YYIA 4YYDA 5H85A 3MB3A 4IOQA 4QEWA 5FG4A 4O7CA 4YYJA 4O7AA 5CRMA 2YEMA 4Z93A 4F3IA 4NYWA 5CUDA 4YATA 4O78A 4HXNA 2RNYA 4UIUA 5CU8A 3O35A 5I83A 1JSPB 3U5KA 4HXMA 3GG3A 4NXJA 4RVRA 4PCIA 5FFVA 4UIXA 5I40A 4BJXA 3FKMX 3O33A 4YYGA 5CP5A 5I7YA 4CFKA 5FE8A 5AD3A 4UITA 2WP2A 4Z6HA 3JVKA 4QSSA 4LYIA 5CTLA 5EA1A 5F2PA 4MENA 3QZTA 4TT6A 2F6NA 5CUCA 5IIDA 5LUUA 4QBMA 3MB4A 4HXLA 5D24A 4Z1SA 4Z1QA 5F60A 4NUEA 5KTWA 5ENJA 3UVWA 5CQ5A 4UIVA 4YY4A 4QR3A 4PCEA 5CUEA 5LKTA 4ALHA 5DY7A 3P1FA 4LC2A 2RO1A 5CUAA 4CFLA 5BT3A 5L8UA 2YDWA 5I80A 5LVRA 5FG5A 3SVGA 4KV1A 4N4GA 4BW4A 5CFWA 4A9MA 4UYDA 2YW5A 5HQ7A 3DWYA 4TYLA 4YYNA 4O75A 2R0SA 4A9EA 5KHMA 2YQDA 3UV4A 4TT2A 4Z6IA 5ENHA 4A9NA 5HLSA 5FE9A 3JVJA 3U5OA 3HMHA 5F61A 4NUDA 5F3AA 5I29A 4QSVA 3HMEA 5DYUA 2R10A 4YH4A 5C87A 5FFYA 5EV9A 3LQJA 4QYLA 4QY4A 2FSAA 4YYHA 4QEVA 4QSPA 4QZSA 5C4QA 5FBXA 4NRBA 2D82A 2YELA 5FH6A 4X2IA 4XUAA 4TZ2A 5E7DA 4IR6A 5FE2A 4QNSA 3D7CA 5F63A 5FE7A 5LJ0A 5EICA 4J0SA 4YYMA 5D0CA 4O76A 4NR9A 1JM4B 2GRCA 3HMFA 5LJ1A 5J0DA 5JWMA 5C89A 5HQ6A 5HQ5A 2OSSA 4LYWA 4QC1A 3MXFA 5DW1A 4CLBA 4IR4A 4N4HA 4NUCA 5BT5A 4YAXA 4TS8A 5H1UA 4NR5A 4NR4A 4QR4A 4QB3A 5IGKA 4TU4A 5EWDA 5G4RA 4NQMA 5CRZA 4J1PA 4YBMA 4GPJA 4PKLA 5EK9A 5FH8A 5FG6A 3JVMA 4WIVA 4YH3A 4A9HA 5FB1A 5FE4A 4MR3A 4ZW1A 4NR8A 4QYDA 5HENA 3P1EA 1WUMA 5CQ3A 5FE5A 4J0RA 5DYXA 3MQMA 4TT4A 5E9VA 5ENEA 4J3IA 4N4IA 4MEQA 3UVDA 5K29A 5E3DA 4UIWA 5DX4A 4NR7A 3LQIA 5EQ1A 5KO4A 5D3PA 5AD2A 3U5MA 5CUBA 2RS9B 5DLZA 2LSPB 5HFQA 4HXSA 5A81A 5DBMA 2RFJA 4ALGA 5LVQA 4WHUA 2N9GA 3IU6A 5F25A 4UIZA 4LZ2A 3QZVA 5DKCA 5E73A 5ENBA 2RNXA 5HRWA 2DVVA 5AMFA 5IGNA 2DVRA 5EWWA 4C66A 2OO1A 2DATA 4BHWA 4UIYA 5A5PA 4YABA 5EPSA 4BW3A 5EGUA 4O71A 5DKDA 5L8TA 5A7CA 5ETDA 5F1HA 3UVXA 4NRAA 3Q2EA 5D3NA 4UYFB 2YEKA 5G4SA 5F62A 3G0JA 4HBYA 5D3SA 4MR6A 1EQFA 5A5QA 4PY6A 4QSWA 3Q2FA 3LQHA 5LJ2A 5EI4A 4TQNA 2DVSA 5EM3A 4O7EA 4O72A 3ZYUA 3SVFA 5DFCA 5HM0A 4AKNA 3MULA 5A5RA 4CUTA 4QEUA 3S92A 4BW2A 4LYSA 4CUQA 5KU3A 5EPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QSX A;  2L5E A;  5KTX A;  4PS5 A;  4LDF A;  4KV4 A;  5HRX A;  4UYG A;  5LKU A;  3U5P A;  4YYK A;  3IU5 A;  3U5N A;  4IR3 A;  2WP1 A;  5CQ8 A;  3UV5 A;  1X0J A;  5L99 A;  5HRV A;  4UYH A;  5I89 A;  5FE6 A;  3RCW A;  5A82 A;  4A9J A;  5E74 A;  5FE0 A;  3AAD