5LJ0A

Crystal structure of human atad2 bromodomain in complex with 8-(((3r,4r,5s)-3-((4,4-difluorocyclohexyl)methoxy)-5-methoxypiperidin-4-yl)amino)-3-methyl-5-(5-methylpyridin-3-yl)-1,7-naphthyridin-2(1h)-one
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title A Chemical Probe for the ATAD2 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5lj0A00
4HXKA 5DYXA 2LSPB 5ENFA 5BT5A 5F1LA 5FG4A 5A7CA 4QSQA 5DLXA 5E9IA 5A5QA 4NRBA 1JM4B 1F68A 4YBSA 4QEVA 4IR3A 5CQ5A 3MUKA 3P5OA 4YABA 4NRAA 4KCXA 5EWWA 5FG5A 3NXBA 2RS9B 3LQIA 4TT4A 5I88A 5HFQA 4LZ2A 5D3RA 3P1CA 4YATA 5FE3A 5G4SA 1E6IA 4QSUA 5EWHA 2RNYA 4PCIA 5EQ1A 2RNWA 5A82A 2F6JA 4XUAA 4YYHA 5A5SA 5AD3A 5BT4A 2I7KA 3AADA 4TT6A 5DYAA 2D82A 4QZSA 4LYIA 4MR6A 5FFVA 4KV1A 4E96A 2OUOA 3RCWA 5EU1A 2R0VA 4N4HA 5CQ8A 5F60A 5HM0A 5CFWA 2RI7A 3O33A 5A5RA 5DY7A 2L84A 3D7CA 4UIVA 5LKXA 3LXJA 5EV9A 5C89A 5LKZA 3U5PA 4PTBA 5DX4A 4CUQA 3UV2A 5HQ7A 4O70A 3U5LA 5HCLA 4O7EA 5EICA 5ENEA 4A9LA 3P1DA 5L98A 5I86A 4MEPA 4O7FA 4DONA 4UIYA 4YYDA 3LJWA 5E9MA 5CPEA 4NYXA 2MJVB 3MQMA 5KTWA 4PS5A 3P1FA 2YEMA 4UYDA 5ETBA 3HMFA 5I83A 2RNXA 4IOOA 4QSVA 5HQ5A 2DKWA 5DKHA 1N72A 4A9HA 5E74A 3UVWA 5CUGA 4IR4A 5KTUA 5LUUA 4NUCA 4Q0OA 5D3SA 3QZSA 4YY4A 5DKDA 2DWWA 3TLPA 3UV4A 5DFBA 5ACYA 4NR6A 2DVVA 2F6NA 2I8NA 4TQNA 4O74A 4NRCA 5D3NA 3MXFA 4TYLA 4YK0A 5FFYA 5HRXA 4PCEA 3P1EA 4YH3A 5FH6A 4HBWA 4MR4A 2NXBA 4QEUA 2R0SA 4TZ8A 4A9JA 5C4QA 4TU6A 5F5ZA 3JVKA 5EPBA 4FLPA 2D9EA 5CQTA 3MB3A 3MB4A 4QUTA 4HXMA 4IR6A 3U5MA 4AKNA 5CQ6A 4LRGA 4QSPA 5F25A 5E0RA 4XY9A 4IR5A 5EISA 4QSXA 2YELA 4LYWA 5IGNA 5A5PA 2DATA 3Q2FA 4C67A 5CRMA 3JVMA 5E9LA 4A9KA 4O78A 5FE4A 2G4AA 2L5EA 3DWYA 5ENHA 4ZQLA 5EWVA 4A9IA 5EM3A 5CUAA 4MENA 3O35A 4YADA 5EGUA 4OUFA 4NUEA 3LQHA 5H1VA 4CUPA 5KHMA 4XY8A 4A9MA 4HXLA 4LZSA 4OGIA 4QYDA 5LJ1A 5I1QA 5KU3A 2WP2A 5COIA 4NR8A 5DW2A 4Q0NA 5LKUA 4YBTA 4NUDA 3SVGA 4MR3A 3IU5A 5E3GA 5IG6A 4CUTA 4XUBA 3O34A 4QSSA 5FE6A 5D24A 4YYJA 4A9NA 5E73A 4TS8A 4O72A 4NXJA 5L99A 5L96A 3JVLA 1X0JA 5BT3A 4LDFA 5FE9A 4HBYA 3UW9A 5DLZA 5DBMA 2WP1A 5FE8A 5E9VA 4YYIA 5ENJA 3ZYUA 2E7OA 4QC1A 4UYEA 2OO1A 4ALHA 4NR9A 5DYCA 5FE2A 4N4FA 4HBVA 4GPJA 1JSPB 4HXNA 4A9FA 4NYVA 4PKLA 5HRWA 5I80A 3O36A 2YYNA 5JWMA 5D26A 2R0YA 5A5NA 5IGMA 2R10A 5CRZA 4NQNA 5EPRA 5HJCA 5H85A 5HELA 4BHWA 4O77A 3ONIA 5I40A 4NR5A 2RFJA 5LJ0A 4QR5A 5CUDA 4LC2A 4TT2A 5CUEA 5E9KA 3U5OA 5LJ2A 3SVFA 4J1PA 4YBMA 5FE7A 5HQ6A 5EK9A 5FBXA 5HEMA 5CUBA 4YYMA 2FSAA 5D0CA 5D7XA 4TZ2A 4ALGA 1WUGA 5L97A 4YC9A 5ENBA 3MULA 5H1TA 4A9EA 5TB6A 4CFKA 3HMHA 3IU6A 3LQJA 4OGJA 4HBXA 3G0JA 5I7YA 4Z1SA 5J0DA 5CZGA 2YQDA 4LR6A 4YYKA 5TCMA 5D3HA 5LKTA 4O76A 5ENCA 5D3PA 4J0SA 5D3TA 3Q2EA 4O71A 4A9OA 4Z1QA 5DW1A 4Y03A 5DKCA 4ZC9A 5II1A 4MEQA 4QC3A 2YDWA 5CQAA 5F63A 5DYUA 3G0LA 4QBMA 2DVSA 4N4IA 1ZS5A 4WHWA 4NQMA 5CGPA 2OSSA 3U5KA 5FE0A 5HLSA 5IIDA 4YH4A 4J3IA 4HXRA 5D3LA 5EPSA 2GRCA 5EI4A 5L8UA 4F3IA 1WUMA 5I29A 3QZVA 5E9YA 4BW3A 4Z93A 4CUUA 5FE1A 5LVRA 2DVQA 1EQFA 5CQ4A 5FH8A 5F2PA 5FG6A 3U5JA 5HRVA 5E7DA 5FDZA 5IBNA 5FH7A 5CQ7A 3DAIA 5CY9A 3S92A 5EP7A 4HXPA 4UIXA 5AMEA 5FB1A 5C87A 4BW4A 5D25A 5F3AA 3AQAA 4HXSA 5FB0A 3U5NA 4IORA 4YY6A 4UIZA 5F36A 5C8GA 