5LJ0A

Crystal structure of human atad2 bromodomain in complex with 8-(((3r,4r,5s)-3-((4,4-difluorocyclohexyl)methoxy)-5-methoxypiperidin-4-yl)amino)-3-methyl-5-(5-methylpyridin-3-yl)-1,7-naphthyridin-2(1h)-one
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords ATPase family AAA domain-containing protein 2
publication title A Chemical Probe for the ATAD2 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5lj0A00
2RO1A 4O72A 4FLPA 5DYAA 4AKNA 4TQNA 5D0CA 4MR4A 5HRVA 5C8GA 4XUAA 2RNXA 5E3DA 5CQ7A 4QSTA 4O7EA 4N4GA 4Z1QA 4O76A 4N4HA 2DATA 5IGKA 4PCEA 4XY8A 5IBNA 5DW2A 5L97A 5HQ5A 3LJWA 5D3SA 2OO1A 4O7CA 4YC9A 4X2IA 4NXJA 4O78A 3IU5A 5C89A 4QB3A 3AQAA 3Q2EA 4YAXA 5AMEA 4CL9A 4IR6A 5K29A 5HELA 4PTBA 4HBWA 2YDWA 2YELA 3P1EA 5EWDA 2RNYA 4NUEA 4C67A 3SVHA 1JSPB 4OGIA 4YY4A 5DY7A 4A9OA 3TLPA 5E9VA 5H85A 3MXFA 4QSVA 5C87A 5HM0A 4QR5A 1ZS5A 4NYWA 5C7NA 5D24A 3MB3A 2R0YA 4KV1A 4HXOA 4TU6A 4HBYA 5ENCA 5A83A 5HFQA 2E3KA 4BW2A 5I83A 4O7BA 4Q0NA 4A9FA 5L8UA 4A9EA 3QZVA 4NQMA 2DVVA 3U5NA 4O74A 2DVSA 5A5RA 1X0JA 4O75A 4PY6A 4QEUA 5L96A 1JM4B 4O70A 3MQMA 4YYJA 5A5PA 5F63A 4YK0A 5TCMA 4TZ2A 4BJXA 4NYXA 4NYVA 3LQIA 4PKLA 5CFWA 4CUUA 4XUBA 2YYNA 5CRMA 5D3JA 4QSPA 5EWCA 4IOOA 4NR4A 4NUCA 3UV5A 4N4FA 4N4IA 5E0RA 4A9LA 5KO4A 3SVFA 5FB1A 5H1UA 4QC3A 2YW5A 4UYGA 4NR8A 5ETBA 4WHWA 5EISA 5F5ZA 5CZGA 5CUGA 5F62A 4NR9A 5CGPA 4TS8A 4LYSA 5CQ4A 5F61A 4OGJA 5KTUA 4O7AA 3D7CA 2R10A 5JI8A 3MB4A 3P1DA 4CUSA 4OUFA 4YY6A 3S91A 4O77A 5BT5A 3U5JA 5FG4A 5LKZA 4MEQA 5DYCA 4IR3A 5DYXA 3U5LA 5LJ0A 5AMFA 3IU6A 5ENIA 4LYWA 5A85A 5ENEA 5FE6A 5CUCA 5BT3A 4NS5A 4A9KA 2I7KA 3FKMX 4CUQA 4YBSA 5HCLA 3P1FA 4A9JA 5CS8A 1N72A 4NRBA 2H60A 5CU8A 3GG3A 5EM3A 4CFLA 2WP1A 5FE4A 3O37A 4QYDA 5ENGA 5DX4A 5EWWA 5CTLA 3S92A 5EWVA 5II2A 4TZ8A 4QY4A 3G0JA 5F1LA 5H1TA 5F2PA 5DFCA 3AADA 4UIWA 3UVDA 5CQTA 5KTXA 3HMEA 4KCXA 5IGLA 5FG6A 5I88A 4RVRA 4TT2A 4TYLA 5A7CA 4UYHA 3NXBA 2G4AA 5CUBA 3ONIA 5L99A 4LRGA 5HFRA 3LQHA 5EPSA 2F6JA 4UYFB 3U5PA 4J0RA 3HMHA 4CFKA 5DKDA 2MJVB 5ENBA 2RS9B 4YYIA 4QR4A 4Y03A 4MEPA 3UVWA 4QSRA 5FH6A 4MENA 4A9MA 5HQ6A 5F25A 2YQDA 4Z93A 4TTEA 5FE1A 5HEMA 4YYKA 5D25A 5D3LA 5TB6A 2RFJA 4NRCA 5EPRA 5AD3A 5I7YA 5COIA 2E7OA 4IOQA 4UIXA 4HXRA 2YEKA 4YYDA 5A5OA 5LVRA 2R0SA 3UVYA 5FH7A 4GPJA 4LC2A 4QUUA 5F36A 5CPEA 5A81A 4QSXA 3UV2A 5JWMA 5I80A 4HXMA 5I29A 5G4SA 5CQ5A 5D3TA 4YABA 5FFVA 5FE3A 3Q2FA 3SVGA 5FG5A 5FE5A 4J3IA 5HQ7A 4MR6A 4NR6A 4C66A 5F3AA 4UIZA 5I40A 1E6IA 3QZSA 4TU4A 4QC1A 4QUTA 3DAIA 2OSSA 4QR3A 4MR5A 4PCIA 5FFYA 5ENJA 4HBXA 4TT6A 3LXJA 3JVJA 5HRXA 2DVQA 4LZSA 5EVAA 5ENHA 4PS5A 5FE0A 5II1A 2RNWA 5CQAA 4WHUA 4YYGA 3UVXA 3QZTA 5DBMA 5C85A 5DW1A 4DONA 5HJCA 2E7NA 5DFBA 5DKHA 4BW3A 3MULA 5HRWA 5FE9A 4HXNA 5FE2A 4LYIA 3U5OA 4QSQA 4LDFA 1WUMA 3O35A 5I86A 5L8TA 4MEOA 5CQ8A 5LKTA 4BW4A 4IR5A 2YEMA 4A9IA 5CP5A 4NR7A 4TT4A 4UIVA 4CURA 5E9LA 5E73A 3JVMA 5ENFA 5EP7A 5EV9A 4NUDA 5EI4A 5EU1A 3U5MA 5I7XA 3UV4A 4YYMA 3LQJA 5LKXA 2OUOA 5I1QA 5BT4A 4HXPA 4ZQLA 5AD2A 4BHWA 4WIVA 4IR4A 5FE8A 2FSAA 4UIYA 4IORA 4J0SA 3U5KA 5LKUA 4YYNA 2GRCA 5FH8A 4Z6IA 4LR6A 2R0VA 4N3WA 3O33A 4QEWA 2DWWA 4HXLA 4XY9A 5FDZA 4QYLA 4QZSA 2WP2A 5E9KA 4YBTA 4ZC9A 3UW9A 4Q0OA 5A5QA 4YH3A 5D3PA 4QNSA 5EPBA 3O36A 5FFWA 4LZRA 3G0LA 4F3IA 5DFDA 4XYAA 5IG6A 4J1PA 5G4RA 5E9IA 5EA1A 3I3JA 4YATA 5FBXA 5CUDA 5EGUA 1WUGA 5D3RA 5D3NA 4A9NA 5LJ1A 5E3GA 2L84A 4YADA 4BW1A 4HBVA 3O34A 3P5OA 4E96A 5IGMA 3K2JA 5D26A 5HENA 5F1HA 2KTBB 4QSUA 4UYFA 3DWYA 5DLXA 2DKWA 5D3HA 5KU3A 5ACYA 