2D9EA

Solution structure of the bromodomain of peregrin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
GSSGSSGFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Peregrin
publication title Solution structure of the Bromodomain of Peregrin
rcsb
source organism Homo sapiens
total genus 27
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2005-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2d9eA00
4BW1A 5H85A 5KO4A 3O36A 4N4IA 5E3DA 1ZS5A 1F68A 5BT4A 3HMFA 3HMEA 3IU5A 3NXBA 5CTLA 4XY9A 3LQHA 4NRCA 2RFJA 4NR6A 5L8TA 3ZYUA 5I86A 4QYDA 5CQ8A 4IOQA 3JVKA 4YY6A 3MQMA 5CUDA 5CUAA 3Q2FA 4UIZA 4QC1A 4O77A 5AMFA 4UIUA 3JVLA 3QZTA 5F61A 5CUGA 5D3TA 4TT6A 4XYAA 5EU1A 5C89A 5HCLA 5CQ3A 5E9KA 3RCWA 4PCEA 4TT2A 5D7XA 4HXLA 3UVWA 5HENA 3O34A 5FE0A 4HXNA 2DVSA 5C85A 4QUTA 5FB1A 4QR5A 3QZVA 5JWMA 4NYXA 4RVRA 4ZC9A 4YBMA 5DBMA 3UV2A 5F62A 4HBVA 5HEMA 4CUSA 2OSSA 5EWDA 5FE1A 5D0CA 5CQ7A 5DLXA 5IBNA 5EPRA 4NR7A 4A9LA 4O7FA 1WUGA 2R0VA 4QZSA 5DY7A 4MR4A 4YYHA 5F1HA 2DWWA 4IR3A 4IR6A 5FE2A 2YQDA 5TCMA 5FFVA 5BT3A 3MUKA 4QSUA 4Q0NA 2D9EA 2L85A 5EPBA 5A5QA 5LKXA 5CUCA 4N4FA 4UYFB 4J3IA 4YADA 4Z6HA 5CQ5A 5HRWA 5L98A 4DONA 4OGJA 2N9GA 4TQNA 5DYUA 4IR4A 3G0LA 5K29A 5ENHA 5E9YA 4QUUA 4N4HA 5A83A 4TS8A 5DYXA 4WHUA 5FE5A 3IU6A 3MB3A 2L5EA 3O35A 5DKHA 4QSSA 5DFCA 5A5RA 4O78A 4NR5A 3U5LA 3O37A 4O7AA 4UITA 5HFQA 4HXSA 2DVRA 4BW3A 4N3WA 4XUAA 3P1EA 3I3JA 4J0SA 4J0RA 5D25A 4QSVA 4AKNA 5LJ0A 2DATA 3JVMA 5ENIA 5HLSA 5CRZA 4LC2A 5D26A 5HJCA 4CUQA 5HM0A 4MENA 5FDZA 3P1DA 4NRAA 3FKMX 4YABA 4TZ2A 4NQNA 5FE4A 4Z93A 2YELA 5ENGA 4LZRA 2OUOA 5FG6A 5EP7A 4NR4A 5HQ5A 5LJ1A 2F6NA 4C66A 5AD2A 5F60A 4A9OA 4UIYA 2FSAA 5KU3A 5E9IA 4TTEA 2R0YA 4UIVA 5DW2A 2RS9B 5FFWA 2RNXA 4J1PA 2RO1A 5I7XA 4QEUA 1N72A 5H1TA 5DYAA 5AMEA 4QC3A 2I8NA 3GG3A 4QYLA 4LDFA 5L8UA 4TU6A 5I83A 5ENJA 4NUEA 4NXJA 5H1UA 4QR4A 3O33A 3UV5A 4UYGA 4YH4A 5EV9A 2YEMA 5F36A 5DKCA 5AD3A 4LYWA 5EWHA 4LR6A 5A5PA 4QSWA 2DVVA 3QZSA 4O75A 5ETDA 4YBSA 5FBXA 4O7CA 5J0DA 5IG6A 3P1FA 5TB6A 3LXJA 2R10A 5HRXA 5D3HA 5DFBA 4Q0OA 5FB0A 2DVQA 4MEPA 4PS5A 5D3SA 4A9NA 4XUBA 5A5NA 2YDWA 5FE6A 4YYDA 5I29A 5CQ6A 5KHMA 4WHWA 4O71A 4YYIA 3UW9A 5L97A 3LQJA 5BT5A 5C4QA 4YAXA 4QNSA 4IORA 5LKZA 4WIVA 4CL9A 5FH8A 5ENCA 5CP5A 5HQ6A 5CQTA 4HXRA 5HELA 5CZGA 4A9IA 5EWCA 4LRGA 4HXKA 3UVYA 3U5OA 5L99A 4IR5A 5A85A 4O70A 5EVAA 5ENFA 5F3AA 5ENEA 5CPEA 4NUCA 4PY6A 5F63A 5I7YA 5I80A 5G4RA 4UYHA 5CRMA 4NS5A 4YH3A 2YEKA 5F5ZA 5KTXA 4NR9A 3DWYA 3SVGA 3UV4A 5EICA 2D82A 4CURA 4UYDA 4TU4A 4BW2A 5G4SA 4C67A 4A9EA 4X2IA 4MR3A 4KCXA 5D3RA 3K2JA 5ACYA 5DLZA 5FG4A 4CUPA 5FE3A 4NRBA 4LZ2A 4QEWA 2KTBB 4HBYA 5I40A 5KTUA 4FLPA 5DW1A 5E9VA 5IGLA 4YYGA 3MXFA 2MJVB 3U5NA 5A82A 3D7CA 3UVDA 4HXMA 5FFYA 4A9JA 4ZQLA 5LUUA 2R0SA 4Z1QA 4NYVA 5IGMA 5F1LA 5IGNA 5IGKA 5FG5A 4NR8A 5DYCA 5E74A 5CUBA 4ALGA 3U5JA 4YYNA 4A9FA 4PCIA 5A81A 1X0JA 2YW5A 4KV4A 2H60A 5CU8A 4F3IA 2RNYA 4E96A 2RNWA 4OGIA 4QSPA 2RI7A 5F25A 4LZSA 4CFLA 5LKUA 2NXBA 2YYNA 2I7KA 5I1QA 5C87A 5II2A 5DFDA 5COIA 3U5MA 5I88A 5D3LA 4PTBA 4QB3A 5CGPA 5EA1A 4A9HA 3AQAA 4A9MA 5IIDA 4O7EA 5I89A 2L84A 4TT4A 4O74A 5EWWA 4Z6IA 5HFRA 5A5SA 5F2PA 5FE7A 4CFKA 4YK0A 3TLPA 3S92A 3G0JA 5FE8A 4TYLA 4UIWA 4O72A 4PKLA 4YY4A 5EM3A 3Q2EA 4TZ8A 4YYJA 5D3NA 4ALHA 4YYKA 5DKDA 4IOOA 5EWVA 5EGUA 4BW4A 4QSTA 5D24A 4YC9A 3DAIA 5E3GA 5LKTA 4OUFA 4QSXA 4BJXA 3P1CA 4HBXA 2WP2A 5EPSA 3AADA 4MEQA 5FH6A 4CUUA 5FH7A 4QBMA 3U5KA 3LJWA 4GPJA 3ONIA 5A5OA 4ZW1A 4MR6A 3S91A 4O7BA 5HRVA 5E73A 5EI4A 5CQAA 