4LYSA 4QY4A 5A83A 4IOQA 4UIWA 4CFLA 3S91A 4UITA 4O75A 4N4GA 5HENA 3UV5A 2E7NA 4XYAA 4Z6HA 4NR7A 3UVYA 4BJXA 5EWDA 4UYFB 4MEOA 4QNSA 5D3JA 5HFRA 5CQ3A 4MR5A 4NS5A 4PY6A 4KV4A 4WIVA 4QSRA 4ZW1A 4O7CA 4LZRA 5EVAA 4NYWA 5F1HA 5DFCA 5IGLA 3FKMX 5K29A 5E3DA 3QZTA 3I3JA 5F61A 3GG3A 5ENGA 5LVQA 4UYFA 3JVJA 4BW2A 5CS8A 4J0RA 5G4RA 2H60A 4YYGA 2DVRA 5CUCA 4TTEA 5FE5A 3SVHA 2KTBB 4HXOA 5CU8A 4O7BA 4QYLA 4CUSA 5A85A 5EWCA 4CURA 5II2A 5C7NA 3HMEA 3K2JA 5CP5A 4N3WA 5ENIA 5KO4A 4RVRA 5A81A 5H1UA 4QSWA 4QSTA 2E3KA 4UIUA 5AMFA 5I89A 4YYNA 2YW5A 3UVXA 2L85A 5L8TA 5CTLA 4BW1A 4O7AA 2YEKA 5DFDA 5I7XA 2N9GA 4TU4A 4UYHA 5C85A 5IGKA 4YAXA 3UVDA 5JI8A 4UYGA 5ETDA 4Z6IA 4CL9A 4QUUA 2RO1A 4X2IA 4C66A 4QR3A 4NR4A 5FFWA 4QEWA 4QR4A 4CLBA 5F62A 5EA1A 4QB3A 5A5OA 5KTXA 4WHUA 5AD2A 3O37A
chains in the Genus database with same CATH superfamily
4HXKA 5DYXA 2LSPB 5ENFA 5BT5A 5F1LA 5FG4A 5A7CA 4QSQA 5DLXA 5E9IA 5A5QA 4NRBA 1JM4B 1F68A 4YBSA 4QEVA 4IR3A 5CQ5A 3MUKA 3P5OA 4YABA 4NRAA 4KCXA 5EWWA 5FG5A 3NXBA 2RS9B 3LQIA 4TT4A 5I88A 5HFQA 4LZ2A 5D3RA 3P1CA 4YATA 5FE3A 5G4SA 1E6IA 4QSUA 5EWHA 2RNYA 4PCIA 5EQ1A 2RNWA 5A82A 2F6JA 4XUAA 4YYHA 5A5SA 5AD3A 5BT4A 2I7KA 3AADA 4TT6A 5DYAA 2D82A 4QZSA 4LYIA 4MR6A 5FFVA 4KV1A 4E96A 2OUOA 3RCWA 5EU1A 2R0VA 4N4HA 5CQ8A 5F60A 5HM0A 5CFWA 2RI7A 3O33A 5A5RA 5DY7A 2L84A 3D7CA 4UIVA 5LKXA 3LXJA 5EV9A 5C89A 5LKZA 3U5PA 4PTBA 5DX4A 4CUQA 3UV2A 5HQ7A 4O70A 3U5LA 5HCLA 4O7EA 5EICA 5ENEA 4A9LA 3P1DA 1ZKRA 5L98A 3ERRA 5I86A 4MEPA 4O7FA 4DONA 4UIYA 4YYDA 3LJWA 5E9MA 5CPEA 4NYXA 2MJVB 3MQMA 4AKGA 5KTWA 4PS5A 3P1FA 2YEMA 4UYDA 5ETBA 3HMFA 5I83A 2RNXA 4IOOA 4QSVA 3VKGA 5HQ5A 2DKWA 5DKHA 1N72A 4A9HA 5E74A 3UVWA 5CUGA 4IR4A 5KTUA 5LUUA 4NUCA 4Q0OA 5D3SA 3QZSA 4YY4A 5DKDA 2DWWA 3TLPA 3UV4A 5DFBA 5ACYA 4NR6A 2DVVA 2F6NA 2I8NA 4TQNA 4O74A 4NRCA 5D3NA 3MXFA 4TYLA 4YK0A 5FFYA 5HRXA 4PCEA 3P1EA 4YH3A 5FH6A 4HBWA 4MR4A 2NXBA 4QEUA 2R0SA 4TZ8A 4A9JA 5C4QA 4TU6A 5F5ZA 3JVKA 5EPBA 4FLPA 2D9EA 5CQTA 3MB3A 3MB4A 4QUTA 4HXMA 4IR6A 3U5MA 4AKNA 5CQ6A 4LRGA 4QSPA 5F25A 5E0RA 4XY9A 4IR5A 5EISA 4QSXA 2YELA 4LYWA 5IGNA 5A5PA 4AKHA 2DATA 3Q2FA 4C67A 5CRMA 3JVMA 5E9LA 4A9KA 4O78A 5FE4A 2G4AA 2L5EA 3DWYA 5ENHA 4ZQLA 5EWVA 4A9IA 5EM3A 5CUAA 4MENA 3O35A 4YADA 5EGUA 4OUFA 4NUEA 3LQHA 5H1VA 4CUPA 5KHMA 4XY8A 4A9MA 4HXLA 4LZSA 4OGIA 4QYDA 5LJ1A 5I1QA 5KU3A 2WP2A 5COIA 4NR8A 5DW2A 3D1DA 4Q0NA 5LKUA 4YBTA 4NUDA 3SVGA 4MR3A 3IU5A 5E3GA 5IG6A 4CUTA 4XUBA 3O34A 4QSSA 5FE6A 5D24A 4YYJA 4A9NA 5E73A 4TS8A 4O72A 4NXJA 5L99A 5L96A 3JVLA 1X0JA 5BT3A 4LDFA 5FE9A 4HBYA 3UW9A 5DLZA 5DBMA 2WP1A 5FE8A 5E9VA 4YYIA 5ENJA 3ZYUA 2E7OA 4QC1A 4UYEA 2OO1A 4ALHA 4NR9A 5DYCA 5FE2A 4N4FA 4HBVA 4GPJA 1JSPB 4HXNA 4A9FA 4NYVA 4PKLA 5HRWA 5I80A 3O36A 2YYNA 5JWMA 5D26A 2R0YA 5A5NA 5IGMA 2R10A 5CRZA 4NQNA 5EPRA 5HJCA 5H85A 2EJNA 5HELA 4BHWA 4O77A 3ONIA 5I40A 4NR5A 2RFJA 5LJ0A 4QR5A 5CUDA 4LC2A 4TT2A 5CUEA 5E9KA 3U5OA 5LJ2A 3SVFA 4J1PA 4YBMA 5FE7A 5HQ6A 5EK9A 5FBXA 5HEMA 5CUBA 4YYMA 2FSAA 5D0CA 5D7XA 4TZ2A 4ALGA 1WUGA 5L97A 4YC9A 5ENBA 3MULA 5H1TA 4A9EA 5TB6A 4CFKA 3HMHA 3IU6A 3LQJA 4OGJA 4HBXA 3G0JA 5I7YA 4Z1SA 5J0DA 5CZGA 2YQDA 4LR6A 4YYKA 5TCMA 5D3HA 5LKTA 4O76A 