5CY9A 5I89A 4HXSA 5E9YA 4O71A 5EQ1A 4O7FA 4CUPA 5HLSA 5D7XA 5FB0A 2NXBA 3HMFA 2N9GA 4UYDA 5E9MA 4YH4A 5EICA 4KV4A 5IIDA 4UITA 5L98A 3JVLA 4ZW1A 2I8NA 4LZ2A 5ETDA 5A82A 5DYUA 2D82A 5CQ6A 5LUUA 4Z6HA 4QSSA 4ALGA 2LSPB 5DLZA 5E74A 2DVRA 5KHMA 3JVKA 4NQNA 5F60A 5CQ3A 4MR3A 3MUKA 5KTWA 5EK9A 2L5EA 4NRAA 4QBMA 4ALHA 5IGNA 4CLBA 3P1CA 5LJ2A 5DKCA 2D9EA 4QEVA 5EWHA 4CUTA 1EQFA 4HXKA 5CUAA 2L85A 3RCWA 4UIUA 4UYEA 5CUEA 3ZYUA 4YBMA 5LVQA 5A5NA 5C4QA 5A5SA 4NR5A 5J0DA 2RI7A 5E7DA 4A9HA 4YYHA 1F68A 4Z1SA 5FE7A 4QSWA 2F6NA 5CRZA 5H1VA
chains in the Genus database with same CATH superfamily
2RO1A 4O72A 4FLPA 5DYAA 4AKNA 4TQNA 5D0CA 4MR4A 5HRVA 5C8GA 4XUAA 2RNXA 5E3DA 5CQ7A 4QSTA 4O7EA 4N4GA 4Z1QA 4O76A 4N4HA 2DATA 5IGKA 4PCEA 4XY8A 5IBNA 5DW2A 5L97A 5HQ5A 3LJWA 5D3SA 2OO1A 4O7CA 4YC9A 4X2IA 4NXJA 4O78A 3IU5A 5C89A 4QB3A 3AQAA 3Q2EA 4YAXA 5AMEA 4CL9A 4IR6A 5K29A 5HELA 4PTBA 4HBWA 2YDWA 2YELA 3P1EA 5EWDA 2RNYA 4NUEA 4C67A 3SVHA 1JSPB 4OGIA 4YY4A 5DY7A 4A9OA 3TLPA 5E9VA 5H85A 3MXFA 4QSVA 5C87A 5HM0A 4QR5A 1ZS5A 4NYWA 5C7NA 5D24A 3MB3A 2R0YA 4KV1A 4HXOA 4TU6A 4HBYA 5ENCA 5A83A 5HFQA 2E3KA 4BW2A 5I83A 4O7BA 4Q0NA 4A9FA 5L8UA 4A9EA 3QZVA 4NQMA 2DVVA 3U5NA 3VKHA 4O74A 2DVSA 5A5RA 1X0JA 4O75A 4PY6A 4QEUA 5L96A 1JM4B 4O70A 3MQMA 4YYJA 5A5PA 5F63A 4YK0A 5TCMA 4TZ2A 4BJXA 4NYXA 4NYVA 3LQIA 4PKLA 5CFWA 4CUUA 4XUBA 2YYNA 5CRMA 5D3JA 4QSPA 5EWCA 4IOOA 4NR4A 4NUCA 3UV5A 4N4FA 4N4IA 5E0RA 4A9LA 5KO4A 3SVFA 5FB1A 5H1UA 4QC3A 2YW5A 4UYGA 4NR8A 5ETBA 4WHWA 5EISA 5F5ZA 5CZGA 5CUGA 5F62A 4NR9A 5CGPA 4TS8A 4LYSA 5CQ4A 5F61A 4OGJA 5KTUA 4O7AA 3D7CA 2R10A 5JI8A 3MB4A 3P1DA 4CUSA 4OUFA 4YY6A 3S91A 4O77A 5BT5A 3U5JA 5FG4A 5LKZA 4MEQA 5DYCA 4IR3A 5DYXA 3U5LA 5LJ0A 5AMFA 4AKIA 3IU6A 5ENIA 4LYWA 5A85A 5ENEA 5FE6A 5CUCA 5BT3A 4NS5A 4A9KA 2I7KA 3FKMX 4CUQA 4YBSA 5HCLA 3P1FA 3ERRA 4A9JA 5CS8A 1N72A 4NRBA 2H60A 5CU8A 3GG3A 5EM3A 4CFLA 2WP1A 5FE4A 3O37A 4QYDA 5ENGA 5DX4A 5EWWA 5CTLA 3S92A 5EWVA 5II2A 2EJNA 4TZ8A 4QY4A 3G0JA 5F1LA 5H1TA 5F2PA 5DFCA 3AADA 4UIWA 3UVDA 5CQTA 5KTXA 3HMEA 4KCXA 5IGLA 5FG6A 5I88A 4RVRA 4TT2A 4TYLA 5A7CA 4UYHA 3NXBA 2G4AA 5CUBA 3ONIA 5L99A 4LRGA 5HFRA 3LQHA 1ZKRA 5EPSA 2F6JA 4UYFB 3U5PA 4J0RA 3HMHA 4CFKA 5DKDA 2MJVB 5ENBA 2RS9B 4YYIA 4QR4A 4Y03A 4MEPA 3UVWA 4QSRA 4AKHA 5FH6A 4MENA 4A9MA 5HQ6A 5F25A 2YQDA 4Z93A 4TTEA 5FE1A 5HEMA 4YYKA 5D25A 5D3LA 5TB6A 2RFJA 4AKGA 4NRCA 5EPRA 5AD3A 5I7YA 5COIA 2E7OA 4IOQA 4UIXA 4HXRA 2YEKA 4YYDA 5A5OA 5LVRA 2R0SA 3UVYA 5FH7A 4GPJA 4LC2A 4QUUA 5F36A 5CPEA 5A81A 4QSXA 3UV2A 5JWMA 5I80A 4HXMA 5I29A 5G4SA 5CQ5A 5D3TA 4YABA 5FFVA 5FE3A 3Q2FA 3SVGA 5FG5A 5FE5A 4J3IA 5HQ7A 4MR6A 4NR6A 4C66A 5F3AA 4UIZA 5I40A 1E6IA 3QZSA 4TU4A 4QC1A 4QUTA 3DAIA 2OSSA 4QR3A 4MR5A 4PCIA 5FFYA 5ENJA 4HBXA 4TT6A 3LXJA 3JVJA 5HRXA 2DVQA 4LZSA 5EVAA 5ENHA 4PS5A 5FE0A 5II1A 2RNWA 5CQAA 4WHUA 4YYGA 3UVXA 3QZTA 5DBMA 5C85A 5DW1A 4DONA 5HJCA 2E7NA 5DFBA 5DKHA 3D1BA 4BW3A 3MULA 5HRWA 5FE9A 4HXNA 5FE2A 4LYIA 3U5OA 4QSQA 4LDFA 1WUMA 3O35A 5I86A 5L8TA 4MEOA 5CQ8A 5LKTA 4BW4A 4IR5A 2YEMA 4A9IA 5CP5A 4NR7A 4TT4A 4UIVA 4CURA 5E9LA 5E73A 3JVMA 5ENFA 5EP7A 5EV9A 4NUDA 5EI4A 5EU1A 3U5MA 5I7XA 3UV4A 4YYMA 3LQJA 5LKXA 2OUOA 5I1QA 5BT4A 4HXPA 4ZQLA 5AD2A 4BHWA 4WIVA 4IR4A 5FE8A 2FSAA 4UIYA 4IORA 4J0SA 3U5KA 5LKUA 4YYNA 2GRCA 5FH8A 4Z6IA 4LR6A 2R0VA 4N3WA 3O33A 4QEWA 2DWWA 4HXLA 4XY9A 5FDZA 4QYLA 4QZSA 2WP2A 5E9KA 4YBTA 4ZC9A 1PUOA 3UW9A 4Q0OA 5A5QA 4YH3A 5D3PA 4QNSA 5EPBA 3O36A 5FFWA 4LZRA 3G0LA 4F3IA 5DFDA 4XYAA 5IG6A 4J1PA 