4BHWA 5ENBA 5CUEA 5KTWA 1WUMA 5E7DA 4YATA 5D3JA 5CQ4A 5CY9A 4QEVA 5D3PA 4YBTA 4UYEA 5LVRA 2E7OA 4NQMA 3UVXA 4HBWA 4MEOA 4MR5A 2WP1A 4UYFA 4UIXA 1EQFA 3LQIA 5II1A 4KV1A 2LSPB 5JI8A 4O76A 5EISA 4LYSA 5E9LA 2DKWA 4XY8A 3SVHA 4CLBA 4NUDA 5A7CA 3P5OA 5HQ7A 2G4AA 4HXOA 2E7NA 4YYMA 2F6JA 5LVQA 2GRCA 3HMHA 5ETBA 4NYWA 4Z1SA 5C7NA 4A9KA 5FE9A 5C8GA 4CUTA 2OO1A 4QY4A 5CFWA 4QSQA 2E3KA 4LYIA 5EK9A 5DX4A 5E9MA 5EQ1A 5H1VA 5E0RA 5L96A 3JVJA 3U5PA 4QR3A 1JSPB 4QSRA 1JM4B 3SVFA 3MB4A 5LJ2A 4N4GA 4Y03A 3MULA 1E6IA 4HXPA 5CS8A
chains in the Genus database with same CATH superfamily
4BW1A 5H85A 5KO4A 3O36A 4N4IA 5E3DA 1ZS5A 1F68A 5BT4A 3HMFA 3HMEA 3IU5A 3NXBA 5CTLA 4XY9A 3LQHA 4NRCA 2RFJA 4NR6A 5L8TA 3ZYUA 5I86A 4QYDA 5CQ8A 4IOQA 3JVKA 4YY6A 3MQMA 5CUDA 5CUAA 3Q2FA 4UIZA 4QC1A 4O77A 5AMFA 4UIUA 3JVLA 3QZTA 5F61A 5CUGA 5D3TA 4TT6A 4XYAA 5EU1A 5C89A 5HCLA 5CQ3A 5E9KA 3RCWA 4PCEA 4TT2A 5D7XA 4HXLA 3UVWA 5HENA 3O34A 5FE0A 4HXNA 2DVSA 5C85A 4QUTA 5FB1A 4QR5A 3QZVA 5JWMA 4NYXA 4RVRA 4ZC9A 4YBMA 5DBMA 3UV2A 5F62A 4HBVA 5HEMA 4CUSA 2OSSA 5EWDA 5FE1A 5D0CA 5CQ7A 5DLXA 5IBNA 5EPRA 4NR7A 4A9LA 4O7FA 1WUGA 2R0VA 4QZSA 5DY7A 4MR4A 4YYHA 5F1HA 2DWWA 4IR3A 4IR6A 5FE2A 2YQDA 5TCMA 5FFVA 5BT3A 3MUKA 4QSUA 4Q0NA 2D9EA 2L85A 5EPBA 5A5QA 5LKXA 5CUCA 4N4FA 4UYFB 4J3IA 4YADA 4Z6HA 5CQ5A 5HRWA 5L98A 4DONA 4OGJA 2N9GA 4TQNA 5DYUA 4IR4A 3G0LA 5K29A 5ENHA 5E9YA 4QUUA 4N4HA 5A83A 4TS8A 5DYXA 4WHUA 5FE5A 3IU6A 3MB3A 2L5EA 3O35A 5DKHA 4QSSA 5DFCA 5A5RA 4O78A 4NR5A 3U5LA 3O37A 4O7AA 4UITA 5HFQA 4HXSA 2DVRA 4BW3A 4N3WA 4XUAA 3P1EA 3I3JA 4J0SA 4J0RA 5D25A 4QSVA 4AKNA 5LJ0A 2DATA 3JVMA 5ENIA 5HLSA 5CRZA 4LC2A 5D26A 5HJCA 4CUQA 5HM0A 4MENA 5FDZA 3P1DA 4NRAA 3FKMX 4YABA 4TZ2A 4NQNA 5FE4A 4Z93A 2YELA 5ENGA 4LZRA 2OUOA 5FG6A 5EP7A 4NR4A 5HQ5A 5LJ1A 2F6NA 4C66A 5AD2A 5F60A 4A9OA 4UIYA 2FSAA 5KU3A 5E9IA 4TTEA 2R0YA 4UIVA 5DW2A 2RS9B 5FFWA 2RNXA 4J1PA 2RO1A 5I7XA 4QEUA 1N72A 3VKGA 5H1TA 5DYAA 5AMEA 4QC3A 2I8NA 3GG3A 4QYLA 4LDFA 5L8UA 4TU6A 5I83A 5ENJA 4NUEA 4NXJA 5H1UA 4QR4A 3O33A 3UV5A 4UYGA 4YH4A 4AI6A 5EV9A 2YEMA 5F36A 5DKCA 4AKIA 5AD3A 4LYWA 5EWHA 4LR6A 5A5PA 4QSWA 2DVVA 3QZSA 4O75A 5ETDA 4YBSA 5FBXA 4O7CA 5J0DA 5IG6A 3P1FA 5TB6A 3LXJA 2R10A 5HRXA 5D3HA 5DFBA 4Q0OA 5FB0A 2DVQA 4MEPA 4PS5A 5D3SA 4A9NA 4XUBA 5A5NA 2YDWA 5FE6A 4YYDA 5I29A 5CQ6A 5KHMA 4WHWA 4O71A 4YYIA 3UW9A 5L97A 3LQJA 5BT5A 5C4QA 4YAXA 4QNSA 4IORA 5LKZA 4WIVA 4CL9A 5FH8A 5ENCA 5CP5A 5HQ6A 5CQTA 4HXRA 5HELA 5CZGA 4AKHA 4A9IA 5EWCA 4LRGA 4HXKA 3UVYA 3U5OA 5L99A 4IR5A 5A85A 4O70A 5EVAA 5ENFA 5F3AA 5ENEA 5CPEA 4NUCA 4PY6A 5F63A 5I7YA 5I80A 5G4RA 3VKHA 4UYHA 5CRMA 4NS5A 3D1DA 4YH3A 2YEKA 5F5ZA 5KTXA 4NR9A 3DWYA 3SVGA 3UV4A 5EICA 2D82A 4CURA 4UYDA 4TU4A 4BW2A 5G4SA 4C67A 4A9EA 4X2IA 4MR3A 4KCXA 5D3RA 3K2JA 5ACYA 5DLZA 5FG4A 4CUPA 5FE3A 4NRBA 4LZ2A 4QEWA 2KTBB 4HBYA 5I40A 5KTUA 4FLPA 5DW1A 5E9VA 5IGLA 4YYGA 3MXFA 2MJVB 3U5NA 5A82A 3D7CA 3UVDA 4HXMA 5FFYA 4A9JA 4ZQLA 5LUUA 2R0SA 4Z1QA 4NYVA 5IGMA 5F1LA 5IGNA 5IGKA 5FG5A 4NR8A 5DYCA 5E74A 5CUBA 4ALGA 3U5JA 4YYNA 4A9FA 4PCIA 5A81A 1X0JA 2YW5A 4KV4A 2H60A 4AKGA 5CU8A 4F3IA 2RNYA 4E96A 2RNWA 4OGIA 4QSPA 2RI7A 5F25A 4LZSA 4CFLA 5LKUA 2NXBA 2YYNA 2I7KA 5I1QA 5C87A 5II2A 5DFDA 5COIA 3U5MA 5I88A 5D3LA 4PTBA 4QB3A 5CGPA 5EA1A 4A9HA 3AQAA 4A9MA 5IIDA 4O7EA 5I89A 2L84A 4TT4A 4O74A 5EWWA 4Z6IA 5HFRA 5A5SA 5F2PA 5FE7A 4CFKA 4YK0A 3TLPA 3S92A 3G0JA 5FE8A 4TYLA 4UIWA 4O72A 4PKLA 4YY4A 5EM3A 3Q2EA 4TZ8A 4YYJA 5D3NA 4ALHA 4YYKA 5DKDA 4IOOA 5EWVA 5EGUA 