5ENCA 5D3PA 4J0SA 5D3TA 3Q2EA 4O71A 4A9OA 4Z1QA 5DW1A 4Y03A 5DKCA 4ZC9A 5II1A 4MEQA 4QC3A 2YDWA 5CQAA 5F63A 1PUOA 5DYUA 3G0LA 4QBMA 2DVSA 4N4IA 1ZS5A 4WHWA 4NQMA 5CGPA 2OSSA 3U5KA 5FE0A 5HLSA 5IIDA 4YH4A 4J3IA 4HXRA 5D3LA 5EPSA 2GRCA 5EI4A 5L8UA 4F3IA 1WUMA 5I29A 3QZVA 5E9YA 4BW3A 4Z93A 4CUUA 5FE1A 5LVRA 2DVQA 1EQFA 5CQ4A 5FH8A 5F2PA 5FG6A 3VKHA 3U5JA 5HRVA 5E7DA 5FDZA 5IBNA 5FH7A 5CQ7A 3DAIA 5CY9A 3S92A 5EP7A 4HXPA 4UIXA 5AMEA 5FB1A 5C87A 4BW4A 4AI6A 3D1BA 5D25A 5F3AA 3AQAA 4HXSA 5FB0A 3U5NA 4IORA 4YY6A 4UIZA 5F36A 5C8GA 4AKIA 4LYSA 4QY4A 5A83A 4IOQA 4UIWA 4CFLA 3S91A 4UITA 4O75A 4N4GA 5HENA 3UV5A 2E7NA 4XYAA 4Z6HA 4NR7A 3UVYA 4BJXA 5EWDA 4UYFB 4MEOA 4QNSA 5D3JA 5HFRA 5CQ3A 4MR5A 4NS5A 4PY6A 4KV4A 4WIVA 4QSRA 4ZW1A 4O7CA 4LZRA 5EVAA 4NYWA 5F1HA 5DFCA 5IGLA 3FKMX 5K29A 5E3DA 3QZTA 3I3JA 5F61A 3GG3A 5ENGA 5LVQA 4UYFA 3JVJA 4BW2A 5CS8A 4J0RA 5G4RA 2H60A 4YYGA 2DVRA 5CUCA 4TTEA 5FE5A 3SVHA 2KTBB 4HXOA 5CU8A 4O7BA 4QYLA 4CUSA 5A85A 5EWCA 4CURA 5II2A 5C7NA 3HMEA 3K2JA 5CP5A 4N3WA 5ENIA 5KO4A 4RVRA 5A81A 5H1UA 4QSWA 4QSTA 2E3KA 4UIUA 5AMFA 5I89A 4YYNA 2YW5A 3UVXA 2L85A 5L8TA 5CTLA 4BW1A 4O7AA 2YEKA 5DFDA 5I7XA 2N9GA 4TU4A 4UYHA 5C85A 5IGKA 4YAXA 3UVDA 5JI8A 4UYGA 5ETDA 4Z6IA 4CL9A 4QUUA 2RO1A 4X2IA 4C66A 4QR3A 4NR4A 5FFWA 4QEWA 4QR4A 4CLBA 5F62A 5EA1A 4QB3A 5A5OA 5KTXA 4WHUA 5AD2A 3O37A
chains in the Genus database with same CATH topology
4HXKA 5DYXA 2LSPB 5ENFA 5BT5A 5F1LA 5FG4A 5A7CA 4QSQA 5DLXA 5E9IA 5A5QA 4NRBA 1JM4B 1F68A 4YBSA 4QEVA 4IR3A 5CQ5A 3MUKA 3P5OA 4YABA 4NRAA 4KCXA 5EWWA 5FG5A 3NXBA 2RS9B 3LQIA 4TT4A 5I88A 5HFQA 4LZ2A 5D3RA 3P1CA 4YATA 5FE3A 5G4SA 1E6IA 4QSUA 5EWHA 2RNYA 4PCIA 5EQ1A 2RNWA 5A82A 2F6JA 4XUAA 4YYHA 5A5SA 5AD3A 5BT4A 2I7KA 3AADA 4TT6A 5DYAA 2D82A 4QZSA 4LYIA 4MR6A 5FFVA 4KV1A 4E96A 2OUOA 3RCWA 5EU1A 2R0VA 4N4HA 5CQ8A 5F60A 5HM0A 5CFWA 2RI7A 3O33A 5A5RA 5DY7A 2L84A 3D7CA 4UIVA 5LKXA 3LXJA 5EV9A 5C89A 5LKZA 3U5PA 4PTBA 5DX4A 4CUQA 3UV2A 5HQ7A 4O70A 3U5LA 5HCLA 4O7EA 5EICA 5ENEA 4A9LA 3P1DA 5L98A 5I86A 4MEPA 4O7FA 4DONA 4UIYA 4YYDA 3LJWA 5E9MA 5CPEA 4NYXA 2MJVB 3MQMA 5KTWA 4PS5A 3P1FA 2YEMA 4UYDA 5ETBA 3HMFA 5I83A 2RNXA 4IOOA 4QSVA 5HQ5A 2DKWA 5DKHA 1N72A 4A9HA 5E74A 3UVWA 5CUGA 4IR4A 5KTUA 5LUUA 4NUCA 4Q0OA 5D3SA 3QZSA 4YY4A 5DKDA 2DWWA 3TLPA 3UV4A 5DFBA 5ACYA 4NR6A 2DVVA 2F6NA 2I8NA 4TQNA 4O74A 4NRCA 5D3NA 3MXFA 4TYLA 4YK0A 5FFYA 5HRXA 4PCEA 3P1EA 4YH3A 5FH6A 4HBWA 4MR4A 2NXBA 4QEUA 2R0SA 4TZ8A 4A9JA 5C4QA 4TU6A 5F5ZA 3JVKA 5EPBA 4FLPA 2D9EA 5CQTA 3MB3A 3MB4A 4QUTA 4HXMA 4IR6A 3U5MA 4AKNA 5CQ6A 4LRGA 4QSPA 5F25A 5E0RA 4XY9A 4IR5A 5EISA 4QSXA 2YELA 4LYWA 5IGNA 5A5PA 2DATA 3Q2FA 4C67A 5CRMA 3JVMA 5E9LA 4A9KA 4O78A 5FE4A 2G4AA 2L5EA 3DWYA 5ENHA 4ZQLA 5EWVA 4A9IA 5EM3A 5CUAA 4MENA 3O35A 4YADA 5EGUA 4OUFA 4NUEA 3LQHA 5H1VA 4CUPA 5KHMA 4XY8A 4A9MA 4HXLA 4LZSA 4OGIA 4QYDA 5LJ1A 5I1QA 5KU3A 2WP2A 5COIA 4NR8A 5DW2A 4Q0NA 5LKUA 4YBTA 4NUDA 3SVGA 4MR3A 3IU5A 5E3GA 5IG6A 4CUTA 4XUBA 3O34A 4QSSA 5FE6A 5D24A 4YYJA 4A9NA 5E73A 4TS8A 4O72A 4NXJA 5L99A 5L96A 3JVLA 1X0JA 5BT3A 4LDFA 5FE9A 4HBYA 3UW9A 5DLZA 5DBMA 2WP1A 5FE8A 5E9VA 4YYIA 5ENJA 3ZYUA 2E7OA 4QC1A 4UYEA 2OO1A 4ALHA 4NR9A 