5G4RA 5E9IA 5EA1A 3I3JA 4YATA 5FBXA 5CUDA 5EGUA 1WUGA 5D3RA 5D3NA 4A9NA 5LJ1A 5E3GA 2L84A 4YADA 4BW1A 4HBVA 3O34A 3P5OA 4E96A 5IGMA 3K2JA 5D26A 5HENA 5F1HA 2KTBB 4QSUA 4UYFA 3DWYA 5DLXA 2DKWA 5D3HA 5KU3A 5ACYA 5CY9A 5I89A 4HXSA 5E9YA 4O71A 5EQ1A 4O7FA 4CUPA 5HLSA 5D7XA 5FB0A 2NXBA 3HMFA 2N9GA 4UYDA 5E9MA 4YH4A 5EICA 4KV4A 3VKGA 5IIDA 4UITA 5L98A 3JVLA 4ZW1A 2I8NA 4LZ2A 5ETDA 5A82A 5DYUA 2D82A 5CQ6A 5LUUA 4Z6HA 4QSSA 4ALGA 2LSPB 3D1DA 5DLZA 5E74A 2DVRA 5KHMA 3JVKA 4NQNA 5F60A 5CQ3A 4MR3A 3MUKA 5KTWA 5EK9A 2L5EA 4NRAA 4QBMA 4ALHA 5IGNA 4CLBA 3P1CA 5LJ2A 5DKCA 2D9EA 4QEVA 5EWHA 4CUTA 1EQFA 4HXKA 5CUAA 2L85A 3RCWA 4UIUA 4UYEA 5CUEA 3ZYUA 4YBMA 5LVQA 5A5NA 5C4QA 4AI6A 5A5SA 4NR5A 5J0DA 2RI7A 5E7DA 4A9HA 4YYHA 1F68A 4Z1SA 5FE7A 4QSWA 2F6NA 5CRZA 5H1VA
chains in the Genus database with same CATH topology
2RO1A 4O72A 4FLPA 5DYAA 4AKNA 4TQNA 5D0CA 4MR4A 5HRVA 5C8GA 4XUAA 2RNXA 5E3DA 5CQ7A 4QSTA 4O7EA 4N4GA 4Z1QA 4O76A 4N4HA 2DATA 5IGKA 4PCEA 4XY8A 5IBNA 5DW2A 5L97A 5HQ5A 3LJWA 5D3SA 2OO1A 4O7CA 4YC9A 4X2IA 4NXJA 4O78A 3IU5A 5C89A 4QB3A 3AQAA 3Q2EA 4YAXA 5AMEA 4CL9A 4IR6A 5K29A 5HELA 4PTBA 4HBWA 2YDWA 2YELA 3P1EA 5EWDA 2RNYA 4NUEA 4C67A 3SVHA 1JSPB 4OGIA 4YY4A 5DY7A 4A9OA 3TLPA 5E9VA 5H85A 3MXFA 4QSVA 5C87A 5HM0A 4QR5A 1ZS5A 4NYWA 5C7NA 5D24A 3MB3A 2R0YA 4KV1A 4HXOA 4TU6A 4HBYA 5ENCA 5A83A 5HFQA 2E3KA 4BW2A 5I83A 4O7BA 4Q0NA 4A9FA 5L8UA 4A9EA 3QZVA 4NQMA 2DVVA 3U5NA 4O74A 2DVSA 5A5RA 1X0JA 4O75A 4PY6A 4QEUA 5L96A 1JM4B 4O70A 3MQMA 4YYJA 5A5PA 5F63A 4YK0A 5TCMA 4TZ2A 4BJXA 4NYXA 4NYVA 3LQIA 4PKLA 5CFWA 4CUUA 4XUBA 2YYNA 5CRMA 5D3JA 4QSPA 5EWCA 4IOOA 4NR4A 4NUCA 3UV5A 4N4FA 4N4IA 5E0RA 4A9LA 5KO4A 3SVFA 5FB1A 5H1UA 4QC3A 2YW5A 4UYGA 4NR8A 5ETBA 4WHWA 5EISA 5F5ZA 5CZGA 5CUGA 5F62A 4NR9A 5CGPA 4TS8A 4LYSA 5CQ4A 5F61A 4OGJA 5KTUA 4O7AA 3D7CA 2R10A 5JI8A 3MB4A 3P1DA 4CUSA 4OUFA 4YY6A 3S91A 4O77A 5BT5A 3U5JA 5FG4A 5LKZA 4MEQA 5DYCA 4IR3A 5DYXA 3U5LA 5LJ0A 5AMFA 3IU6A 5ENIA 4LYWA 5A85A 5ENEA 5FE6A 5CUCA 5BT3A 4NS5A 4A9KA 2I7KA 3FKMX 4CUQA 4YBSA 5HCLA 3P1FA 4A9JA 5CS8A 1N72A 4NRBA 2H60A 5CU8A 3GG3A 5EM3A 4CFLA 2WP1A 5FE4A 3O37A 4QYDA 5ENGA 5DX4A 5EWWA 5CTLA 3S92A 5EWVA 5II2A 4TZ8A 4QY4A 3G0JA 5F1LA 5H1TA 5F2PA 5DFCA 3AADA 4UIWA 3UVDA 5CQTA 5KTXA 3HMEA 4KCXA 5IGLA 5FG6A 5I88A 4RVRA 4TT2A 4TYLA 5A7CA 4UYHA 3NXBA 2G4AA 5CUBA 3ONIA 5L99A 4LRGA 5HFRA 3LQHA 5EPSA 2F6JA 4UYFB 3U5PA 4J0RA 3HMHA 4CFKA 5DKDA 2MJVB 5ENBA 2RS9B 4YYIA 4QR4A 4Y03A 4MEPA 3UVWA 4QSRA 5FH6A 4MENA 4A9MA 5HQ6A 5F25A 2YQDA 4Z93A 4TTEA 5FE1A 5HEMA 4YYKA 5D25A 5D3LA 5TB6A 2RFJA 4NRCA 5EPRA 5AD3A 5I7YA 5COIA 2E7OA 4IOQA 4UIXA 4HXRA 2YEKA 4YYDA 5A5OA 5LVRA 2R0SA 3UVYA 5FH7A 4GPJA 4LC2A 4QUUA 5F36A 5CPEA 5A81A 4QSXA 3UV2A 5JWMA 5I80A 4HXMA 5I29A 5G4SA 5CQ5A 5D3TA 4YABA 5FFVA 5FE3A 3Q2FA 3SVGA 5FG5A 5FE5A 4J3IA 5HQ7A 4MR6A 4NR6A 4C66A 5F3AA 4UIZA 5I40A 1E6IA 3QZSA 4TU4A 4QC1A 4QUTA 3DAIA 2OSSA 4QR3A 4MR5A 4PCIA 5FFYA 5ENJA 4HBXA 4TT6A 3LXJA 3JVJA 5HRXA 2DVQA 4LZSA 5EVAA 5ENHA 4PS5A 5FE0A 5II1A 2RNWA 5CQAA 4WHUA 4YYGA 3UVXA 3QZTA 5DBMA 5C85A 5DW1A 4DONA 5HJCA 2E7NA 5DFBA 5DKHA 4BW3A 3MULA 5HRWA 5FE9A 4HXNA 5FE2A 4LYIA 3U5OA 4QSQA 4LDFA 1WUMA 3O35A 5I86A 5L8TA 4MEOA 5CQ8A 5LKTA 4BW4A 4IR5A 2YEMA 4A9IA 5CP5A 4NR7A 4TT4A 4UIVA 4CURA 5E9LA 5E73A 3JVMA 5ENFA 5EP7A 5EV9A 4NUDA 5EI4A 5EU1A 3U5MA 5I7XA 3UV4A 4YYMA 3LQJA 5LKXA 2OUOA 5I1QA 5BT4A 4HXPA 4ZQLA 5AD2A 4BHWA 4WIVA 4IR4A 5FE8A 2FSAA 4UIYA 4IORA 4J0SA 3U5KA 5LKUA 4YYNA 2GRCA 5FH8A 4Z6IA 4LR6A 2R0VA 4N3WA 