4BW4A 4QSTA 5D24A 4YC9A 3DAIA 5E3GA 5LKTA 4OUFA 4QSXA 4BJXA 3P1CA 4HBXA 2WP2A 5EPSA 3AADA 4MEQA 5FH6A 4CUUA 5FH7A 4QBMA 3U5KA 3LJWA 4GPJA 3ONIA 5A5OA 4ZW1A 4MR6A 3S91A 4O7BA 5HRVA 5E73A 5EI4A 5CQAA 4BHWA 1PUOA 5ENBA 5CUEA 5KTWA 1WUMA 5E7DA 4YATA 5D3JA 3D1BA 5CQ4A 5CY9A 4QEVA 5D3PA 4YBTA 4UYEA 5LVRA 2E7OA 4NQMA 3UVXA 3ERRA 4HBWA 4MEOA 4MR5A 2WP1A 4UYFA 4UIXA 1EQFA 3LQIA 5II1A 4KV1A 2LSPB 5JI8A 4O76A 5EISA 4LYSA 5E9LA 2DKWA 4XY8A 3SVHA 4CLBA 4NUDA 5A7CA 3P5OA 5HQ7A 2G4AA 4HXOA 2E7NA 4YYMA 2F6JA 5LVQA 2GRCA 3HMHA 5ETBA 2EJNA 4NYWA 4Z1SA 5C7NA 4A9KA 5FE9A 5C8GA 4CUTA 2OO1A 4QY4A 5CFWA 1ZKRA 4QSQA 2E3KA 4LYIA 5EK9A 5DX4A 5E9MA 5EQ1A 5H1VA 5E0RA 5L96A 3JVJA 3U5PA 4QR3A 1JSPB 4QSRA 1JM4B 3SVFA 3MB4A 5LJ2A 4N4GA 4Y03A 3MULA 1E6IA 4HXPA 5CS8A
chains in the Genus database with same CATH topology
4BW1A 5H85A 5KO4A 3O36A 4N4IA 5E3DA 1ZS5A 1F68A 5BT4A 3HMFA 3HMEA 3IU5A 3NXBA 5CTLA 4XY9A 3LQHA 4NRCA 2RFJA 4NR6A 5L8TA 3ZYUA 5I86A 4QYDA 5CQ8A 4IOQA 3JVKA 4YY6A 3MQMA 5CUDA 5CUAA 3Q2FA 4UIZA 4QC1A 4O77A 5AMFA 4UIUA 3JVLA 3QZTA 5F61A 5CUGA 5D3TA 4TT6A 4XYAA 5EU1A 5C89A 5HCLA 5CQ3A 5E9KA 3RCWA 4PCEA 4TT2A 5D7XA 4HXLA 3UVWA 5HENA 3O34A 5FE0A 4HXNA 2DVSA 5C85A 4QUTA 5FB1A 4QR5A 3QZVA 5JWMA 4NYXA 4RVRA 4ZC9A 4YBMA 5DBMA 3UV2A 5F62A 4HBVA 5HEMA 4CUSA 2OSSA 5EWDA 5FE1A 5D0CA 5CQ7A 5DLXA 5IBNA 5EPRA 4NR7A 4A9LA 4O7FA 1WUGA 2R0VA 4QZSA 5DY7A 4MR4A 4YYHA 5F1HA 2DWWA 4IR3A 4IR6A 5FE2A 2YQDA 5TCMA 5FFVA 5BT3A 3MUKA 4QSUA 4Q0NA 2D9EA 2L85A 5EPBA 5A5QA 5LKXA 5CUCA 4N4FA 4UYFB 4J3IA 4YADA 4Z6HA 5CQ5A 5HRWA 5L98A 4DONA 4OGJA 2N9GA 4TQNA 5DYUA 4IR4A 3G0LA 5K29A 5ENHA 5E9YA 4QUUA 4N4HA 5A83A 4TS8A 5DYXA 4WHUA 5FE5A 3IU6A 3MB3A 2L5EA 3O35A 5DKHA 4QSSA 5DFCA 5A5RA 4O78A 4NR5A 3U5LA 3O37A 4O7AA 4UITA 5HFQA 4HXSA 2DVRA 4BW3A 4N3WA 4XUAA 3P1EA 3I3JA 4J0SA 4J0RA 5D25A 4QSVA 4AKNA 5LJ0A 2DATA 3JVMA 5ENIA 5HLSA 5CRZA 4LC2A 5D26A 5HJCA 4CUQA 5HM0A 4MENA 5FDZA 3P1DA 4NRAA 3FKMX 4YABA 4TZ2A 4NQNA 5FE4A 4Z93A 2YELA 5ENGA 4LZRA 2OUOA 5FG6A 5EP7A 4NR4A 5HQ5A 5LJ1A 2F6NA 4C66A 5AD2A 5F60A 4A9OA 4UIYA 2FSAA 5KU3A 5E9IA 4TTEA 2R0YA 4UIVA 5DW2A 2RS9B 5FFWA 2RNXA 4J1PA 2RO1A 5I7XA 4QEUA 1N72A 5H1TA 5DYAA 5AMEA 4QC3A 2I8NA 3GG3A 4QYLA 4LDFA 5L8UA 4TU6A 5I83A 5ENJA 4NUEA 4NXJA 5H1UA 4QR4A 3O33A 3UV5A 4UYGA 4YH4A 5EV9A 2YEMA 5F36A 5DKCA 5AD3A 4LYWA 5EWHA 4LR6A 5A5PA 4QSWA 2DVVA 3QZSA 4O75A 5ETDA 4YBSA 5FBXA 4O7CA 5J0DA 5IG6A 3P1FA 5TB6A 3LXJA 2R10A 5HRXA 5D3HA 5DFBA 4Q0OA 5FB0A 2DVQA 4MEPA 4PS5A 5D3SA 4A9NA 4XUBA 5A5NA 2YDWA 5FE6A 4YYDA 5I29A 5CQ6A 5KHMA 4WHWA 4O71A 4YYIA 3UW9A 5L97A 3LQJA 5BT5A 5C4QA 4YAXA 4QNSA 4IORA 5LKZA 4WIVA 4CL9A 5FH8A 5ENCA 5CP5A 5HQ6A 5CQTA 4HXRA 5HELA 5CZGA 4A9IA 5EWCA 4LRGA 4HXKA 3UVYA 3U5OA 5L99A 4IR5A 5A85A 4O70A 5EVAA 5ENFA 5F3AA 5ENEA 5CPEA 4NUCA 4PY6A 5F63A 5I7YA 5I80A 5G4RA 4UYHA 5CRMA 4NS5A 4YH3A 2YEKA 5F5ZA 5KTXA 4NR9A 3DWYA 3SVGA 3UV4A 5EICA 2D82A 4CURA 4UYDA 4TU4A 4BW2A 5G4SA 4C67A 4A9EA 4X2IA 4MR3A 4KCXA 5D3RA 3K2JA 5ACYA 5DLZA 5FG4A 4CUPA 5FE3A 4NRBA 4LZ2A 4QEWA 2KTBB 4HBYA 5I40A 5KTUA 4FLPA 5DW1A 5E9VA 5IGLA 4YYGA 3MXFA 2MJVB 3U5NA 5A82A 3D7CA 3UVDA 4HXMA 5FFYA 4A9JA 4ZQLA 5LUUA 2R0SA 4Z1QA 4NYVA 5IGMA 5F1LA 5IGNA 5IGKA 5FG5A 4NR8A 5DYCA 5E74A 5CUBA 4ALGA 3U5JA 4YYNA 4A9FA 4PCIA 5A81A 1X0JA 2YW5A 4KV4A 2H60A 5CU8A 4F3IA 2RNYA 4E96A 2RNWA 4OGIA 4QSPA 2RI7A 5F25A 4LZSA 4CFLA 5LKUA 2NXBA 2YYNA 2I7KA 5I1QA 5C87A 5II2A 5DFDA 5COIA 3U5MA 5I88A 5D3LA 4PTBA 4QB3A 5CGPA 5EA1A 4A9HA 3AQAA 4A9MA 5IIDA 4O7EA 5I89A 