A;  4WHW A;  4E96 A;  4IOO A;  5I86 A;  1F68 A;  5F5Z A;  4CUP A;  4QUU A;  4MEO A;  4DON A;  4ZQL A;  4YBT A;  5CY9 A;  4O74 A;  2DWW A;  2D9E A;  4TZ8 A;  5DKH A;  2KTB B;  5E9Y A;  5II1 A;  4ZC9 A;  4NYV A;  4A9L A;  4OUF A;  2G4A A;  4CUR A;  4QSQ A;  4YY6 A;  4O70 A;  3NXB A;  4QUT A;  5FE3 A;  4HXO A;  4LR6 A;  2YYN A;  5CQ7 A;  3I3J A;  4MR4 A;  5C7N A;  3O34 A;  5EWV A;  5FB0 A;  5I7X A;  3TLP A;  4MEP A;  4HXR A;  2DKW A;  4LZS A;  5FE1 A;  4Q0N A;  4XY8 A;  5DYC A;  2MJV B;  5E9M A;  5ENG A;  5ACY A;  5CS8 A;  3K2J A;  4HBW A;  4YBS A;  5C85 A;  4IOR A;  3O37 A;  1WUG A;  5HEL A;  4CL9 A;  5EVA A;  4TTE A;  5HEM A;  5CQ6 A;  5AME A;  5I1Q A;  4A9O A;  5BT4 A;  2I8N A;  5HCL A;  3AQA A;  5EWH A;  2R0Y A;  5IGL A;  5F1L A;  3P1C A;  5H1T A;  4HBV A;  4QC3 A;  5ENC A;  4A9F A;  1E6I A;  2E7O A;  4IR5 A;  5D7X A;  2OUO A;  3O36 A;  5F36 A;  5IBN A;  2F6J A;  5FH7 A;  5D3H A;  5ENF A;  5II2 A;  5A5O A;  2NXB A;  4N4F A;  3G0L A;  4CUU A;  5E0R A;  2R0V A;  2RNW A;  5ETB A;  3U5L A;  5A83 A;  3U5J A;  5EPB A;  5HJC A;  5D3J A;  4A9I A;  4QSR A;  4OGI A;  5DLX A;  4HXP A;  3P1D A;  5D3L A;  3UW9 A;  4LRG A;  5KTU A;  2E7N A;  3DAI A;  4OGJ A;  2DVQ A;  4O7B A;  5E9L A;  3JVL A;  4NS5 A;  5EIS A;  4A9K A;  5EWC A;  4NRC A;  5E9K A;  5LKZ A;  5E9I A;  4UYE A;  4NYX A;  4UYF A;  5DFB A;  4YC9 A;  5ENI A;  2RI7 A;  5CUG A;  5C8G A;  5TB6 A;  2E3K A;  4O77 A;  3S91 A;  5A5S A;  5A5N A;  5DYA A;  3MUK A;  3LXJ A;  4PTB A;  4XUB A;  5D3R A;  3P5O A;  5DW2 A;  5H1V A;  3UVY A;  3QZS A;  5CQ4 A;  4CUS A;  5D3T A;  5CPE A;  4XY9 A;  5LKX A;  4NR6 A;  5EP7 A;  4N3W A;  3UV2 A;  5JI8 A;  5D26 A;  5CZG A;  5CQT A;  5A85 A;  4BW1 A;  4LZR A;  2H60 A;  4MR5 A;  5L97 A;  5I88 A;  5D25 A;  5HFR A;  4QSU A;  5DFD A;  5TCM A;  4NQN A;  3LJW A;  5FFW A;  2L84 A;  4HXK A;  4KCX A;  4TU6 A;  4Y03 A;  5COI A;  5E3G A;  5L96 A;  5CQA A;  4YAD A;  4YK0 A;  3SVH A;  2L85 A;  3ONI A;  5FDZ A;  1ZS5 A;  4FLP A;  4O7F A;  5L98 A;  4C67 A;  4Q0O A;  1N72 A;  4XYA A;  5EU1 A;  5IG6 A;  4QR5 A;  5CGP A;  2I7K A;  4QST A;  5IGM A;  4HBX A;  4YYI A;  4YYD A;  5H85 A;  3MB3 A;  4IOQ A;  4QEW A;  5FG4 A;  4O7C A;  4YYJ A;  4O7A A;  5CRM A;  2YEM A;  4Z93 A;  4F3I A;  4NYW A;  5CUD A;  4YAT A;  4O78 A;  4HXN A;  