3O33A 4QEWA 2DWWA 4HXLA 4XY9A 5FDZA 4QYLA 4QZSA 2WP2A 5E9KA 4YBTA 4ZC9A 3UW9A 4Q0OA 5A5QA 4YH3A 5D3PA 4QNSA 5EPBA 3O36A 5FFWA 4LZRA 3G0LA 4F3IA 5DFDA 4XYAA 5IG6A 4J1PA 5G4RA 5E9IA 5EA1A 3I3JA 4YATA 5FBXA 5CUDA 5EGUA 1WUGA 5D3RA 5D3NA 4A9NA 5LJ1A 5E3GA 2L84A 4YADA 4BW1A 4HBVA 3O34A 3P5OA 4E96A 5IGMA 3K2JA 5D26A 5HENA 5F1HA 2KTBB 4QSUA 4UYFA 3DWYA 5DLXA 2DKWA 5D3HA 5KU3A 5ACYA 5CY9A 5I89A 4HXSA 5E9YA 4O71A 5EQ1A 4O7FA 4CUPA 5HLSA 5D7XA 5FB0A 2NXBA 3HMFA 2N9GA 4UYDA 5E9MA 4YH4A 5EICA 4KV4A 5IIDA 4UITA 5L98A 3JVLA 4ZW1A 2I8NA 4LZ2A 5ETDA 5A82A 5DYUA 2D82A 5CQ6A 5LUUA 4Z6HA 4QSSA 4ALGA 2LSPB 5DLZA 5E74A 2DVRA 5KHMA 3JVKA 4NQNA 5F60A 5CQ3A 4MR3A 3MUKA 5KTWA 5EK9A 2L5EA 4NRAA 4QBMA 4ALHA 5IGNA 4CLBA 3P1CA 5LJ2A 5DKCA 2D9EA 4QEVA 5EWHA 4CUTA 1EQFA 4HXKA 5CUAA 2L85A 3RCWA 4UIUA 4UYEA 5CUEA 3ZYUA 4YBMA 5LVQA 5A5NA 5C4QA 5A5SA 4NR5A 5J0DA 2RI7A 5E7DA 4A9HA 4YYHA 1F68A 4Z1SA 5FE7A 4QSWA 2F6NA 5CRZA 5H1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RO1 A;  4O72 A;  4FLP A;  5DYA A;  4AKN A;  4TQN A;  5D0C A;  4MR4 A;  5HRV A;  5C8G A;  4XUA A;  2RNX A;  5E3D A;  5CQ7 A;  4QST A;  4O7E A;  4N4G A;  4Z1Q A;  4O76 A;  4N4H A;  2DAT A;  5IGK A;  4PCE A;  4XY8 A;  5IBN A;  5DW2 A;  5L97 A;  5HQ5 A;  3LJW A;  5D3S A;  2OO1 A;  4O7C A;  4YC9 A;  4X2I A;  4NXJ A;  4O78 A;  3IU5 A;  5C89 A;  4QB3 A;  3AQA A;  3Q2E A;  4YAX A;  5AME A;  4CL9 A;  4IR6 A;  5K29 A;  5HEL A;  4PTB A;  4HBW A;  2YDW A;  2YEL A;  3P1E A;  5EWD A;  2RNY A;  4NUE A;  4C67 A;  3SVH A;  1JSP B;  4OGI A;  4YY4 A;  5DY7 A;  4A9O A;  3TLP A;  5E9V A;  5H85 A;  3MXF A;  4QSV A;  5C87 A;  5HM0 A;  4QR5 A;  1ZS5 A;  4NYW A;  5C7N A;  5D24 A;  3MB3 A;  2R0Y A;  4KV1 A;  4HXO A;  4TU6 A;  4HBY A;  5ENC A;  5A83 A;  5HFQ A;  2E3K A;  4BW2 A;  5I83 A;  4O7B A;  4Q0N A;  4A9F A;  5L8U A;  4A9E A;  3QZV A;  4NQM A;  2DVV A;  3U5N A;  4O74 A;  2DVS A;  5A5R A;  1X0J A;  4O75 A;  4PY6 A;  4QEU A;  5L96 A;  1JM4 B;  4O70 A;  3MQM A;  4YYJ A;  5A5P A;  5F63 A;  4YK0 A;  5TCM A;  4TZ2 A;  4BJX A;  4NYX A;  4NYV A;  3LQI A;  4PKL A;  5CFW A;  4CUU A;  4XUB A;  2YYN A;  5CRM A;  5D3J A;  4QSP A;  5EWC A;  4IOO A;  4NR4 A;  4NUC A;  3UV5 A;  4N4F A;  4N4I A;  5E0R A;  4A9L A;  5KO4 A;  3SVF A;  5FB1 A;  5H1U A;  4QC3 A;  2YW5 A;  4UYG A;  4NR8 A;  5ETB A;  4WHW A;  5EIS A;  5F5Z A;  5CZG A;  5CUG A;  5F62 A;  4NR9 A;  5CGP A;  4TS8 A;  4LYS A;  5CQ4 A;  5F61 A;  4OGJ A;  5KTU A;  4O7A A;  3D7C A;  2R10 A;  5JI8 A;  3MB4 A;  3P1D A;  4CUS A;  4OUF A;  4YY6 A;  3S91 A;  4O77 A;  5BT5 A;  3U5J A;  5FG4 A;  5LKZ A;  4MEQ A;  5DYC A;  4IR3 A;  5DYX A;  3U5L A;  5LJ0 A;  5AMF A;  3IU6 A;  5ENI A;  4LYW A;  5A85 A;  5ENE A;  5FE6 A;  5CUC A;  5BT3 A;  4NS5 A;  4A9K A;  2I7K A;  3FKM X;  4CUQ A;  4YBS A;  5HCL A;  3P1F A;  4A9J A;  5CS8 A;  1N72 A;  4NRB A;  2H60 A;  5CU8 A;  3GG3 A;  5EM3 A;  4CFL A;  2WP1 A;  5FE4 A;  3O37 A;  4QYD A;  5ENG A;  5DX4 A;  5EWW A;  5CTL A;  3S92 A;  5EWV A;  5II2 A;  4TZ8 A;  4QY4 A;  3G0J A;  5F1L A;  5H1T A;  5F2P A;  5DFC A;  3AAD A;  4UIW A;  3UVD A;  5CQT A;  5KTX A;  3HME A;  4KCX A;  5IGL A;  5FG6 A;  5I88 A;  4RVR A;  4TT2 A;  4TYL A;  5A7C A;  4UYH A;  3NXB A;  2G4A A;  5CUB A;  3ONI A;  5L99 A;  4LRG A;  5HFR A;  3LQH A;  5EPS A;  2F6J A;  4UYF B;  3U5P A;  4J0R A;  3HMH A;  4CFK A;  5DKD A;  2MJV B;  5ENB A;  2RS9 B;  4YYI A;  4QR4 A;  4Y03 A;  4MEP A;  3UVW A;  4QSR A;  5FH6 A;  4MEN A;  4A9M A;  5HQ6 A;  5F25 A;  