2L84A 4TT4A 4O74A 5EWWA 4Z6IA 5HFRA 5A5SA 5F2PA 5FE7A 4CFKA 4YK0A 3TLPA 3S92A 3G0JA 5FE8A 4TYLA 4UIWA 4O72A 4PKLA 4YY4A 5EM3A 3Q2EA 4TZ8A 4YYJA 5D3NA 4ALHA 4YYKA 5DKDA 4IOOA 5EWVA 5EGUA 4BW4A 4QSTA 5D24A 4YC9A 3DAIA 5E3GA 5LKTA 4OUFA 4QSXA 4BJXA 3P1CA 4HBXA 2WP2A 5EPSA 3AADA 4MEQA 5FH6A 4CUUA 5FH7A 4QBMA 3U5KA 3LJWA 4GPJA 3ONIA 5A5OA 4ZW1A 4MR6A 3S91A 4O7BA 5HRVA 5E73A 5EI4A 5CQAA 4BHWA 5ENBA 5CUEA 5KTWA 1WUMA 5E7DA 4YATA 5D3JA 5CQ4A 5CY9A 4QEVA 5D3PA 4YBTA 4UYEA 5LVRA 2E7OA 4NQMA 3UVXA 4HBWA 4MEOA 4MR5A 2WP1A 4UYFA 4UIXA 1EQFA 3LQIA 5II1A 4KV1A 2LSPB 5JI8A 4O76A 5EISA 4LYSA 5E9LA 2DKWA 4XY8A 3SVHA 4CLBA 4NUDA 5A7CA 3P5OA 5HQ7A 2G4AA 4HXOA 2E7NA 4YYMA 2F6JA 5LVQA 2GRCA 3HMHA 5ETBA 4NYWA 4Z1SA 5C7NA 4A9KA 5FE9A 5C8GA 4CUTA 2OO1A 4QY4A 5CFWA 4QSQA 2E3KA 4LYIA 5EK9A 5DX4A 5E9MA 5EQ1A 5H1VA 5E0RA 5L96A 3JVJA 3U5PA 4QR3A 1JSPB 4QSRA 1JM4B 3SVFA 3MB4A 5LJ2A 4N4GA 4Y03A 3MULA 1E6IA 4HXPA 5CS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BW1 A;  5H85 A;  5KO4 A;  3O36 A;  4N4I A;  5E3D A;  1ZS5 A;  1F68 A;  5BT4 A;  3HMF A;  3HME A;  3IU5 A;  3NXB A;  5CTL A;  4XY9 A;  3LQH A;  4NRC A;  2RFJ A;  4NR6 A;  5L8T A;  3ZYU A;  5I86 A;  4QYD A;  5CQ8 A;  4IOQ A;  3JVK A;  4YY6 A;  3MQM A;  5CUD A;  5CUA A;  3Q2F A;  4UIZ A;  4QC1 A;  4O77 A;  5AMF A;  4UIU A;  3JVL A;  3QZT A;  5F61 A;  5CUG A;  5D3T A;  4TT6 A;  4XYA A;  5EU1 A;  5C89 A;  5HCL A;  5CQ3 A;  5E9K A;  3RCW A;  4PCE A;  4TT2 A;  5D7X A;  4HXL A;  3UVW A;  5HEN A;  3O34 A;  5FE0 A;  4HXN A;  2DVS A;  5C85 A;  4QUT A;  5FB1 A;  4QR5 A;  3QZV A;  5JWM A;  4NYX A;  4RVR A;  4ZC9 A;  4YBM A;  5DBM A;  3UV2 A;  5F62 A;  4HBV A;  5HEM A;  4CUS A;  2OSS A;  5EWD A;  5FE1 A;  5D0C A;  5CQ7 A;  5DLX A;  5IBN A;  5EPR A;  4NR7 A;  4A9L A;  4O7F A;  1WUG A;  2R0V A;  4QZS A;  5DY7 A;  4MR4 A;  4YYH A;  5F1H A;  2DWW A;  4IR3 A;  4IR6 A;  5FE2 A;  2YQD A;  5TCM A;  5FFV A;  5BT3 A;  3MUK A;  4QSU A;  4Q0N A;  2D9E A;  2L85 A;  5EPB A;  5A5Q A;  5LKX A;  5CUC A;  4N4F A;  4UYF B;  4J3I A;  4YAD A;  4Z6H A;  5CQ5 A;  5HRW A;  5L98 A;  4DON A;  4OGJ A;  2N9G A;  4TQN A;  5DYU A;  4IR4 A;  3G0L A;  5K29 A;  5ENH A;  5E9Y A;  4QUU A;  4N4H A;  5A83 A;  4TS8 A;  5DYX A;  4WHU A;  5FE5 A;  3IU6 A;  3MB3 A;  2L5E A;  3O35 A;  5DKH A;  4QSS A;  5DFC A;  5A5R A;  4O78 A;  4NR5 A;  3U5L A;  3O37 A;  4O7A A;  4UIT A;  5HFQ A;  4HXS A;  2DVR A;  4BW3 A;  4N3W A;  4XUA A;  3P1E A;  3I3J A;  4J0S A;  4J0R A;  5D25 A;  4QSV A;  4AKN A;  5LJ0 A;  2DAT A;  3JVM A;  5ENI A;  5HLS A;  5CRZ A;  4LC2 A;  5D26 A;  5HJC A;  4CUQ A;  5HM0 A;  4MEN A;  5FDZ A;  3P1D A;  4NRA A;  3FKM X;  4YAB A;  4TZ2 A;  4NQN A;  5FE4 A;  4Z93 A;  2YEL A;  5ENG A;  4LZR A;  2OUO A;  5FG6 A;  5EP7 A;  4NR4 A;  5HQ5 A;  5LJ1 A;  2F6N A;  4C66 A;  5AD2 A;  5F60 A;  4A9O A;  4UIY A;  2FSA A;  5KU3 A;  5E9I A;  4TTE A;  2R0Y A;  4UIV A;  5DW2 A;  2RS9 B;  5FFW A;  2RNX A;  4J1P A;  2RO1 A;  5I7X A;  4QEU A;  1N72 A;  5H1T A;  5DYA A;  5AME A;  4QC3 A;  2I8N A;  3GG3 A;  4QYL A;  4LDF A;  5L8U A;  4TU6 A;  5I83 A;  5ENJ A;  4NUE A;  4NXJ A;  5H1U A;  4QR4 A;  3O33 A;  3UV5 A;  4UYG A;  4YH4 A;  5EV9 A;  2YEM A;  5F36 A;  5DKC A;  5AD3 A;  4LYW A;  5EWH A;  4LR6 A;  5A5P A;  4QSW A;  2DVV A;  3QZS A;  4O75 A;  5ETD A;  4YBS A;  5FBX A;  4O7C A;  5J0D A;  5IG6 A;  3P1F A;  5TB6 A;  3LXJ A;  2R10 A;  5HRX A;  5D3H A;  5DFB A;  4Q0O A;  5FB0 A;  2DVQ A;  4MEP A;  4PS5 A;  5D3S A;  4A9N A;  4XUB