2RNY A;  4UIU A;  5CU8 A;  3O35 A;  5I83 A;  1JSP B;  3U5K A;  4HXM A;  3GG3 A;  4NXJ A;  4RVR A;  4PCI A;  5FFV A;  4UIX A;  5I40 A;  4BJX A;  3FKM X;  3O33 A;  4YYG A;  5CP5 A;  5I7Y A;  4CFK A;  5FE8 A;  5AD3 A;  4UIT A;  2WP2 A;  4Z6H A;  3JVK A;  4QSS A;  4LYI A;  5CTL A;  5EA1 A;  5F2P A;  4MEN A;  3QZT A;  4TT6 A;  2F6N A;  5CUC A;  5IID A;  5LUU A;  4QBM A;  3MB4 A;  4HXL A;  5D24 A;  4Z1S A;  4Z1Q A;  5F60 A;  4NUE A;  5KTW A;  5ENJ A;  3UVW A;  5CQ5 A;  4UIV A;  4YY4 A;  4QR3 A;  4PCE A;  5CUE A;  5LKT A;  4ALH A;  5DY7 A;  3P1F A;  4LC2 A;  2RO1 A;  5CUA A;  4CFL A;  5BT3 A;  5L8U A;  2YDW A;  5I80 A;  5LVR A;  5FG5 A;  3SVG A;  4KV1 A;  4N4G A;  4BW4 A;  5CFW A;  4A9M A;  4UYD A;  2YW5 A;  5HQ7 A;  3DWY A;  4TYL A;  4YYN A;  4O75 A;  2R0S A;  4A9E A;  5KHM A;  2YQD A;  3UV4 A;  4TT2 A;  4Z6I A;  5ENH A;  4A9N A;  5HLS A;  5FE9 A;  3JVJ A;  3U5O A;  3HMH A;  5F61 A;  4NUD A;  5F3A A;  5I29 A;  4QSV A;  3HME A;  5DYU A;  2R10 A;  4YH4 A;  5C87 A;  5FFY A;  5EV9 A;  3LQJ A;  4QYL A;  4QY4 A;  2FSA A;  4YYH A;  4QEV A;  4QSP A;  4QZS A;  5C4Q A;  5FBX A;  4NRB A;  2D82 A;  2YEL A;  5FH6 A;  4X2I A;  4XUA A;  4TZ2 A;  5E7D A;  4IR6 A;  5FE2 A;  4QNS A;  3D7C A;  5F63 A;  5FE7 A;  5LJ0 A;  5EIC A;  4J0S A;  4YYM A;  5D0C A;  4O76 A;  4NR9 A;  1JM4 B;  2GRC A;  3HMF A;  5LJ1 A;  5J0D A;  5JWM A;  5C89 A;  5HQ6 A;  5HQ5 A;  2OSS A;  4LYW A;  4QC1 A;  3MXF A;  5DW1 A;  4CLB A;  4IR4 A;  4N4H A;  4NUC A;  5BT5 A;  4YAX A;  4TS8 A;  5H1U A;  4NR5 A;  4NR4 A;  4QR4 A;  4QB3 A;  5IGK A;  4TU4 A;  5EWD A;  5G4R A;  4NQM A;  5CRZ A;  4J1P A;  4YBM A;  4GPJ A;  4PKL A;  5EK9 A;  5FH8 A;  5FG6 A;  3JVM A;  4WIV A;  4YH3 A;  4A9H A;  5FB1 A;  5FE4 A;  4MR3 A;  4ZW1 A;  4NR8 A;  4QYD A;  5HEN A;  3P1E A;  1WUM A;  5CQ3 A;  5FE5 A;  4J0R A;  5DYX A;  3MQM A;  4TT4 A;  5E9V A;  5ENE A;  4J3I A;  4N4I A;  4MEQ A;  3UVD A;  5K29 A;  5E3D A;  4UIW A;  5DX4 A;  4NR7 A;  3LQI A;  5EQ1 A;  5KO4 A;  5D3P A;  5AD2 A;  3U5M A;  5CUB A;  2RS9 B;  5DLZ A;  2LSP B;  5HFQ A;  4HXS A;  5A81 A;  5DBM A;  2RFJ A;  4ALG A;  5LVQ A;  4WHU A;  2N9G A;  3IU6 A;  5F25 A;  4UIZ A;  4LZ2 A;  3QZV A;  5DKC A;  5E73 A;  5ENB A;  2RNX A;  5HRW A;  2DVV A;  5AMF A;  5IGN A;  2DVR A;  5EWW A;  4C66 A;  2OO1 A;  2DAT A;  