5DYCA 5FE2A 4N4FA 4HBVA 4GPJA 1JSPB 4HXNA 4A9FA 4NYVA 4PKLA 5HRWA 5I80A 3O36A 2YYNA 5JWMA 5D26A 2R0YA 5A5NA 5IGMA 2R10A 5CRZA 4NQNA 5EPRA 5HJCA 5H85A 5HELA 4BHWA 4O77A 3ONIA 5I40A 4NR5A 2RFJA 5LJ0A 4QR5A 5CUDA 4LC2A 4TT2A 5CUEA 5E9KA 3U5OA 5LJ2A 3SVFA 4J1PA 4YBMA 5FE7A 5HQ6A 5EK9A 5FBXA 5HEMA 5CUBA 4YYMA 2FSAA 5D0CA 5D7XA 4TZ2A 4ALGA 1WUGA 5L97A 4YC9A 5ENBA 3MULA 5H1TA 4A9EA 5TB6A 4CFKA 3HMHA 3IU6A 3LQJA 4OGJA 4HBXA 3G0JA 5I7YA 4Z1SA 5J0DA 5CZGA 2YQDA 4LR6A 4YYKA 5TCMA 5D3HA 5LKTA 4O76A 5ENCA 5D3PA 4J0SA 5D3TA 3Q2EA 4O71A 4A9OA 4Z1QA 5DW1A 4Y03A 5DKCA 4ZC9A 5II1A 4MEQA 4QC3A 2YDWA 5CQAA 5F63A 5DYUA 3G0LA 4QBMA 2DVSA 4N4IA 1ZS5A 4WHWA 4NQMA 5CGPA 2OSSA 3U5KA 5FE0A 5HLSA 5IIDA 4YH4A 4J3IA 4HXRA 5D3LA 5EPSA 2GRCA 5EI4A 5L8UA 4F3IA 1WUMA 5I29A 3QZVA 5E9YA 4BW3A 4Z93A 4CUUA 5FE1A 5LVRA 2DVQA 1EQFA 5CQ4A 5FH8A 5F2PA 5FG6A 3U5JA 5HRVA 5E7DA 5FDZA 5IBNA 5FH7A 5CQ7A 3DAIA 5CY9A 3S92A 5EP7A 4HXPA 4UIXA 5AMEA 5FB1A 5C87A 4BW4A 5D25A 5F3AA 3AQAA 4HXSA 5FB0A 3U5NA 4IORA 4YY6A 4UIZA 5F36A 5C8GA 4LYSA 4QY4A 5A83A 4IOQA 4UIWA 4CFLA 3S91A 4UITA 4O75A 4N4GA 5HENA 3UV5A 2E7NA 4XYAA 4Z6HA 4NR7A 3UVYA 4BJXA 5EWDA 4UYFB 4MEOA 4QNSA 5D3JA 5HFRA 5CQ3A 4MR5A 4NS5A 4PY6A 4KV4A 4WIVA 4QSRA 4ZW1A 4O7CA 4LZRA 5EVAA 4NYWA 5F1HA 5DFCA 5IGLA 3FKMX 5K29A 5E3DA 3QZTA 3I3JA 5F61A 3GG3A 5ENGA 5LVQA 4UYFA 3JVJA 4BW2A 5CS8A 4J0RA 5G4RA 2H60A 4YYGA 2DVRA 5CUCA 4TTEA 5FE5A 3SVHA 2KTBB 4HXOA 5CU8A 4O7BA 4QYLA 4CUSA 5A85A 5EWCA 4CURA 5II2A 5C7NA 3HMEA 3K2JA 5CP5A 4N3WA 5ENIA 5KO4A 4RVRA 5A81A 5H1UA 4QSWA 4QSTA 2E3KA 4UIUA 5AMFA 5I89A 4YYNA 2YW5A 3UVXA 2L85A 5L8TA 5CTLA 4BW1A 4O7AA 2YEKA 5DFDA 5I7XA 2N9GA 4TU4A 4UYHA 5C85A 5IGKA 4YAXA 3UVDA 5JI8A 4UYGA 5ETDA 4Z6IA 4CL9A 4QUUA 2RO1A 4X2IA 4C66A 4QR3A 4NR4A 5FFWA 4QEWA 4QR4A 4CLBA 5F62A 5EA1A 4QB3A 5A5OA 5KTXA 4WHUA 5AD2A 3O37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXK A;  5DYX A;  2LSP B;  5ENF A;  5BT5 A;  5F1L A;  5FG4 A;  5A7C A;  4QSQ A;  5DLX A;  5E9I A;  5A5Q A;  4NRB A;  1JM4 B;  1F68 A;  4YBS A;  4QEV A;  4IR3 A;  5CQ5 A;  3MUK A;  3P5O A;  4YAB A;  4NRA A;  4KCX A;  5EWW A;  5FG5 A;  3NXB A;  2RS9 B;  3LQI A;  4TT4 A;  5I88 A;  5HFQ A;  4LZ2 A;  5D3R A;  3P1C A;  4YAT A;  5FE3 A;  5G4S A;  1E6I A;  4QSU A;  5EWH A;  2RNY A;  4PCI A;  5EQ1 A;  2RNW A;  5A82 A;  2F6J A;  4XUA A;  4YYH A;  5A5S A;  5AD3 A;  5BT4 A;  2I7K A;  3AAD A;  4TT6 A;  5DYA A;  2D82 A;  4QZS A;  4LYI A;  4MR6 A;  5FFV A;  4KV1 A;  4E96 A;  2OUO A;  3RCW A;  5EU1 A;  2R0V A;  4N4H A;  5CQ8 A;  5F60 A;  5HM0 A;  5CFW A;  2RI7 A;  3O33 A;  5A5R A;  5DY7 A;  2L84 A;  3D7C A;  4UIV A;  5LKX A;  3LXJ A;  5EV9 A;  5C89 A;  5LKZ A;  3U5P A;  4PTB A;  5DX4 A;  4CUQ A;  3UV2 A;  5HQ7 A;  4O70 A;  3U5L A;  5HCL A;  4O7E A;  5EIC A;  5ENE A;  4A9L A;  3P1D A;  5L98 A;  5I86 A;  4MEP A;  4O7F A;  4DON A;  4UIY A;  4YYD A;  3LJW A;  5E9M A;  5CPE A;  4NYX A;  2MJV B;  3MQM A;  5KTW A;  4PS5 A;  3P1F A;  2YEM A;  4UYD A;  5ETB A;  3HMF A;  5I83 A;  2RNX A;  4IOO A;  4QSV A;  5HQ5 A;  2DKW A;  5DKH A;  1N72 A;  4A9H A;  5E74 A;  3UVW A;  5CUG A;  4IR4 A;  5KTU A;  5LUU A;  4NUC A;  4Q0O A;  5D3S A;  3QZS A;  