A;  5A5N A;  2YDW A;  5FE6 A;  4YYD A;  5I29 A;  5CQ6 A;  5KHM A;  4WHW A;  4O71 A;  4YYI A;  3UW9 A;  5L97 A;  3LQJ A;  5BT5 A;  5C4Q A;  4YAX A;  4QNS A;  4IOR A;  5LKZ A;  4WIV A;  4CL9 A;  5FH8 A;  5ENC A;  5CP5 A;  5HQ6 A;  5CQT A;  4HXR A;  5HEL A;  5CZG A;  4A9I A;  5EWC A;  4LRG A;  4HXK A;  3UVY A;  3U5O A;  5L99 A;  4IR5 A;  5A85 A;  4O70 A;  5EVA A;  5ENF A;  5F3A A;  5ENE A;  5CPE A;  4NUC A;  4PY6 A;  5F63 A;  5I7Y A;  5I80 A;  5G4R A;  4UYH A;  5CRM A;  4NS5 A;  4YH3 A;  2YEK A;  5F5Z A;  5KTX A;  4NR9 A;  3DWY A;  3SVG A;  3UV4 A;  5EIC A;  2D82 A;  4CUR A;  4UYD A;  4TU4 A;  4BW2 A;  5G4S A;  4C67 A;  4A9E A;  4X2I A;  4MR3 A;  4KCX A;  5D3R A;  3K2J A;  5ACY A;  5DLZ A;  5FG4 A;  4CUP A;  5FE3 A;  4NRB A;  4LZ2 A;  4QEW A;  2KTB B;  4HBY A;  5I40 A;  5KTU A;  4FLP A;  5DW1 A;  5E9V A;  5IGL A;  4YYG A;  3MXF A;  2MJV B;  3U5N A;  5A82 A;  3D7C A;  3UVD A;  4HXM A;  5FFY A;  4A9J A;  4ZQL A;  5LUU A;  2R0S A;  4Z1Q A;  4NYV A;  5IGM A;  5F1L A;  5IGN A;  5IGK A;  5FG5 A;  4NR8 A;  5DYC A;  5E74 A;  5CUB A;  4ALG A;  3U5J A;  4YYN A;  4A9F A;  4PCI A;  5A81 A;  1X0J A;  2YW5 A;  4KV4 A;  2H60 A;  5CU8 A;  4F3I A;  2RNY A;  4E96 A;  2RNW A;  4OGI A;  4QSP A;  2RI7 A;  5F25 A;  4LZS A;  4CFL A;  5LKU A;  2NXB A;  2YYN A;  2I7K A;  5I1Q A;  5C87 A;  5II2 A;  5DFD A;  5COI A;  3U5M A;  5I88 A;  5D3L A;  4PTB A;  4QB3 A;  5CGP A;  5EA1 A;  4A9H A;  3AQA A;  4A9M A;  5IID A;  4O7E A;  5I89 A;  2L84 A;  4TT4 A;  4O74 A;  5EWW A;  4Z6I A;  5HFR A;  5A5S A;  5F2P A;  5FE7 A;  4CFK A;  4YK0 A;  3TLP A;  3S92 A;  3G0J A;  5FE8 A;  4TYL A;  4UIW A;  4O72 A;  4PKL A;  4YY4 A;  5EM3 A;  3Q2E A;  4TZ8 A;  4YYJ A;  5D3N A;  4ALH A;  4YYK A;  5DKD A;  4IOO A;  5EWV A;  5EGU A;  4BW4 A;  4QST A;  5D24 A;  4YC9 A;  3DAI A;  5E3G A;  5LKT A;  4OUF A;  4QSX A;  4BJX A;  3P1C A;  4HBX A;  2WP2 A;  5EPS A;  3AAD A;  4MEQ A;  5FH6 A;  4CUU A;  5FH7 A;  4QBM A;  3U5K A;  3LJW A;  4GPJ A;  3ONI A;  5A5O A;  4ZW1 A;  4MR6 A;  3S91 A;  4O7B A;  5HRV A;  5E73 A;  5EI4 A;  5CQA A;  4BHW A;  5ENB A;  5CUE A;  5KTW A;  1WUM A;  5E7D A;  4YAT A;  5D3J A;  5CQ4 A;  5CY9 A;  4QEV A;  5D3P A;  4YBT A;  4UYE A;  5LVR A;  2E7O A;  4NQM A;  3UVX A;  4HBW A;  4MEO A;  4MR5 A;  2WP1 A;  4UYF A;  4UIX A;  1EQF A;  3LQI A;  5II1 A;  4KV1 A;  2LSP B;  5JI8 A;  4O76 A;  5EIS A;  4LYS A;  5E9L A;  2DKW A;  4XY8 A;  3SVH A;  4CLB A;  4NUD A;  5A7C A;  3P5O A;  5HQ7 A;  2G4A A;  4HXO A;  2E7N A;  4YYM A;  2F6J A;  5LVQ A;  2GRC A;  3HMH A;  5ETB A;  4NYW A;  4Z1S A;  5C7N A;  4A9K A;  5FE9 A;  5C8G A;  4CUT A;  2OO1 A;  4QY4 A;  5CFW A;  4QSQ A;  2E3K A;  4LYI A;  5EK9 A;  5DX4 A;  5E9M A;  5EQ1 A;  5H1V A;  5E0R A;  5L96 A;  3JVJ A;  3U5P A;  4QR3 A;  1JSP B;  4QSR A;  1JM4 B;  3SVF A;  3MB4 A;  5LJ2 A;  4N4G A;  4Y03 A;  3MUL A;  1E6I A;  4HXP A;  5CS8 A; 
#chains in the Genus database with same CATH topology
 4BW1 A;  5H85 A;  5KO4 A;  3O36 A;  4N4I A;  5E3D A;  1ZS5 A;  1F68 A;  5BT4 A;  3HMF A;  3HME A;  3IU5 A;  3NXB A;  5CTL A;  4XY9 A;  3LQH A;  4NRC A;  2RFJ A;  4NR6 A;  5L8T A;  3ZYU A;  5I86 A;  4QYD A;  5CQ8 A;  4IOQ A;  3JVK A;  4YY6 A;  3MQM A;  5CUD A;  5CUA A;  3Q2F A;  4UIZ A;  4QC1 A;  4O77 A;  5AMF A;  4UIU A;  3JVL A;  3QZT A;  5F61 A;  5CUG A;  5D3T A;  4TT6 A;  4XYA A;  5EU1 A;  5C89 A;  5HCL A;  5CQ3 A;  5E9K A;  3RCW A;  4PCE A;  4TT2 A;  5D7X A;  4HXL A;  3UVW A;  5HEN A;  3O34 A;  5FE0 A;  4HXN