4BHW A;  4UIY A;  5A5P A;  4YAB A;  5EPS A;  4BW3 A;  5EGU A;  4O71 A;  5DKD A;  5L8T A;  5A7C A;  5ETD A;  5F1H A;  3UVX A;  4NRA A;  3Q2E A;  5D3N A;  4UYF B;  2YEK A;  5G4S A;  5F62 A;  3G0J A;  4HBY A;  5D3S A;  4MR6 A;  1EQF A;  5A5Q A;  4PY6 A;  4QSW A;  3Q2F A;  3LQH A;  5LJ2 A;  5EI4 A;  4TQN A;  2DVS A;  5EM3 A;  4O7E A;  4O72 A;  3ZYU A;  3SVF A;  5DFC A;  5HM0 A;  4AKN A;  3MUL A;  5A5R A;  4CUT A;  4QEU A;  3S92 A;  4BW2 A;  4LYS A;  4CUQ A;  5KU3 A;  5EPR A; 
#chains in the Genus database with same CATH topology
 4QSX A;  2L5E A;  5KTX A;  4PS5 A;  4LDF A;  4KV4 A;  5HRX A;  4UYG A;  5LKU A;  3U5P A;  4YYK A;  3IU5 A;  3U5N A;  4IR3 A;  2WP1 A;  5CQ8 A;  3UV5 A;  1X0J A;  5L99 A;  5HRV A;  4UYH A;  5I89 A;  5FE6 A;  3RCW A;  5A82 A;  4A9J A;  5E74 A;  5FE0 A;  3AAD A;  4WHW A;  4E96 A;  4IOO A;  5I86 A;  1F68 A;  5F5Z A;  4CUP A;  4QUU A;  4MEO A;  4DON A;  4ZQL A;  4YBT A;  5CY9 A;  4O74 A;  2DWW A;  2D9E A;  4TZ8 A;  5DKH A;  3VKH A;  2KTB B;  5E9Y A;  5II1 A;  4ZC9 A;  4NYV A;  4A9L A;  4OUF A;  2G4A A;  4CUR A;  4QSQ A;  4YY6 A;  4O70 A;  3NXB A;  4QUT A;  5FE3 A;  4HXO A;  4LR6 A;  2YYN A;  5CQ7 A;  3I3J A;  4MR4 A;  5C7N A;  3O34 A;  5EWV A;  5FB0 A;  5I7X A;  3TLP A;  4MEP A;  4HXR A;  2DKW A;  4LZS A;  5FE1 A;  4Q0N A;  4XY8 A;  5DYC A;  2MJV B;  5E9M A;  5ENG A;  5ACY A;  5CS8 A;  3K2J A;  4HBW A;  4YBS A;  5C85 A;  4IOR A;  3O37 A;  1WUG A;  5HEL A;  4CL9 A;  5EVA A;  4TTE A;  5HEM A;  5CQ6 A;  5AME A;  5I1Q A;  4A9O A;  5BT4 A;  2I8N A;  5HCL A;  3AQA A;  2EJN A;  2R0Y A;  5EWH A;  5IGL A;  5F1L A;  3P1C A;  3D1D A;  5H1T A;  4HBV A;  4QC3 A;  5ENC A;  4A9F A;  1E6I A;  2E7O A;  4IR5 A;  5D7X A;  2OUO A;  3O36 A;  5F36 A;  5IBN A;  2F6J A;  5FH7 A;  5D3H A;  5ENF A;  5II2 A;  5A5O A;  2NXB A;  4N4F A;  3G0L A;  4CUU A;  5E0R A;  2R0V A;  2RNW A;  5ETB A;  3U5L A;  5A83 A;  3U5J A;  5EPB A;  5HJC A;  5D3J A;  4A9I A;  4QSR A;  4OGI A;  5DLX A;  4HXP A;  4AI6 A;  3P1D A;  5D3L A;  3UW9 A;  4LRG A;  5KTU A;  2E7N A;  3DAI A;  4OGJ A;  2DVQ A;  4O7B A;  5E9L A;  3JVL A;  4NS5 A;  5EIS A;  4A9K A;  4AKH A;  5EWC A;  4NRC A;  5E9K A;  5LKZ A;  5E9I A;  4UYE A;  4NYX A;  4UYF A;  5DFB A;  4YC9 A;  5ENI A;  2RI7 A;  5CUG A;  5C8G A;  5TB6 A;  2E3K A;  4O77 A;  