4YY4 A;  5DKD A;  2DWW A;  3TLP A;  3UV4 A;  5DFB A;  5ACY A;  4NR6 A;  2DVV A;  2F6N A;  2I8N A;  4TQN A;  4O74 A;  4NRC A;  5D3N A;  3MXF A;  4TYL A;  4YK0 A;  5FFY A;  5HRX A;  4PCE A;  3P1E A;  4YH3 A;  5FH6 A;  4HBW A;  4MR4 A;  2NXB A;  4QEU A;  2R0S A;  4TZ8 A;  4A9J A;  5C4Q A;  4TU6 A;  5F5Z A;  3JVK A;  5EPB A;  4FLP A;  2D9E A;  5CQT A;  3MB3 A;  3MB4 A;  4QUT A;  4HXM A;  4IR6 A;  3U5M A;  4AKN A;  5CQ6 A;  4LRG A;  4QSP A;  5F25 A;  5E0R A;  4XY9 A;  4IR5 A;  5EIS A;  4QSX A;  2YEL A;  4LYW A;  5IGN A;  5A5P A;  2DAT A;  3Q2F A;  4C67 A;  5CRM A;  3JVM A;  5E9L A;  4A9K A;  4O78 A;  5FE4 A;  2G4A A;  2L5E A;  3DWY A;  5ENH A;  4ZQL A;  5EWV A;  4A9I A;  5EM3 A;  5CUA A;  4MEN A;  3O35 A;  4YAD A;  5EGU A;  4OUF A;  4NUE A;  3LQH A;  5H1V A;  4CUP A;  5KHM A;  4XY8 A;  4A9M A;  4HXL A;  4LZS A;  4OGI A;  4QYD A;  5LJ1 A;  5I1Q A;  5KU3 A;  2WP2 A;  5COI A;  4NR8 A;  5DW2 A;  4Q0N A;  5LKU A;  4YBT A;  4NUD A;  3SVG A;  4MR3 A;  3IU5 A;  5E3G A;  5IG6 A;  4CUT A;  4XUB A;  3O34 A;  4QSS A;  5FE6 A;  5D24 A;  4YYJ A;  4A9N A;  5E73 A;  4TS8 A;  4O72 A;  4NXJ A;  5L99 A;  5L96 A;  3JVL A;  1X0J A;  5BT3 A;  4LDF A;  5FE9 A;  4HBY A;  3UW9 A;  5DLZ A;  5DBM A;  2WP1 A;  5FE8 A;  5E9V A;  4YYI A;  5ENJ A;  3ZYU A;  2E7O A;  4QC1 A;  4UYE A;  2OO1 A;  4ALH A;  4NR9 A;  5DYC A;  5FE2 A;  4N4F A;  4HBV A;  4GPJ A;  1JSP B;  4HXN A;  4A9F A;  4NYV A;  4PKL A;  5HRW A;  5I80 A;  3O36 A;  2YYN A;  5JWM A;  5D26 A;  2R0Y A;  5A5N A;  5IGM A;  2R10 A;  5CRZ A;  4NQN A;  5EPR A;  5HJC A;  5H85 A;  5HEL A;  4BHW A;  4O77 A;  3ONI A;  5I40 A;  4NR5 A;  2RFJ A;  5LJ0 A;  4QR5 A;  5CUD A;  4LC2 A;  4TT2 A;  5CUE A;  5E9K A;  3U5O A;  5LJ2 A;  3SVF A;  4J1P A;  4YBM A;  5FE7 A;  5HQ6 A;  5EK9 A;  5FBX A;  5HEM A;  5CUB A;  4YYM A;  2FSA A;  5D0C A;  5D7X A;  4TZ2 A;  4ALG A;  1WUG A;  5L97 A;  4YC9 A;  5ENB A;  3MUL A;  5H1T A;  4A9E A;  5TB6 A;  4CFK A;  3HMH A;  3IU6 A;  3LQJ A;  4OGJ A;  4HBX A;  3G0J A;  5I7Y A;  4Z1S A;  5J0D A;  5CZG A;  2YQD A;  4LR6 A;  4YYK A;  5TCM A;  5D3H A;  5LKT A;  4O76 A;  5ENC A;  5D3P A;  4J0S A;  5D3T A;  3Q2E A;  4O71 A;  4A9O A;  4Z1Q A;  5DW1 A;  4Y03 A;  5DKC A;  4ZC9 A;  5II1 A;  4MEQ A;  4QC3 A;  2YDW A;  5CQA A;  5F63 A;  5DYU A;  3G0L A;  4QBM A;  2DVS A;  4N4I A;  1ZS5 A;  4WHW A;  4NQM A;  5CGP A;  2OSS A;  3U5K A;  5FE0 A;  5HLS A;  5IID A;  4YH4 A;  4J3I A;  4HXR A;  5D3L A;  5EPS A;  2GRC A;  5EI4 A;  5L8U A;  4F3I A;  1WUM A;  5I29 A;  3QZV A;  5E9Y A;  4BW3 A;  4Z93 A;  4CUU A;  5FE1 A;  5LVR A;  2DVQ A;  1EQF A;  5CQ4 A;  5FH8 A;  5F2P A;  5FG6 A;  3U5J A;  5HRV A;  5E7D A;  5FDZ A;  5IBN A;  5FH7 A;  5CQ7 A;  3DAI A;  5CY9 A;  3S92 A;  5EP7 A;  4HXP A;  4UIX A;  5AME A;  5FB1 A;  5C87 A;  4BW4 A;  5D25 A;  5F3A A;  3AQA A;  4HXS A;  5FB0 A;  3U5N A;  4IOR A;  4YY6 A;  4UIZ A;  5F36 A;  5C8G A;  4LYS A;  4QY4 A;  5A83 A;  4IOQ A;  4UIW A;  4CFL A;  3S91 A;  4UIT A;  4O75 A;  4N4G A;  5HEN A;  3UV5 A;  2E7N A;  4XYA A;  4Z6H A;  4NR7 A;  3UVY A;  4BJX A;  5EWD A;  4UYF B;  4MEO A;  4QNS A;  5D3J A;  5HFR A;  5CQ3 A;  4MR5 A;  4NS5 A;  4PY6 A;  