A;  2DVS A;  5C85 A;  4QUT A;  5FB1 A;  4QR5 A;  3QZV A;  5JWM A;  4NYX A;  4RVR A;  4ZC9 A;  4YBM A;  5DBM A;  3UV2 A;  5F62 A;  4HBV A;  5HEM A;  4CUS A;  2OSS A;  5EWD A;  5FE1 A;  5D0C A;  5CQ7 A;  5DLX A;  5IBN A;  5EPR A;  4NR7 A;  4A9L A;  4O7F A;  1WUG A;  2R0V A;  4QZS A;  5DY7 A;  4MR4 A;  4YYH A;  5F1H A;  2DWW A;  4IR3 A;  4IR6 A;  5FE2 A;  2YQD A;  5TCM A;  5FFV A;  5BT3 A;  3MUK A;  4QSU A;  4Q0N A;  2D9E A;  2L85 A;  5EPB A;  5A5Q A;  5LKX A;  5CUC A;  4N4F A;  4UYF B;  4J3I A;  4YAD A;  4Z6H A;  5CQ5 A;  5HRW A;  5L98 A;  4DON A;  4OGJ A;  2N9G A;  4TQN A;  5DYU A;  4IR4 A;  3G0L A;  5K29 A;  5ENH A;  5E9Y A;  4QUU A;  4N4H A;  5A83 A;  4TS8 A;  5DYX A;  4WHU A;  5FE5 A;  3IU6 A;  3MB3 A;  2L5E A;  3O35 A;  5DKH A;  4QSS A;  5DFC A;  5A5R A;  4O78 A;  4NR5 A;  3U5L A;  3O37 A;  4O7A A;  4UIT A;  5HFQ A;  4HXS A;  2DVR A;  4BW3 A;  4N3W A;  4XUA A;  3P1E A;  3I3J A;  4J0S A;  4J0R A;  5D25 A;  4QSV A;  4AKN A;  5LJ0 A;  2DAT A;  3JVM A;  5ENI A;  5HLS A;  5CRZ A;  4LC2 A;  5D26 A;  5HJC A;  4CUQ A;  5HM0 A;  4MEN A;  5FDZ A;  3P1D A;  4NRA A;  3FKM X;  4YAB A;  4TZ2 A;  4NQN A;  5FE4 A;  4Z93 A;  2YEL A;  5ENG A;  4LZR A;  2OUO A;  5FG6 A;  5EP7 A;  4NR4 A;  5HQ5 A;  5LJ1 A;  2F6N A;  4C66 A;  5AD2 A;  5F60 A;  4A9O A;  4UIY A;  2FSA A;  5KU3 A;  5E9I A;  4TTE A;  2R0Y A;  4UIV A;  5DW2 A;  2RS9 B;  5FFW A;  2RNX A;  4J1P A;  2RO1 A;  5I7X A;  4QEU A;  1N72 A;  3VKG A;  5H1T A;  5DYA A;  5AME A;  4QC3 A;  2I8N A;  3GG3 A;  4QYL A;  4LDF A;  5L8U A;  4TU6 A;  5I83 A;  5ENJ A;  4NUE A;  4NXJ A;  5H1U A;  4QR4 A;  3O33 A;  3UV5 A;  4UYG A;  4YH4 A;  4AI6 A;  5EV9 A;  2YEM A;  5F36 A;  5DKC A;  4AKI A;  5AD3 A;  4LYW A;  5EWH A;  4LR6 A;  5A5P A;  4QSW A;  2DVV A;  3QZS A;  4O75 A;  5ETD A;  4YBS A;  5FBX A;  4O7C A;  5J0D A;  5IG6 A;  3P1F A;  5TB6 A;  3LXJ A;  2R10 A;  5HRX A;  5D3H A;  5DFB A;  4Q0O A;  5FB0 A;  2DVQ A;  4MEP A;  4PS5 A;  5D3S A;  4A9N A;  4XUB A;  5A5N A;  2YDW A;  5FE6 A;  4YYD A;  5I29 A;  5CQ6 A;  5KHM A;  4WHW A;  4O71 A;  4YYI A;  3UW9 A;  5L97 A;  3LQJ A;  5BT5 A;  5C4Q A;  4YAX A;  4QNS A;  4IOR A;  5LKZ A;  4WIV A;  4CL9 A;  5FH8 A;  5ENC A;  5CP5 A;  5HQ6 A;  5CQT A;  4HXR A;  5HEL A;  5CZG A;  4AKH A;  4A9I A;  5EWC A;  4LRG A;  4HXK A;  3UVY A;  3U5O A;  5L99 A;  4IR5 A;  5A85 A;  4O70 A;  5EVA A;  5ENF A;  5F3A A;  5ENE A;  5CPE A;  4NUC A;  4PY6 A;  5F63 A;  5I7Y A;  5I80 A;  5G4R A;  3VKH A;  4UYH A;  5CRM A;  4NS5 A;  3D1D A;  4YH3 A;  2YEK A;  5F5Z A;  5KTX A;  4NR9 A;  3DWY A;  3SVG A;  3UV4 A;  5EIC A;  2D82 A;  4CUR A;  4UYD A;  4TU4 A;  4BW2 A;  5G4S A;  4C67 A;  4A9E A;  4X2I A;  4MR3 A;  4KCX A;  5D3R A;  3K2J A;  5ACY A;  5DLZ A;  5FG4 A;  4CUP A;  5FE3 A;  4NRB A;  4LZ2 A;  4QEW A;  2KTB B;  4HBY A;  5I40 A;  5KTU A;  4FLP A;  5DW1 A;  5E9V A;  5IGL A;  4YYG A;  3MXF A;  2MJV B;  3U5N A;  5A82 A;  3D7C A;  3UVD A;  4HXM A;  5FFY A;  4A9J A;  4ZQL A;  5LUU A;  2R0S A;  4Z1Q A;  4NYV A;  5IGM A;  5F1L A;  5IGN A;  5IGK A;  5FG5 A;  4NR8 A;  5DYC A;  5E74 A;  5CUB A;  4ALG A;  3U5J A;  4YYN A;  4A9F A;  4PCI A;  5A81 A;  1X0J A;  2YW5 A;  4KV4 A;  2H60 A;  4AKG A;  5CU8 A;  4F3I A;  2RNY A;  4E96 A;  2RNW A;  4OGI A;  4QSP A;  2RI7 A;  5F25 A;  4LZS A;  4CFL A;  5LKU A;  2NXB A;  2YYN A;  2I7K A;  5I1Q A;  5C87 A;  5II2 A;  5DFD A;  5COI A;  3U5M A;  5I88 A;  5D3L A;  4PTB A;  4QB3 A;  5CGP A;  5EA1 A;  4A9H A;  3AQA A;  4A9M A;  5IID