2YQD A;  4Z93 A;  4TTE A;  5FE1 A;  5HEM A;  4YYK A;  5D25 A;  5D3L A;  5TB6 A;  2RFJ A;  4NRC A;  5EPR A;  5AD3 A;  5I7Y A;  5COI A;  2E7O A;  4IOQ A;  4UIX A;  4HXR A;  2YEK A;  4YYD A;  5A5O A;  5LVR A;  2R0S A;  3UVY A;  5FH7 A;  4GPJ A;  4LC2 A;  4QUU A;  5F36 A;  5CPE A;  5A81 A;  4QSX A;  3UV2 A;  5JWM A;  5I80 A;  4HXM A;  5I29 A;  5G4S A;  5CQ5 A;  5D3T A;  4YAB A;  5FFV A;  5FE3 A;  3Q2F A;  3SVG A;  5FG5 A;  5FE5 A;  4J3I A;  5HQ7 A;  4MR6 A;  4NR6 A;  4C66 A;  5F3A A;  4UIZ A;  5I40 A;  1E6I A;  3QZS A;  4TU4 A;  4QC1 A;  4QUT A;  3DAI A;  2OSS A;  4QR3 A;  4MR5 A;  4PCI A;  5FFY A;  5ENJ A;  4HBX A;  4TT6 A;  3LXJ A;  3JVJ A;  5HRX A;  2DVQ A;  4LZS A;  5EVA A;  5ENH A;  4PS5 A;  5FE0 A;  5II1 A;  2RNW A;  5CQA A;  4WHU A;  4YYG A;  3UVX A;  3QZT A;  5DBM A;  5C85 A;  5DW1 A;  4DON A;  5HJC A;  2E7N A;  5DFB A;  5DKH A;  4BW3 A;  3MUL A;  5HRW A;  5FE9 A;  4HXN A;  5FE2 A;  4LYI A;  3U5O A;  4QSQ A;  4LDF A;  1WUM A;  3O35 A;  5I86 A;  5L8T A;  4MEO A;  5CQ8 A;  5LKT A;  4BW4 A;  4IR5 A;  2YEM A;  4A9I A;  5CP5 A;  4NR7 A;  4TT4 A;  4UIV A;  4CUR A;  5E9L A;  5E73 A;  3JVM A;  5ENF A;  5EP7 A;  5EV9 A;  4NUD A;  5EI4 A;  5EU1 A;  3U5M A;  5I7X A;  3UV4 A;  4YYM A;  3LQJ A;  5LKX A;  2OUO A;  5I1Q A;  5BT4 A;  4HXP A;  4ZQL A;  5AD2 A;  4BHW A;  4WIV A;  4IR4 A;  5FE8 A;  2FSA A;  4UIY A;  4IOR A;  4J0S A;  3U5K A;  5LKU A;  4YYN A;  2GRC A;  5FH8 A;  4Z6I A;  4LR6 A;  2R0V A;  4N3W A;  3O33 A;  4QEW A;  2DWW A;  4HXL A;  4XY9 A;  5FDZ A;  4QYL A;  4QZS A;  2WP2 A;  5E9K A;  4YBT A;  4ZC9 A;  3UW9 A;  4Q0O A;  5A5Q A;  4YH3 A;  5D3P A;  4QNS A;  5EPB A;  3O36 A;  5FFW A;  4LZR A;  3G0L A;  4F3I A;  5DFD A;  4XYA A;  5IG6 A;  4J1P A;  5G4R A;  5E9I A;  5EA1 A;  3I3J A;  4YAT A;  5FBX A;  5CUD A;  5EGU A;  1WUG A;  5D3R A;  5D3N A;  4A9N A;  5LJ1 A;  5E3G A;  2L84 A;  4YAD A;  4BW1 A;  4HBV A;  3O34 A;  3P5O A;  4E96 A;  5IGM A;  3K2J A;  5D26 A;  5HEN A;  5F1H A;  2KTB B;  4QSU A;  4UYF A;  3DWY A;  5DLX A;  2DKW A;  5D3H A;  5KU3 A;  5ACY A;  5CY9 A;  5I89 A;  4HXS A;  5E9Y A;  4O71 A;  5EQ1 A;  4O7F A;  4CUP A;  5HLS A;  5D7X A;  5FB0 A;  2NXB A;  3HMF A;  2N9G A;  4UYD A;  5E9M A;  4YH4 A;  5EIC A;  4KV4 A;  5IID A;  4UIT A;  5L98 A;  3JVL A;  4ZW1 A;  2I8N A;  4LZ2 A;  5ETD A;  5A82 A;  5DYU A;  2D82 A;  5CQ6 A;  5LUU A;  4Z6H A;  4QSS A;  4ALG A;  2LSP B;  5DLZ A;  5E74 A;  2DVR A;  5KHM A;  3JVK A;  4NQN A;  5F60 A;  5CQ3 A;  4MR3 A;  3MUK A;  5KTW A;  5EK9 A;  2L5E A;  4NRA A;  4QBM A;  4ALH A;  5IGN A;  4CLB A;  3P1C A;  5LJ2 A;  5DKC A;  2D9E A;  4QEV A;  5EWH A;  4CUT A;  1EQF A;  4HXK A;  5CUA A;  2L85 A;  3RCW A;  4UIU A;  4UYE A;  5CUE A;  3ZYU A;  4YBM A;  5LVQ A;  5A5N A;  5C4Q A;  5A5S A;  4NR5 A;  5J0D A;  2RI7 A;  5E7D A;  4A9H A;  4YYH A;  1F68 A;  4Z1S A;  5FE7 A;  4QSW A;  2F6N A;  5CRZ A;  5H1V A; 
#chains in the Genus database with same CATH topology
 2RO1 A;  4O72 A;  4FLP A;  5DYA A;  4AKN A;  4TQN A;  5D0C A;  4MR4 A;  5HRV A;  5C8G A;  4XUA A;  2RNX A;  5E3D A;  5CQ7 A;  4QST A;  4O7E A;  4N4G A;  4Z1Q A;  4O76 A;  4N4H A;  2DAT A;  5IGK A;  4PCE A;  4XY8 A;  5IBN A;  5DW2 A;  5L97 A;  5HQ5 A;  3LJW A;  5D3S A;  2OO1 A;  4O7C A;  4YC9 A;  4X2I A;  4NXJ A;  4O78 A;  3IU5 A;  5C89 A;  4QB3 A;  3AQA A;  3Q2E A;  4YAX A;  5AME A;  4CL9 A;  4IR6 A;  5K29 A;  5HEL A;  4PTB A;  4HBW A;  2YDW A;  2YEL A;  3P1E A;  5EWD A;  2RNY A;  4NUE A;  4C67 A;  3SVH A;  