4KV4 A;  4WIV A;  4QSR A;  4ZW1 A;  4O7C A;  4LZR A;  5EVA A;  4NYW A;  5F1H A;  5DFC A;  5IGL A;  3FKM X;  5K29 A;  5E3D A;  3QZT A;  3I3J A;  5F61 A;  3GG3 A;  5ENG A;  5LVQ A;  4UYF A;  3JVJ A;  4BW2 A;  5CS8 A;  4J0R A;  5G4R A;  2H60 A;  4YYG A;  2DVR A;  5CUC A;  4TTE A;  5FE5 A;  3SVH A;  2KTB B;  4HXO A;  5CU8 A;  4O7B A;  4QYL A;  4CUS A;  5A85 A;  5EWC A;  4CUR A;  5II2 A;  5C7N A;  3HME A;  3K2J A;  5CP5 A;  4N3W A;  5ENI A;  5KO4 A;  4RVR A;  5A81 A;  5H1U A;  4QSW A;  4QST A;  2E3K A;  4UIU A;  5AMF A;  5I89 A;  4YYN A;  2YW5 A;  3UVX A;  2L85 A;  5L8T A;  5CTL A;  4BW1 A;  4O7A A;  2YEK A;  5DFD A;  5I7X A;  2N9G A;  4TU4 A;  4UYH A;  5C85 A;  5IGK A;  4YAX A;  3UVD A;  5JI8 A;  4UYG A;  5ETD A;  4Z6I A;  4CL9 A;  4QUU A;  2RO1 A;  4X2I A;  4C66 A;  4QR3 A;  4NR4 A;  5FFW A;  4QEW A;  4QR4 A;  4CLB A;  5F62 A;  5EA1 A;  4QB3 A;  5A5O A;  5KTX A;  4WHU A;  5AD2 A;  3O37 A; 
#chains in the Genus database with same CATH topology
 4HXK A;  5DYX A;  2LSP B;  5ENF A;  5BT5 A;  5F1L A;  5FG4 A;  5A7C A;  4QSQ A;  5DLX A;  5E9I A;  5A5Q A;  4NRB A;  1JM4 B;  1F68 A;  4YBS A;  4QEV A;  4IR3 A;  5CQ5 A;  3MUK A;  3P5O A;  4YAB A;  4NRA A;  4KCX A;  5EWW A;  5FG5 A;  3NXB A;  2RS9 B;  3LQI A;  4TT4 A;  5I88 A;  5HFQ A;  4LZ2 A;  5D3R A;  3P1C A;  4YAT A;  5FE3 A;  5G4S A;  1E6I A;  4QSU A;  5EWH A;  2RNY A;  4PCI A;  5EQ1 A;  2RNW A;  5A82 A;  2F6J A;  4XUA A;  4YYH A;  5A5S A;  5AD3 A;  5BT4 A;  2I7K A;  3AAD A;  4TT6 A;  5DYA A;  2D82 A;  4QZS A;  4LYI A;  4MR6 A;  5FFV A;  4KV1 A;  4E96 A;  2OUO A;  3RCW A;  5EU1 A;  2R0V A;  4N4H A;  5CQ8 A;  5F60 A;  5HM0 A;  5CFW A;  2RI7 A;  3O33 A;  5A5R A;  5DY7 A;  2L84 A;  3D7C A;  4UIV A;  5LKX A;  3LXJ A;  5EV9 A;  5C89 A;  5LKZ A;  3U5P A;  4PTB A;  5DX4 A;  4CUQ A;  3UV2 A;  5HQ7 A;  4O70 A;  3U5L A;  5HCL A;  4O7E A;  5EIC A;  5ENE A;  4A9L A;  3P1D A;  1ZKR A;  5L98 A;  3ERR A;  5I86 A;  4MEP A;  4O7F A;  4DON A;  4UIY A;  4YYD A;  3LJW A;  5E9M A;  5CPE A;  4NYX A;  2MJV B;  3MQM A;  4AKG A;  5KTW A;  4PS5 A;  3P1F A;  2YEM A;  4UYD A;  5ETB A;  3HMF A;  5I83 A;  2RNX A;  4IOO A;  4QSV A;  3VKG A;  5HQ5 A;  2DKW A;  5DKH A;  1N72 A;  4A9H A;  5E74 A;  3UVW A;  5CUG A;  4IR4 A;  5KTU A;  5LUU A;  4NUC A;  4Q0O A;  5D3S A;  3QZS A;  4YY4 A;  5DKD A;  2DWW A;  3TLP A;  3UV4 A;  5DFB A;  5ACY A;  4NR6 A;  2DVV A;  2F6N A;  2I8N A;  4TQN A;  4O74 A;  4NRC A;  5D3N A;  3MXF A;  4TYL A;  4YK0 A;  5FFY A;  5HRX A;  4PCE A;  3P1E A;  4YH3 A;  5FH6 A;  4HBW A;  4MR4 A;  2NXB A;  4QEU A;  2R0S A;  4TZ8 A;  4A9J A;  5C4Q A;  4TU6 A;  5F5Z A;  3JVK A;  5EPB A;  4FLP A;  2D9E A;  5CQT A;  3MB3 A;  3MB4 A;  4QUT A;  4HXM A;  4IR6 A;  3U5M A;  4AKN A;  5CQ6 A;  4LRG A;  4QSP A;  5F25 A;  5E0R A;  4XY9 A;  4IR5 A;  5EIS A;  4QSX A;  2YEL A;  4LYW A;  5IGN A;  5A5P A;  4AKH A;  2DAT A;  3Q2F A;  4C67 A;  5CRM A;  3JVM A;  5E9L A;  4A9K A;  4O78 A;  5FE4 A;  2G4A A;  2L5E A;  3DWY A;  5ENH A;  4ZQL A;  5EWV A;  4A9I A;  5EM3 A;  5CUA A;  4MEN A;  3O35 A;  4YAD A;  5EGU A;  4OUF A;  4NUE A;  3LQH A;  5H1V A;  4CUP A;  5KHM A;  4XY8 A;  4A9M A;  4HXL A;  4LZS