A;  4O7E A;  5I89 A;  2L84 A;  4TT4 A;  4O74 A;  5EWW A;  4Z6I A;  5HFR A;  5A5S A;  5F2P A;  5FE7 A;  4CFK A;  4YK0 A;  3TLP A;  3S92 A;  3G0J A;  5FE8 A;  4TYL A;  4UIW A;  4O72 A;  4PKL A;  4YY4 A;  5EM3 A;  3Q2E A;  4TZ8 A;  4YYJ A;  5D3N A;  4ALH A;  4YYK A;  5DKD A;  4IOO A;  5EWV A;  5EGU A;  4BW4 A;  4QST A;  5D24 A;  4YC9 A;  3DAI A;  5E3G A;  5LKT A;  4OUF A;  4QSX A;  4BJX A;  3P1C A;  4HBX A;  2WP2 A;  5EPS A;  3AAD A;  4MEQ A;  5FH6 A;  4CUU A;  5FH7 A;  4QBM A;  3U5K A;  3LJW A;  4GPJ A;  3ONI A;  5A5O A;  4ZW1 A;  4MR6 A;  3S91 A;  4O7B A;  5HRV A;  5E73 A;  5EI4 A;  5CQA A;  4BHW A;  1PUO A;  5ENB A;  5CUE A;  5KTW A;  1WUM A;  5E7D A;  4YAT A;  5D3J A;  3D1B A;  5CQ4 A;  5CY9 A;  4QEV A;  5D3P A;  4YBT A;  4UYE A;  5LVR A;  2E7O A;  4NQM A;  3UVX A;  3ERR A;  4HBW A;  4MEO A;  4MR5 A;  2WP1 A;  4UYF A;  4UIX A;  1EQF A;  3LQI A;  5II1 A;  4KV1 A;  2LSP B;  5JI8 A;  4O76 A;  5EIS A;  4LYS A;  5E9L A;  2DKW A;  4XY8 A;  3SVH A;  4CLB A;  4NUD A;  5A7C A;  3P5O A;  5HQ7 A;  2G4A A;  4HXO A;  2E7N A;  4YYM A;  2F6J A;  5LVQ A;  2GRC A;  3HMH A;  5ETB A;  2EJN A;  4NYW A;  4Z1S A;  5C7N A;  4A9K A;  5FE9 A;  5C8G A;  4CUT A;  2OO1 A;  4QY4 A;  5CFW A;  1ZKR A;  4QSQ A;  2E3K A;  4LYI A;  5EK9 A;  5DX4 A;  5E9M A;  5EQ1 A;  5H1V A;  5E0R A;  5L96 A;  3JVJ A;  3U5P A;  4QR3 A;  1JSP B;  4QSR A;  1JM4 B;  3SVF A;  3MB4 A;  5LJ2 A;  4N4G A;  4Y03 A;  3MUL A;  1E6I A;  4HXP A;  5CS8 A; 
#chains in the Genus database with same CATH homology
 4BW1 A;  5H85 A;  5KO4 A;  3O36 A;  4N4I A;  5E3D A;  1ZS5 A;  1F68 A;  5BT4 A;  3HMF A;  3HME A;  3IU5 A;  3NXB A;  5CTL A;  4XY9 A;  3LQH A;  4NRC A;  2RFJ A;  4NR6 A;  5L8T A;  3ZYU A;  5I86 A;  4QYD A;  5CQ8 A;  4IOQ A;  3JVK A;  4YY6 A;  3MQM A;  5CUD A;  5CUA A;  3Q2F A;  4UIZ A;  4QC1 A;  4O77 A;  5AMF A;  4UIU A;  3JVL A;  3QZT A;  5F61 A;  5CUG A;  5D3T A;  4TT6 A;  4XYA A;  5EU1 A;  5C89 A;  5HCL A;  5CQ3 A;  5E9K A;  3RCW A;  4PCE A;  4TT2 A;  5D7X A;  4HXL A;  3UVW A;  5HEN A;  3O34 A;  5FE0 A;  4HXN A;  2DVS A;  5C85 A;  4QUT A;  5FB1 A;  4QR5 A;  3QZV A;  5JWM A;  4NYX A;  4RVR A;  4ZC9 A;  4YBM A;  5DBM A;  3UV2 A;  5F62 A;  4HBV A;  5HEM A;  4CUS A;  2OSS A;  5EWD A;  5FE1 A;  5D0C A;  5CQ7 A;  5DLX A;  5IBN A;  5EPR A;  4NR7 A;  4A9L A;  4O7F A;  1WUG A;  2R0V A;  4QZS A;  5DY7 A;  4MR4 A;  4YYH A;  5F1H A;  2DWW A;  4IR3 A;  4IR6 A;  5FE2 A;  2YQD A;  5TCM A;  5FFV A;  5BT3 A;  3MUK A;  4QSU A;  4Q0N A;  2D9E A;  2L85 A;  5EPB A;  5A5Q A;  5LKX A;  5CUC A;  4N4F A;  4UYF B;  4J3I A;  4YAD A;  4Z6H A;  5CQ5 A;  5HRW A;  5L98 A;  4DON A;  4OGJ A;  2N9G A;  4TQN A;  5DYU A;  4IR4 A;  3G0L A;  5K29 A;  5ENH A;  5E9Y A;  4QUU A;  4N4H A;  5A83 A;  4TS8 A;  5DYX A;  4WHU A;  5FE5 A;  3IU6 A;  3MB3 A;  2L5E A;  3O35 A;  5DKH A;  4QSS A;  5DFC A;  5A5R A;  4O78 A;  4NR5 A;  3U5L A;  3O37 A;  4O7A A;  4UIT A;  5HFQ A;  4HXS A;  2DVR A;  4BW3 A;  4N3W A;  4XUA A;  3P1E A;  3I3J A;  4J0S A;  4J0R A;  5D25 A;  4QSV A;  4AKN A;  5LJ0 A;  2DAT A;  3JVM A;  5ENI A;  5HLS A;  5CRZ A;  4LC2 A;  5D26 A;  5HJC A;  4CUQ A;  5HM0 A;  4MEN A;  5FDZ A;  3P1D A;  4NRA A;  3FKM X;  4YAB A;  4TZ2 A;  4NQN A;  5FE4 A;  4Z93 A;  2YEL A;  5ENG A;  4LZR A;  2OUO A;  5FG6 A;  5EP7 A;  4NR4 A;  5HQ5 A;  5LJ1 A;  2F6N A;  4C66 A;  5AD2 A;  5F60 A;  4A9O A;  4UIY A;  2FSA A;  5KU3 A;  5E9I A;  4TTE A;  2R0Y A;  4UIV A;  5DW2 A;  2RS9 B;  5FFW A;  2RNX A;  4J1P