3S91 A;  5A5S A;  5A5N A;  5DYA A;  3MUK A;  3LXJ A;  4PTB A;  4XUB A;  5D3R A;  3P5O A;  5DW2 A;  5H1V A;  3UVY A;  3QZS A;  5CQ4 A;  4CUS A;  5D3T A;  5CPE A;  4XY9 A;  5LKX A;  4NR6 A;  5EP7 A;  4N3W A;  3UV2 A;  5JI8 A;  5D26 A;  5CZG A;  5CQT A;  5A85 A;  4BW1 A;  4LZR A;  2H60 A;  4MR5 A;  5L97 A;  5I88 A;  5D25 A;  5HFR A;  4QSU A;  5DFD A;  5TCM A;  4NQN A;  3LJW A;  5FFW A;  2L84 A;  4HXK A;  4KCX A;  4TU6 A;  4Y03 A;  5COI A;  5E3G A;  5L96 A;  5CQA A;  4YAD A;  4YK0 A;  3SVH A;  2L85 A;  3ONI A;  5FDZ A;  1ZS5 A;  4FLP A;  4O7F A;  5L98 A;  4C67 A;  4Q0O A;  1N72 A;  4XYA A;  5EU1 A;  5IG6 A;  4QR5 A;  5CGP A;  2I7K A;  4QST A;  5IGM A;  4HBX A;  4YYI A;  4YYD A;  5H85 A;  3MB3 A;  4IOQ A;  4QEW A;  5FG4 A;  4O7C A;  4YYJ A;  4O7A A;  5CRM A;  2YEM A;  4Z93 A;  4F3I A;  4NYW A;  5CUD A;  4YAT A;  4O78 A;  4HXN A;  2RNY A;  4UIU A;  5CU8 A;  3O35 A;  5I83 A;  1JSP B;  3U5K A;  4HXM A;  3GG3 A;  4NXJ A;  4RVR A;  3D1B A;  4PCI A;  5FFV A;  4UIX A;  5I40 A;  4BJX A;  3FKM X;  3O33 A;  4YYG A;  5CP5 A;  5I7Y A;  4CFK A;  5FE8 A;  5AD3 A;  4UIT A;  2WP2 A;  4Z6H A;  3JVK A;  4QSS A;  4LYI A;  5CTL A;  5EA1 A;  5F2P A;  4MEN A;  3QZT A;  4TT6 A;  2F6N A;  5CUC A;  5IID A;  5LUU A;  4QBM A;  3MB4 A;  4HXL A;  5D24 A;  4Z1S A;  4Z1Q A;  5F60 A;  4NUE A;  5KTW A;  5ENJ A;  3UVW A;  5CQ5 A;  4UIV A;  4YY4 A;  4QR3 A;  4PCE A;  5CUE A;  5LKT A;  4ALH A;  5DY7 A;  3P1F A;  4LC2 A;  2RO1 A;  5CUA A;  4CFL A;  5BT3 A;  5L8U A;  2YDW A;  5I80 A;  5LVR A;  5FG5 A;  3SVG A;  4KV1 A;  4N4G A;  4BW4 A;  5CFW A;  4A9M A;  4UYD A;  2YW5 A;  5HQ7 A;  3DWY A;  4TYL A;  4YYN A;  4O75 A;  2R0S A;  4A9E A;  5KHM A;  2YQD A;  3UV4 A;  4TT2 A;  4Z6I A;  5ENH A;  4A9N A;  5HLS A;  5FE9 A;  3JVJ A;  3U5O A;  3HMH A;  5F61 A;  4NUD A;  5F3A A;  5I29 A;  4QSV A;  3HME A;  5DYU A;  2R10 A;  4YH4 A;  5C87 A;  5FFY A;  5EV9 A;  3LQJ A;  4QYL A;  4QY4 A;  2FSA A;  4YYH A;  4QEV A;  4QSP A;  4QZS A;  5C4Q A;  5FBX A;  1ZKR A;  4NRB A;  2D82 A;  2YEL A;  5FH6 A;  4X2I A;  4XUA A;  4TZ2 A;  5E7D A;  4IR6 A;  5FE2 A;  4QNS A;  3D7C A;  5F63 A;  5FE7 A;  5LJ0 A;  5EIC A;  4J0S A;  4YYM A;  5D0C A;  4O76 A;  4NR9 A;  1JM4 B;  2GRC A;  3HMF A;  5LJ1 A;  5J0D A;  5JWM A;  5C89 A;  5HQ6 A;  5HQ5 A;  2OSS A;  4LYW A;  