A;  4OGI A;  4QYD A;  5LJ1 A;  5I1Q A;  5KU3 A;  2WP2 A;  5COI A;  4NR8 A;  5DW2 A;  3D1D A;  4Q0N A;  5LKU A;  4YBT A;  4NUD A;  3SVG A;  4MR3 A;  3IU5 A;  5E3G A;  5IG6 A;  4CUT A;  4XUB A;  3O34 A;  4QSS A;  5FE6 A;  5D24 A;  4YYJ A;  4A9N A;  5E73 A;  4TS8 A;  4O72 A;  4NXJ A;  5L99 A;  5L96 A;  3JVL A;  1X0J A;  5BT3 A;  4LDF A;  5FE9 A;  4HBY A;  3UW9 A;  5DLZ A;  5DBM A;  2WP1 A;  5FE8 A;  5E9V A;  4YYI A;  5ENJ A;  3ZYU A;  2E7O A;  4QC1 A;  4UYE A;  2OO1 A;  4ALH A;  4NR9 A;  5DYC A;  5FE2 A;  4N4F A;  4HBV A;  4GPJ A;  1JSP B;  4HXN A;  4A9F A;  4NYV A;  4PKL A;  5HRW A;  5I80 A;  3O36 A;  2YYN A;  5JWM A;  5D26 A;  2R0Y A;  5A5N A;  5IGM A;  2R10 A;  5CRZ A;  4NQN A;  5EPR A;  5HJC A;  5H85 A;  2EJN A;  5HEL A;  4BHW A;  4O77 A;  3ONI A;  5I40 A;  4NR5 A;  2RFJ A;  5LJ0 A;  4QR5 A;  5CUD A;  4LC2 A;  4TT2 A;  5CUE A;  5E9K A;  3U5O A;  5LJ2 A;  3SVF A;  4J1P A;  4YBM A;  5FE7 A;  5HQ6 A;  5EK9 A;  5FBX A;  5HEM A;  5CUB A;  4YYM A;  2FSA A;  5D0C A;  5D7X A;  4TZ2 A;  4ALG A;  1WUG A;  5L97 A;  4YC9 A;  5ENB A;  3MUL A;  5H1T A;  4A9E A;  5TB6 A;  4CFK A;  3HMH A;  3IU6 A;  3LQJ A;  4OGJ A;  4HBX A;  3G0J A;  5I7Y A;  4Z1S A;  5J0D A;  5CZG A;  2YQD A;  4LR6 A;  4YYK A;  5TCM A;  5D3H A;  5LKT A;  4O76 A;  5ENC A;  5D3P A;  4J0S A;  5D3T A;  3Q2E A;  4O71 A;  4A9O A;  4Z1Q A;  5DW1 A;  4Y03 A;  5DKC A;  4ZC9 A;  5II1 A;  4MEQ A;  4QC3 A;  2YDW A;  5CQA A;  5F63 A;  1PUO A;  5DYU A;  3G0L A;  4QBM A;  2DVS A;  4N4I A;  1ZS5 A;  4WHW A;  4NQM A;  5CGP A;  2OSS A;  3U5K A;  5FE0 A;  5HLS A;  5IID A;  4YH4 A;  4J3I A;  4HXR A;  5D3L A;  5EPS A;  2GRC A;  5EI4 A;  5L8U A;  4F3I A;  1WUM A;  5I29 A;  3QZV A;  5E9Y A;  4BW3 A;  4Z93 A;  4CUU A;  5FE1 A;  5LVR A;  2DVQ A;  1EQF A;  5CQ4 A;  5FH8 A;  5F2P A;  5FG6 A;  3VKH A;  3U5J A;  5HRV A;  5E7D A;  5FDZ A;  5IBN A;  5FH7 A;  5CQ7 A;  3DAI A;  5CY9 A;  3S92 A;  5EP7 A;  4HXP A;  4UIX A;  5AME A;  5FB1 A;  5C87 A;  4BW4 A;  4AI6 A;  3D1B A;  5D25 A;  5F3A A;  3AQA A;  4HXS A;  5FB0 A;  3U5N A;  4IOR A;  4YY6 A;  4UIZ A;  5F36 A;  5C8G A;  4AKI A;  4LYS A;  4QY4 A;  5A83 A;  4IOQ A;  4UIW A;  4CFL A;  3S91 A;  4UIT A;  4O75 A;  4N4G A;  5HEN A;  3UV5 A;  2E7N A;  4XYA A;  4Z6H A;  4NR7 A;  3UVY A;  4BJX A;  5EWD A;  4UYF B;  4MEO A;  4QNS A;  5D3J A;  5HFR A;  5CQ3 A;  4MR5 A;  4NS5 A;  4PY6 A;  4KV4 A;  4WIV A;  4QSR A;  4ZW1 A;  4O7C A;  4LZR A;  5EVA A;  4NYW A;  5F1H A;  5DFC A;  5IGL A;  3FKM X;  5K29 A;  5E3D A;  3QZT A;  3I3J A;  5F61 A;  3GG3 A;  5ENG A;  5LVQ A;  4UYF A;  3JVJ A;  4BW2 A;  5CS8 A;  4J0R A;  5G4R A;  2H60 A;  4YYG A;  2DVR A;  5CUC A;  4TTE A;  5FE5 A;  3SVH A;  2KTB B;  4HXO A;  5CU8 A;  4O7B A;  4QYL A;  4CUS A;  5A85 A;  5EWC A;  4CUR A;  5II2 A;  5C7N A;  3HME A;  3K2J A;  5CP5 A;  4N3W A;  5ENI A;  5KO4 A;  4RVR A;  5A81 A;  5H1U A;  4QSW A;  4QST A;  2E3K A;  4UIU A;  5AMF A;  5I89 A;  4YYN A;  2YW5 A;  3UVX A;  2L85 A;  5L8T A;  5CTL A;  4BW1 A;  4O7A A;  2YEK A;  5DFD A;  5I7X A;  2N9G A;  4TU4 A;  4UYH A;  5C85 A;  5IGK A;  4YAX A;  3UVD A;  5JI8 A;  4UYG A;  5ETD A;  4Z6I A;  4CL9 A;  4QUU A;  2RO1 A;  4X2I A;  4C66 A;  4QR3 A;  4NR4 A;  5FFW A;  4QEW A;  4QR4 A;  4CLB A;  5F62 A;  5EA1 A;  4QB3 A;  5A5O A;  5KTX A;  4WHU A;  5AD2 A;  3O37 A; 