A;  2RO1 A;  5I7X A;  4QEU A;  1N72 A;  5H1T A;  5DYA A;  5AME A;  4QC3 A;  2I8N A;  3GG3 A;  4QYL A;  4LDF A;  5L8U A;  4TU6 A;  5I83 A;  5ENJ A;  4NUE A;  4NXJ A;  5H1U A;  4QR4 A;  3O33 A;  3UV5 A;  4UYG A;  4YH4 A;  5EV9 A;  2YEM A;  5F36 A;  5DKC A;  5AD3 A;  4LYW A;  5EWH A;  4LR6 A;  5A5P A;  4QSW A;  2DVV A;  3QZS A;  4O75 A;  5ETD A;  4YBS A;  5FBX A;  4O7C A;  5J0D A;  5IG6 A;  3P1F A;  5TB6 A;  3LXJ A;  2R10 A;  5HRX A;  5D3H A;  5DFB A;  4Q0O A;  5FB0 A;  2DVQ A;  4MEP A;  4PS5 A;  5D3S A;  4A9N A;  4XUB A;  5A5N A;  2YDW A;  5FE6 A;  4YYD A;  5I29 A;  5CQ6 A;  5KHM A;  4WHW A;  4O71 A;  4YYI A;  3UW9 A;  5L97 A;  3LQJ A;  5BT5 A;  5C4Q A;  4YAX A;  4QNS A;  4IOR A;  5LKZ A;  4WIV A;  4CL9 A;  5FH8 A;  5ENC A;  5CP5 A;  5HQ6 A;  5CQT A;  4HXR A;  5HEL A;  5CZG A;  4A9I A;  5EWC A;  4LRG A;  4HXK A;  3UVY A;  3U5O A;  5L99 A;  4IR5 A;  5A85 A;  4O70 A;  5EVA A;  5ENF A;  5F3A A;  5ENE A;  5CPE A;  4NUC A;  4PY6 A;  5F63 A;  5I7Y A;  5I80 A;  5G4R A;  4UYH A;  5CRM A;  4NS5 A;  4YH3 A;  2YEK A;  5F5Z A;  5KTX A;  4NR9 A;  3DWY A;  3SVG A;  3UV4 A;  5EIC A;  2D82 A;  4CUR A;  4UYD A;  4TU4 A;  4BW2 A;  5G4S A;  4C67 A;  4A9E A;  4X2I A;  4MR3 A;  4KCX A;  5D3R A;  3K2J A;  5ACY A;  5DLZ A;  5FG4 A;  4CUP A;  5FE3 A;  4NRB A;  4LZ2 A;  4QEW A;  2KTB B;  4HBY A;  5I40 A;  5KTU A;  4FLP A;  5DW1 A;  5E9V A;  5IGL A;  4YYG A;  3MXF A;  2MJV B;  3U5N A;  5A82 A;  3D7C A;  3UVD A;  4HXM A;  5FFY A;  4A9J A;  4ZQL A;  5LUU A;  2R0S A;  4Z1Q A;  4NYV A;  5IGM A;  5F1L A;  5IGN A;  5IGK A;  5FG5 A;  4NR8 A;  5DYC A;  5E74 A;  5CUB A;  4ALG A;  3U5J A;  4YYN A;  4A9F A;  4PCI A;  5A81 A;  1X0J A;  2YW5 A;  4KV4 A;  2H60 A;  5CU8 A;  4F3I A;  2RNY A;  4E96 A;  2RNW A;  4OGI A;  4QSP A;  2RI7 A;  5F25 A;  4LZS A;  4CFL A;  5LKU A;  2NXB A;  2YYN A;  2I7K A;  5I1Q A;  5C87 A;  5II2 A;  5DFD A;  5COI A;  3U5M A;  5I88 A;  5D3L A;  4PTB A;  4QB3 A;  5CGP A;  5EA1 A;  4A9H A;  3AQA A;  4A9M A;  5IID A;  4O7E A;  5I89 A;  2L84 A;  4TT4 A;  4O74 A;  5EWW A;  4Z6I A;  5HFR A;  5A5S A;  5F2P A;  5FE7 A;  4CFK A;  4YK0 A;  3TLP A;  3S92 A;  3G0J A;  5FE8 A;  4TYL A;  4UIW A;  4O72 A;  4PKL A;  4YY4 A;  5EM3 A;  3Q2E A;  4TZ8 A;  4YYJ A;  5D3N A;  4ALH A;  4YYK A;  5DKD A;  4IOO A;  5EWV A;  5EGU A;  4BW4 A;  4QST A;  5D24 A;  4YC9 A;  3DAI A;  5E3G A;  5LKT A;  4OUF A;  4QSX A;  4BJX A;  3P1C A;  4HBX A;  2WP2 A;  5EPS A;  3AAD A;  4MEQ A;  5FH6 A;  4CUU A;  5FH7 A;  4QBM A;  3U5K A;  3LJW A;  4GPJ A;  3ONI A;  5A5O A;  4ZW1 A;  4MR6 A;  3S91 A;  4O7B A;  5HRV A;  5E73 A;  5EI4 A;  5CQA A;  4BHW A;  5ENB A;  5CUE A;  5KTW A;  1WUM A;  5E7D A;  4YAT A;  5D3J A;  5CQ4 A;  5CY9 A;  4QEV A;  5D3P A;  4YBT A;  4UYE A;  5LVR A;  2E7O A;  4NQM A;  3UVX A;  4HBW A;  4MEO A;  4MR5 A;  2WP1 A;  4UYF A;  4UIX A;  1EQF A;  3LQI A;  5II1 A;  4KV1 A;  2LSP B;  5JI8 A;  4O76 A;  5EIS A;  4LYS A;  5E9L A;  2DKW A;  4XY8 A;  3SVH A;  4CLB A;  4NUD A;  5A7C A;  3P5O A;  5HQ7 A;  2G4A A;  4HXO A;  2E7N A;  4YYM A;  2F6J A;  5LVQ A;  2GRC A;  3HMH A;  5ETB A;  4NYW A;  4Z1S A;  5C7N A;  4A9K A;  5FE9 A;  5C8G A;  4CUT A;  2OO1 A;  4QY4 A;  5CFW A;  4QSQ A;  2E3K A;  4LYI A;  5EK9 A;  5DX4 A;  5E9M A;  5EQ1 A;  5H1V A;  5E0R A;  5L96 A;  3JVJ A;  3U5P A;  4QR3 A;  1JSP B;  4QSR A;  1JM4 B;  3SVF A;  3MB4 A;  5LJ2 A;  4N4G A;  4Y03 A;  3MUL A;  1E6I A;  4HXP A;  5CS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...