1JSP B;  4OGI A;  4YY4 A;  5DY7 A;  4A9O A;  3TLP A;  5E9V A;  5H85 A;  3MXF A;  4QSV A;  5C87 A;  5HM0 A;  4QR5 A;  1ZS5 A;  4NYW A;  5C7N A;  5D24 A;  3MB3 A;  2R0Y A;  4KV1 A;  4HXO A;  4TU6 A;  4HBY A;  5ENC A;  5A83 A;  5HFQ A;  2E3K A;  4BW2 A;  5I83 A;  4O7B A;  4Q0N A;  4A9F A;  5L8U A;  4A9E A;  3QZV A;  4NQM A;  2DVV A;  3U5N A;  3VKH A;  4O74 A;  2DVS A;  5A5R A;  1X0J A;  4O75 A;  4PY6 A;  4QEU A;  5L96 A;  1JM4 B;  4O70 A;  3MQM A;  4YYJ A;  5A5P A;  5F63 A;  4YK0 A;  5TCM A;  4TZ2 A;  4BJX A;  4NYX A;  4NYV A;  3LQI A;  4PKL A;  5CFW A;  4CUU A;  4XUB A;  2YYN A;  5CRM A;  5D3J A;  4QSP A;  5EWC A;  4IOO A;  4NR4 A;  4NUC A;  3UV5 A;  4N4F A;  4N4I A;  5E0R A;  4A9L A;  5KO4 A;  3SVF A;  5FB1 A;  5H1U A;  4QC3 A;  2YW5 A;  4UYG A;  4NR8 A;  5ETB A;  4WHW A;  5EIS A;  5F5Z A;  5CZG A;  5CUG A;  5F62 A;  4NR9 A;  5CGP A;  4TS8 A;  4LYS A;  5CQ4 A;  5F61 A;  4OGJ A;  5KTU A;  4O7A A;  3D7C A;  2R10 A;  5JI8 A;  3MB4 A;  3P1D A;  4CUS A;  4OUF A;  4YY6 A;  3S91 A;  4O77 A;  5BT5 A;  3U5J A;  5FG4 A;  5LKZ A;  4MEQ A;  5DYC A;  4IR3 A;  5DYX A;  3U5L A;  5LJ0 A;  5AMF A;  4AKI A;  3IU6 A;  5ENI A;  4LYW A;  5A85 A;  5ENE A;  5FE6 A;  5CUC A;  5BT3 A;  4NS5 A;  4A9K A;  2I7K A;  3FKM X;  4CUQ A;  4YBS A;  5HCL A;  3P1F A;  3ERR A;  4A9J A;  5CS8 A;  1N72 A;  4NRB A;  2H60 A;  5CU8 A;  3GG3 A;  5EM3 A;  4CFL A;  2WP1 A;  5FE4 A;  3O37 A;  4QYD A;  5ENG A;  5DX4 A;  5EWW A;  5CTL A;  3S92 A;  5EWV A;  5II2 A;  2EJN A;  4TZ8 A;  4QY4 A;  3G0J A;  5F1L A;  5H1T A;  5F2P A;  5DFC A;  3AAD A;  4UIW A;  3UVD A;  5CQT A;  5KTX A;  3HME A;  4KCX A;  5IGL A;  5FG6 A;  5I88 A;  4RVR A;  4TT2 A;  4TYL A;  5A7C A;  4UYH A;  3NXB A;  2G4A A;  5CUB A;  3ONI A;  5L99 A;  4LRG A;  5HFR A;  3LQH A;  1ZKR A;  5EPS A;  2F6J A;  4UYF B;  3U5P A;  4J0R A;  3HMH A;  4CFK A;  5DKD A;  2MJV B;  5ENB A;  2RS9 B;  4YYI A;  4QR4 A;  4Y03 A;  4MEP A;  3UVW A;  4QSR A;  4AKH A;  5FH6 A;  4MEN A;  4A9M A;  5HQ6 A;  5F25 A;  2YQD A;  4Z93 A;  4TTE A;  5FE1 A;  5HEM A;  4YYK A;  5D25 A;  5D3L A;  5TB6 A;  2RFJ A;  4AKG A;  4NRC A;  5EPR A;  5AD3 A;  5I7Y A;  5COI A;  2E7O A;  4IOQ A;  4UIX A;  4HXR A;  2YEK A;  4YYD A;  5A5O A;  5LVR A;  2R0S A;  3UVY A;  5FH7 A;  4GPJ A;  4LC2 A;  4QUU A;  5F36 A;  5CPE A;  5A81 A;  4QSX A;  3UV2 A;  5JWM A;  5I80 A;  4HXM A;  5I29 A;  5G4S A;  5CQ5 A;  5D3T A;  4YAB A;  5FFV A;  5FE3 A;  3Q2F A;  3SVG A;  5FG5 A;  5FE5 A;  4J3I A;  5HQ7 A;  4MR6 A;  4NR6 A;  4C66 A;  5F3A A;  4UIZ A;  5I40 A;  1E6I A;  3QZS A;  4TU4 A;  4QC1 A;  4QUT A;  3DAI A;  2OSS A;  4QR3 A;  4MR5 A;  4PCI A;  5FFY A;  5ENJ A;  4HBX A;  4TT6 A;  3LXJ A;  3JVJ A;  5HRX A;  2DVQ A;  4LZS A;  5EVA A;  5ENH A;  4PS5 A;  5FE0 A;  5II1 A;  2RNW A;  5CQA A;  4WHU A;  4YYG A;  3UVX A;  3QZT A;  5DBM A;  5C85 A;  5DW1 A;  4DON A;  5HJC A;  2E7N A;  5DFB A;  5DKH A;  3D1B A;  4BW3 A;  3MUL A;  5HRW A;  5FE9 A;  4HXN A;  5FE2 A;  4LYI A;  3U5O A;  4QSQ A;  4LDF A;  1WUM A;  3O35 A;  5I86 A;  5L8T A;  4MEO A;  5CQ8 A;  5LKT A;  4BW4 A;  4IR5 A;  2YEM A;  4A9I A;  5CP5 A;  4NR7 A;  4TT4 A;  4UIV A;  4CUR A;  5E9L A;  5E73 A;  3JVM A;  5ENF A;  5EP7 A;  5EV9 A;  4NUD A;  5EI4 A;  5EU1 A;  3U5M A;  5I7X A;  3UV4 A;  4YYM A;  3LQJ A;  5LKX A;  2OUO A;  5I1Q A;  5BT4 A;  4HXP A;  4ZQL A;  5AD2 A;  4BHW A;  4WIV A;  4IR4 A;  5FE8 A;  2FSA A;  4UIY A;  4IOR A;  4J0S A;  3U5K A;  5LKU A;  4YYN A;  2GRC A;  5FH8 A;  4Z6I A;  