4QC1 A;  3MXF A;  5DW1 A;  4CLB A;  4IR4 A;  4N4H A;  4NUC A;  5BT5 A;  4YAX A;  4TS8 A;  5H1U A;  4NR5 A;  4NR4 A;  4QR4 A;  4QB3 A;  5IGK A;  4TU4 A;  5EWD A;  5G4R A;  4NQM A;  5CRZ A;  4J1P A;  4YBM A;  4GPJ A;  4PKL A;  5EK9 A;  5FH8 A;  5FG6 A;  3JVM A;  4WIV A;  4YH3 A;  4A9H A;  5FB1 A;  5FE4 A;  4MR3 A;  4ZW1 A;  4NR8 A;  4AKI A;  4QYD A;  5HEN A;  3P1E A;  1WUM A;  5CQ3 A;  5FE5 A;  4J0R A;  5DYX A;  3MQM A;  4TT4 A;  5E9V A;  5ENE A;  4J3I A;  4N4I A;  4MEQ A;  3UVD A;  5K29 A;  5E3D A;  4UIW A;  5DX4 A;  4NR7 A;  3LQI A;  5EQ1 A;  5KO4 A;  5D3P A;  3VKG A;  5AD2 A;  3U5M A;  5CUB A;  2RS9 B;  5DLZ A;  2LSP B;  5HFQ A;  4HXS A;  5A81 A;  5DBM A;  2RFJ A;  4ALG A;  5LVQ A;  4WHU A;  4AKG A;  2N9G A;  3IU6 A;  5F25 A;  4UIZ A;  4LZ2 A;  3QZV A;  5DKC A;  5E73 A;  5ENB A;  2RNX A;  5HRW A;  2DVV A;  5AMF A;  5IGN A;  2DVR A;  5EWW A;  4C66 A;  2OO1 A;  2DAT A;  4BHW A;  4UIY A;  5A5P A;  4YAB A;  5EPS A;  4BW3 A;  5EGU A;  4O71 A;  5DKD A;  5L8T A;  5A7C A;  5ETD A;  5F1H A;  3UVX A;  4NRA A;  3Q2E A;  5D3N A;  4UYF B;  2YEK A;  5G4S A;  5F62 A;  3G0J A;  4HBY A;  5D3S A;  4MR6 A;  1EQF A;  5A5Q A;  4PY6 A;  4QSW A;  3Q2F A;  3LQH A;  5LJ2 A;  5EI4 A;  4TQN A;  2DVS A;  5EM3 A;  4O7E A;  4O72 A;  3ZYU A;  3ERR A;  3SVF A;  1PUO A;  5DFC A;  5HM0 A;  4AKN A;  3MUL A;  5A5R A;  4CUT A;  4QEU A;  3S92 A;  4BW2 A;  4LYS A;  4CUQ A;  5KU3 A;  5EPR A; 
#chains in the Genus database with same CATH homology
 4QSX A;  2L5E A;  5KTX A;  4PS5 A;  4LDF A;  4KV4 A;  5HRX A;  4UYG A;  5LKU A;  3U5P A;  4YYK A;  3IU5 A;  3U5N A;  4IR3 A;  2WP1 A;  5CQ8 A;  3UV5 A;  1X0J A;  5L99 A;  5HRV A;  4UYH A;  5I89 A;  5FE6 A;  3RCW A;  5A82 A;  4A9J A;  5E74 A;  5FE0 A;  3AAD A;  4WHW A;  4E96 A;  4IOO A;  5I86 A;  1F68 A;  5F5Z A;  4CUP A;  4QUU A;  4MEO A;  4DON A;  4ZQL A;  4YBT A;  5CY9 A;  4O74 A;  2DWW A;  2D9E A;  4TZ8 A;  5DKH A;  2KTB B;  5E9Y A;  5II1 A;  4ZC9 A;  4NYV A;  4A9L A;  4OUF A;  2G4A A;  4CUR A;  4QSQ A;  4YY6 A;  4O70 A;  3NXB A;  4QUT A;  5FE3 A;  4HXO A;  4LR6 A;  2YYN A;  5CQ7 A;  3I3J A;  4MR4 A;  5C7N A;  3O34 A;  5EWV A;  5FB0 A;  5I7X A;  3TLP A;  4MEP A;  4HXR A;  2DKW A;  4LZS A;  5FE1 A;  4Q0N A;  4XY8 A;  5DYC A;  2MJV B;  5E9M A;  5ENG A;  5ACY A;  5CS8 A;  3K2J