4LR6 A;  2R0V A;  4N3W A;  3O33 A;  4QEW A;  2DWW A;  4HXL A;  4XY9 A;  5FDZ A;  4QYL A;  4QZS A;  2WP2 A;  5E9K A;  4YBT A;  4ZC9 A;  1PUO A;  3UW9 A;  4Q0O A;  5A5Q A;  4YH3 A;  5D3P A;  4QNS A;  5EPB A;  3O36 A;  5FFW A;  4LZR A;  3G0L A;  4F3I A;  5DFD A;  4XYA A;  5IG6 A;  4J1P A;  5G4R A;  5E9I A;  5EA1 A;  3I3J A;  4YAT A;  5FBX A;  5CUD A;  5EGU A;  1WUG A;  5D3R A;  5D3N A;  4A9N A;  5LJ1 A;  5E3G A;  2L84 A;  4YAD A;  4BW1 A;  4HBV A;  3O34 A;  3P5O A;  4E96 A;  5IGM A;  3K2J A;  5D26 A;  5HEN A;  5F1H A;  2KTB B;  4QSU A;  4UYF A;  3DWY A;  5DLX A;  2DKW A;  5D3H A;  5KU3 A;  5ACY A;  5CY9 A;  5I89 A;  4HXS A;  5E9Y A;  4O71 A;  5EQ1 A;  4O7F A;  4CUP A;  5HLS A;  5D7X A;  5FB0 A;  2NXB A;  3HMF A;  2N9G A;  4UYD A;  5E9M A;  4YH4 A;  5EIC A;  4KV4 A;  3VKG A;  5IID A;  4UIT A;  5L98 A;  3JVL A;  4ZW1 A;  2I8N A;  4LZ2 A;  5ETD A;  5A82 A;  5DYU A;  2D82 A;  5CQ6 A;  5LUU A;  4Z6H A;  4QSS A;  4ALG A;  2LSP B;  3D1D A;  5DLZ A;  5E74 A;  2DVR A;  5KHM A;  3JVK A;  4NQN A;  5F60 A;  5CQ3 A;  4MR3 A;  3MUK A;  5KTW A;  5EK9 A;  2L5E A;  4NRA A;  4QBM A;  4ALH A;  5IGN A;  4CLB A;  3P1C A;  5LJ2 A;  5DKC A;  2D9E A;  4QEV A;  5EWH A;  4CUT A;  1EQF A;  4HXK A;  5CUA A;  2L85 A;  3RCW A;  4UIU A;  4UYE A;  5CUE A;  3ZYU A;  4YBM A;  5LVQ A;  5A5N A;  5C4Q A;  4AI6 A;  5A5S A;  4NR5 A;  5J0D A;  2RI7 A;  5E7D A;  4A9H A;  4YYH A;  1F68 A;  4Z1S A;  5FE7 A;  4QSW A;  2F6N A;  5CRZ A;  5H1V A; 
#chains in the Genus database with same CATH homology
 2RO1 A;  4O72 A;  4FLP A;  5DYA A;  4AKN A;  4TQN A;  5D0C A;  4MR4 A;  5HRV A;  5C8G A;  4XUA A;  2RNX A;  5E3D A;  5CQ7 A;  4QST A;  4O7E A;  4N4G A;  4Z1Q A;  4O76 A;  4N4H A;  2DAT A;  5IGK A;  4PCE A;  4XY8 A;  5IBN A;  5DW2 A;  5L97 A;  5HQ5 A;  3LJW A;  5D3S A;  2OO1 A;  4O7C A;  4YC9 A;  4X2I A;  4NXJ A;  4O78 A;  3IU5 A;  5C89 A;  4QB3 A;  3AQA A;  3Q2E A;  4YAX A;  5AME A;  4CL9 A;  4IR6 A;  5K29 A;  5HEL A;  4PTB A;  4HBW A;  2YDW A;  2YEL A;  3P1E A;  5EWD A;  2RNY A;  4NUE A;  4C67 A;  3SVH A;  1JSP B;  4OGI A;  4YY4 A;  5DY7 A;  4A9O A;  3TLP A;  5E9V A;  5H85 A;  3MXF A;  4QSV A;  5C87 A;  5HM0 A;  4QR5 A;  1ZS5 A;  4NYW A;  5C7N A;  5D24 A;  3MB3 A;  2R0Y A;  4KV1 A;  4HXO A;  4TU6 A;  4HBY A;  5ENC A;  5A83 A;  5HFQ A;  2E3K A;  4BW2 A;  5I83 A;  4O7B A;  4Q0N A;  4A9F A;  5L8U A;  4A9E A;  3QZV A;  4NQM A;  2DVV A;  3U5N A;  4O74 A;  2DVS A;  5A5R A;  1X0J A;  4O75 A;  4PY6 A;  4QEU A;  5L96 A;  1JM4 B;  4O70 A;  3MQM A;  4YYJ A;  5A5P A;  5F63 A;  4YK0 A;  5TCM A;  4TZ2 A;  4BJX A;  4NYX A;  4NYV A;  3LQI A;  4PKL A;  5CFW A;  4CUU A;  4XUB A;  2YYN A;  5CRM A;  5D3J A;  4QSP A;  5EWC A;  4IOO A;  4NR4 A;  4NUC A;  3UV5 A;  4N4F A;  4N4I A;  5E0R A;  4A9L A;  5KO4 A;  3SVF A;  5FB1 A;  5H1U A;  4QC3 A;  2YW5 A;  4UYG A;  4NR8 A;  5ETB A;  4WHW A;  5EIS A;  5F5Z A;  5CZG A;  5CUG A;  5F62 A;  4NR9 A;  5CGP A;  4TS8 A;  4LYS A;  5CQ4 A;  5F61 A;  4OGJ A;  5KTU A;  4O7A A;  3D7C A;  2R10 A;  5JI8 A;  3MB4 A;  3P1D A;  4CUS A;  4OUF A;  4YY6 A;  3S91 A;  4O77 A;  5BT5 A;  3U5J A;  5FG4 A;  5LKZ A;  4MEQ A;  5DYC A;  4IR3 A;  5DYX A;  3U5L A;  5LJ0 A;  5AMF A;  3IU6 A;  5ENI A;  4LYW A;  5A85 A;  5ENE A;  5FE6 A;  5CUC A;  5BT3 A;  4NS5 A;  4A9K A;  2I7K A;  3FKM X;  4CUQ A;  4YBS A;  5HCL A;  3P1F A;  4A9J A;  5CS8 A;  1N72 A;  4NRB A;  2H60 A;  5CU8 A;  3GG3 A;  5EM3 A;  4CFL A;  2WP1 A;  5FE4 A;  3O37 A;  4QYD A;  5ENG A;  5DX4 