A;  4HBW A;  4YBS A;  5C85 A;  4IOR A;  3O37 A;  1WUG A;  5HEL A;  4CL9 A;  5EVA A;  4TTE A;  5HEM A;  5CQ6 A;  5AME A;  5I1Q A;  4A9O A;  5BT4 A;  2I8N A;  5HCL A;  3AQA A;  5EWH A;  2R0Y A;  5IGL A;  5F1L A;  3P1C A;  5H1T A;  4HBV A;  4QC3 A;  5ENC A;  4A9F A;  1E6I A;  2E7O A;  4IR5 A;  5D7X A;  2OUO A;  3O36 A;  5F36 A;  5IBN A;  2F6J A;  5FH7 A;  5D3H A;  5ENF A;  5II2 A;  5A5O A;  2NXB A;  4N4F A;  3G0L A;  4CUU A;  5E0R A;  2R0V A;  2RNW A;  5ETB A;  3U5L A;  5A83 A;  3U5J A;  5EPB A;  5HJC A;  5D3J A;  4A9I A;  4QSR A;  4OGI A;  5DLX A;  4HXP A;  3P1D A;  5D3L A;  3UW9 A;  4LRG A;  5KTU A;  2E7N A;  3DAI A;  4OGJ A;  2DVQ A;  4O7B A;  5E9L A;  3JVL A;  4NS5 A;  5EIS A;  4A9K A;  5EWC A;  4NRC A;  5E9K A;  5LKZ A;  5E9I A;  4UYE A;  4NYX A;  4UYF A;  5DFB A;  4YC9 A;  5ENI A;  2RI7 A;  5CUG A;  5C8G A;  5TB6 A;  2E3K A;  4O77 A;  3S91 A;  5A5S A;  5A5N A;  5DYA A;  3MUK A;  3LXJ A;  4PTB A;  4XUB A;  5D3R A;  3P5O A;  5DW2 A;  5H1V A;  3UVY A;  3QZS A;  5CQ4 A;  4CUS A;  5D3T A;  5CPE A;  4XY9 A;  5LKX A;  4NR6 A;  5EP7 A;  4N3W A;  3UV2 A;  5JI8 A;  5D26 A;  5CZG A;  5CQT A;  5A85 A;  4BW1 A;  4LZR A;  2H60 A;  4MR5 A;  5L97 A;  5I88 A;  5D25 A;  5HFR A;  4QSU A;  5DFD A;  5TCM A;  4NQN A;  3LJW A;  5FFW A;  2L84 A;  4HXK A;  4KCX A;  4TU6 A;  4Y03 A;  5COI A;  5E3G A;  5L96 A;  5CQA A;  4YAD A;  4YK0 A;  3SVH A;  2L85 A;  3ONI A;  5FDZ A;  1ZS5 A;  4FLP A;  4O7F A;  5L98 A;  4C67 A;  4Q0O A;  1N72 A;  4XYA A;  5EU1 A;  5IG6 A;  4QR5 A;  5CGP A;  2I7K A;  4QST A;  5IGM A;  4HBX A;  4YYI A;  4YYD A;  5H85 A;  3MB3 A;  4IOQ A;  4QEW A;  5FG4 A;  4O7C A;  4YYJ A;  4O7A A;  5CRM A;  2YEM A;  4Z93 A;  4F3I A;  4NYW A;  5CUD A;  4YAT A;  4O78 A;  4HXN A;  2RNY A;  4UIU A;  5CU8 A;  3O35 A;  5I83 A;  1JSP B;  3U5K A;  4HXM A;  3GG3 A;  4NXJ A;  4RVR A;  4PCI A;  5FFV A;  4UIX A;  5I40 A;  4BJX A;  3FKM X;  3O33 A;  4YYG A;  5CP5 A;  5I7Y A;  4CFK A;  5FE8 A;  5AD3 A;  4UIT A;  2WP2 A;  4Z6H A;  3JVK A;  4QSS A;  4LYI A;  5CTL A;  5EA1 A;  5F2P A;  4MEN A;  3QZT A;  4TT6 A;  2F6N A;  5CUC A;  5IID A;  5LUU A;  4QBM A;  3MB4 A;  4HXL A;  5D24 A;  4Z1S A;  4Z1Q A;  5F60 A;  4NUE A;  5KTW A;  5ENJ A;  3UVW A;  5CQ5 A;  4UIV A;  4YY4 A;  4QR3 A;  4PCE A;  5CUE A;  5LKT A;  4ALH A;  5DY7 A;  3P1F A;  4LC2 A;  2RO1 A;  5CUA A;  4CFL A;  5BT3 A;  5L8U A;  2YDW A;  5I80 A;  5LVR A;  5FG5 A;  3SVG A;  4KV1 A;  4N4G A;  4BW4 A;  5CFW A;  4A9M A;  4UYD A;  2YW5 A;  5HQ7 A;  3DWY A;  4TYL A;  4YYN A;  4O75 A;  2R0S A;  4A9E A;  5KHM A;  2YQD A;  3UV4 A;  4TT2 A;  4Z6I A;  5ENH A;  4A9N A;  5HLS A;  5FE9 A;  3JVJ A;  3U5O A;  3HMH A;  5F61 A;  4NUD A;  5F3A A;  5I29 A;  4QSV A;  3HME A;  5DYU A;  2R10 A;  4YH4 A;  5C87 A;  5FFY A;  5EV9 A;  3LQJ A;  4QYL A;  4QY4 A;  2FSA A;  4YYH A;  4QEV A;  4QSP A;  4QZS A;  5C4Q A;  5FBX A;  4NRB A;  2D82 A;  2YEL A;  5FH6 A;  4X2I A;  4XUA A;  4TZ2 A;  5E7D A;  4IR6 A;  5FE2 A;  4QNS A;  3D7C A;  5F63 A;  5FE7 A;  5LJ0 A;  5EIC A;  4J0S A;  4YYM A;  5D0C A;  4O76 A;  4NR9 A;  1JM4 B;  2GRC A;  3HMF A;  5LJ1 A;  5J0D A;  5JWM A;  5C89 A;  5HQ6 A;  5HQ5 A;  2OSS A;  4LYW A;  4QC1 A;  3MXF A;  5DW1 A;  4CLB A;  4IR4 A;  4N4H A;  4NUC A;  5BT5 A;  4YAX A;  4TS8 A;  5H1U A;  4NR5 A;  4NR4 A;  4QR4 A;  4QB3 A;  5IGK A;  4TU4 A;  5EWD A;  5G4R A;  4NQM A;  5CRZ A;  4J1P A;  4YBM A;  4GPJ A;  4PKL A;  5EK9 A;  5FH8 A;  5FG6 A;  3JVM A;  4WIV A;  4YH3 A;  4A9H A;  5FB1 A;  5FE4 A;  4MR3 A;  4ZW1 A;  4NR8 A;  4QYD A;  5HEN A;  3P1E A;  1WUM A;  5CQ3 A;  5FE5 A;  4J0R A;  5DYX A;  3MQM A;  4TT4 A;  5E9V A;  5ENE A;  4J3I A;  4N4I A;  4MEQ A;  3UVD A;  5K29 A;  5E3D A;  4UIW A;  5DX4 A;  4NR7 A;  3LQI A;  5EQ1 A;  5KO4 A;  5D3P A;  5AD2 A;  3U5M A;  5CUB A;  2RS9 B;  5DLZ A;  2LSP B;  5HFQ A;  4HXS A;  5A81 A;  5DBM A;  2RFJ A;  4ALG A;  5LVQ A;  4WHU A;  2N9G A;  3IU6 A;  5F25 A;  4UIZ A;  4LZ2 A;  3QZV A;  5DKC A;  5E73 A;  5ENB A;  2RNX A;  5HRW A;  2DVV A;  5AMF A;  5IGN A;  2DVR A;  5EWW A;  4C66 A;  2OO1 A;  2DAT A;  4BHW A;  4UIY A;  5A5P A;  4YAB A;  5EPS A;  4BW3 A;  5EGU A;  4O71 A;  5DKD A;  5L8T A;  5A7C A;  5ETD A;  5F1H A;  3UVX A;  4NRA A;  3Q2E A;  5D3N A;  4UYF B;  2YEK A;  5G4S A;  5F62 A;  3G0J A;  4HBY A;  5D3S A;  4MR6 A;  1EQF A;  5A5Q A;  4PY6 A;  4QSW A;  3Q2F A;  3LQH A;  5LJ2 A;  5EI4 A;  4TQN A;  2DVS A;  5EM3 A;  4O7E A;  4O72 A;  3ZYU A;  3SVF A;  5DFC A;  5HM0 A;  4AKN A;  3MUL A;  5A5R A;  4CUT A;  4QEU A;  3S92 A;  4BW2 A;  4LYS A;  4CUQ A;  5KU3 A;  5EPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...