A;  5EWW A;  5CTL A;  3S92 A;  5EWV A;  5II2 A;  4TZ8 A;  4QY4 A;  3G0J A;  5F1L A;  5H1T A;  5F2P A;  5DFC A;  3AAD A;  4UIW A;  3UVD A;  5CQT A;  5KTX A;  3HME A;  4KCX A;  5IGL A;  5FG6 A;  5I88 A;  4RVR A;  4TT2 A;  4TYL A;  5A7C A;  4UYH A;  3NXB A;  2G4A A;  5CUB A;  3ONI A;  5L99 A;  4LRG A;  5HFR A;  3LQH A;  5EPS A;  2F6J A;  4UYF B;  3U5P A;  4J0R A;  3HMH A;  4CFK A;  5DKD A;  2MJV B;  5ENB A;  2RS9 B;  4YYI A;  4QR4 A;  4Y03 A;  4MEP A;  3UVW A;  4QSR A;  5FH6 A;  4MEN A;  4A9M A;  5HQ6 A;  5F25 A;  2YQD A;  4Z93 A;  4TTE A;  5FE1 A;  5HEM A;  4YYK A;  5D25 A;  5D3L A;  5TB6 A;  2RFJ A;  4NRC A;  5EPR A;  5AD3 A;  5I7Y A;  5COI A;  2E7O A;  4IOQ A;  4UIX A;  4HXR A;  2YEK A;  4YYD A;  5A5O A;  5LVR A;  2R0S A;  3UVY A;  5FH7 A;  4GPJ A;  4LC2 A;  4QUU A;  5F36 A;  5CPE A;  5A81 A;  4QSX A;  3UV2 A;  5JWM A;  5I80 A;  4HXM A;  5I29 A;  5G4S A;  5CQ5 A;  5D3T A;  4YAB A;  5FFV A;  5FE3 A;  3Q2F A;  3SVG A;  5FG5 A;  5FE5 A;  4J3I A;  5HQ7 A;  4MR6 A;  4NR6 A;  4C66 A;  5F3A A;  4UIZ A;  5I40 A;  1E6I A;  3QZS A;  4TU4 A;  4QC1 A;  4QUT A;  3DAI A;  2OSS A;  4QR3 A;  4MR5 A;  4PCI A;  5FFY A;  5ENJ A;  4HBX A;  4TT6 A;  3LXJ A;  3JVJ A;  5HRX A;  2DVQ A;  4LZS A;  5EVA A;  5ENH A;  4PS5 A;  5FE0 A;  5II1 A;  2RNW A;  5CQA A;  4WHU A;  4YYG A;  3UVX A;  3QZT A;  5DBM A;  5C85 A;  5DW1 A;  4DON A;  5HJC A;  2E7N A;  5DFB A;  5DKH A;  4BW3 A;  3MUL A;  5HRW A;  5FE9 A;  4HXN A;  5FE2 A;  4LYI A;  3U5O A;  4QSQ A;  4LDF A;  1WUM A;  3O35 A;  5I86 A;  5L8T A;  4MEO A;  5CQ8 A;  5LKT A;  4BW4 A;  4IR5 A;  2YEM A;  4A9I A;  5CP5 A;  4NR7 A;  4TT4 A;  4UIV A;  4CUR A;  5E9L A;  5E73 A;  3JVM A;  5ENF A;  5EP7 A;  5EV9 A;  4NUD A;  5EI4 A;  5EU1 A;  3U5M A;  5I7X A;  3UV4 A;  4YYM A;  3LQJ A;  5LKX A;  2OUO A;  5I1Q A;  5BT4 A;  4HXP A;  4ZQL A;  5AD2 A;  4BHW A;  4WIV A;  4IR4 A;  5FE8 A;  2FSA A;  4UIY A;  4IOR A;  4J0S A;  3U5K A;  5LKU A;  4YYN A;  2GRC A;  5FH8 A;  4Z6I A;  4LR6 A;  2R0V A;  4N3W A;  3O33 A;  4QEW A;  2DWW A;  4HXL A;  4XY9 A;  5FDZ A;  4QYL A;  4QZS A;  2WP2 A;  5E9K A;  4YBT A;  4ZC9 A;  3UW9 A;  4Q0O A;  5A5Q A;  4YH3 A;  5D3P A;  4QNS A;  5EPB A;  3O36 A;  5FFW A;  4LZR A;  3G0L A;  4F3I A;  5DFD A;  4XYA A;  5IG6 A;  4J1P A;  5G4R A;  5E9I A;  5EA1 A;  3I3J A;  4YAT A;  5FBX A;  5CUD A;  5EGU A;  1WUG A;  5D3R A;  5D3N A;  4A9N A;  5LJ1 A;  5E3G A;  2L84 A;  4YAD A;  4BW1 A;  4HBV A;  3O34 A;  3P5O A;  4E96 A;  5IGM A;  3K2J A;  5D26 A;  5HEN A;  5F1H A;  2KTB B;  4QSU A;  4UYF A;  3DWY A;  5DLX A;  2DKW A;  5D3H A;  5KU3 A;  5ACY A;  5CY9 A;  5I89 A;  4HXS A;  5E9Y A;  4O71 A;  5EQ1 A;  4O7F A;  4CUP A;  5HLS A;  5D7X A;  5FB0 A;  2NXB A;  3HMF A;  2N9G A;  4UYD A;  5E9M A;  4YH4 A;  5EIC A;  4KV4 A;  5IID A;  4UIT A;  5L98 A;  3JVL A;  4ZW1 A;  2I8N A;  4LZ2 A;  5ETD A;  5A82 A;  5DYU A;  2D82 A;  5CQ6 A;  5LUU A;  4Z6H A;  4QSS A;  4ALG A;  2LSP B;  5DLZ A;  5E74 A;  2DVR A;  5KHM A;  3JVK A;  4NQN A;  5F60 A;  5CQ3 A;  4MR3 A;  3MUK A;  5KTW A;  5EK9 A;  2L5E A;  4NRA A;  4QBM A;  4ALH A;  5IGN A;  4CLB A;  3P1C A;  5LJ2 A;  5DKC A;  2D9E A;  4QEV A;  5EWH A;  4CUT A;  1EQF A;  4HXK A;  5CUA A;  2L85 A;  3RCW A;  4UIU A;  4UYE A;  5CUE A;  3ZYU A;  4YBM A;  5LVQ A;  5A5N A;  5C4Q A;  5A5S A;  4NR5 A;  5J0D A;  2RI7 A;  5E7D A;  4A9H A;  4YYH A;  1F68 A;  4Z1S A;  5FE7 A;  4QSW A;  2F6N A;  5CRZ A;  5H1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...