#chains in the Genus database with same CATH homology
 4HXK A;  5DYX A;  2LSP B;  5ENF A;  5BT5 A;  5F1L A;  5FG4 A;  5A7C A;  4QSQ A;  5DLX A;  5E9I A;  5A5Q A;  4NRB A;  1JM4 B;  1F68 A;  4YBS A;  4QEV A;  4IR3 A;  5CQ5 A;  3MUK A;  3P5O A;  4YAB A;  4NRA A;  4KCX A;  5EWW A;  5FG5 A;  3NXB A;  2RS9 B;  3LQI A;  4TT4 A;  5I88 A;  5HFQ A;  4LZ2 A;  5D3R A;  3P1C A;  4YAT A;  5FE3 A;  5G4S A;  1E6I A;  4QSU A;  5EWH A;  2RNY A;  4PCI A;  5EQ1 A;  2RNW A;  5A82 A;  2F6J A;  4XUA A;  4YYH A;  5A5S A;  5AD3 A;  5BT4 A;  2I7K A;  3AAD A;  4TT6 A;  5DYA A;  2D82 A;  4QZS A;  4LYI A;  4MR6 A;  5FFV A;  4KV1 A;  4E96 A;  2OUO A;  3RCW A;  5EU1 A;  2R0V A;  4N4H A;  5CQ8 A;  5F60 A;  5HM0 A;  5CFW A;  2RI7 A;  3O33 A;  5A5R A;  5DY7 A;  2L84 A;  3D7C A;  4UIV A;  5LKX A;  3LXJ A;  5EV9 A;  5C89 A;  5LKZ A;  3U5P A;  4PTB A;  5DX4 A;  4CUQ A;  3UV2 A;  5HQ7 A;  4O70 A;  3U5L A;  5HCL A;  4O7E A;  5EIC A;  5ENE A;  4A9L A;  3P1D A;  5L98 A;  5I86 A;  4MEP A;  4O7F A;  4DON A;  4UIY A;  4YYD A;  3LJW A;  5E9M A;  5CPE A;  4NYX A;  2MJV B;  3MQM A;  5KTW A;  4PS5 A;  3P1F A;  2YEM A;  4UYD A;  5ETB A;  3HMF A;  5I83 A;  2RNX A;  4IOO A;  4QSV A;  5HQ5 A;  2DKW A;  5DKH A;  1N72 A;  4A9H A;  5E74 A;  3UVW A;  5CUG A;  4IR4 A;  5KTU A;  5LUU A;  4NUC A;  4Q0O A;  5D3S A;  3QZS A;  4YY4 A;  5DKD A;  2DWW A;  3TLP A;  3UV4 A;  5DFB A;  5ACY A;  4NR6 A;  2DVV A;  2F6N A;  2I8N A;  4TQN A;  4O74 A;  4NRC A;  5D3N A;  3MXF A;  4TYL A;  4YK0 A;  5FFY A;  5HRX A;  4PCE A;  3P1E A;  4YH3 A;  5FH6 A;  4HBW A;  4MR4 A;  2NXB A;  4QEU A;  2R0S A;  4TZ8 A;  4A9J A;  5C4Q A;  4TU6 A;  5F5Z A;  3JVK A;  5EPB A;  4FLP A;  2D9E A;  5CQT A;  3MB3 A;  3MB4 A;  4QUT A;  4HXM A;  4IR6 A;  3U5M A;  4AKN A;  5CQ6 A;  4LRG A;  4QSP A;  5F25 A;  5E0R A;  4XY9 A;  4IR5 A;  5EIS A;  4QSX A;  2YEL A;  4LYW A;  5IGN A;  5A5P A;  2DAT A;  3Q2F A;  4C67 A;  5CRM A;  3JVM A;  5E9L A;  4A9K A;  4O78 A;  5FE4 A;  2G4A A;  2L5E A;  3DWY A;  5ENH A;  4ZQL A;  5EWV A;  4A9I A;  5EM3 A;  5CUA A;  4MEN A;  3O35 A;  4YAD A;  5EGU A;  4OUF A;  4NUE A;  3LQH A;  5H1V A;  4CUP A;  5KHM A;  4XY8 A;  4A9M A;  4HXL A;  4LZS A;  4OGI A;  4QYD A;  5LJ1 A;  5I1Q A;  5KU3 A;  2WP2 A;  5COI A;  4NR8 A;  5DW2 A;  4Q0N A;  5LKU A;  4YBT A;  4NUD A;  3SVG A;  4MR3 A;  3IU5 A;  5E3G A;  5IG6 A;  4CUT A;  4XUB A;  3O34 A;  4QSS A;  5FE6 A;  5D24 A;  4YYJ A;  4A9N A;  5E73 A;  4TS8 A;  4O72 A;  4NXJ A;  5L99 A;  5L96 A;  3JVL A;  1X0J A;  5BT3 A;  4LDF A;  5FE9 A;  4HBY A;  3UW9 A;  5DLZ A;  5DBM A;  2WP1 A;  5FE8 A;  5E9V A;  4YYI A;  5ENJ A;  3ZYU A;  2E7O A;  4QC1 A;  4UYE A;  2OO1 A;  4ALH A;  4NR9 A;  5DYC A;  5FE2 A;  4N4F A;  4HBV A;  4GPJ A;  1JSP B;  4HXN A;  4A9F A;  4NYV A;  4PKL A;  5HRW A;  5I80 A;  3O36 A;  2YYN A;  5JWM A;  5D26 A;  2R0Y A;  5A5N A;  5IGM A;  2R10 A;  5CRZ A;  4NQN A;  5EPR A;  5HJC A;  5H85 A;  5HEL A;  4BHW A;  4O77 A;  3ONI A;  5I40 A;  4NR5 A;  2RFJ A;  5LJ0 A;  4QR5 A;  5CUD A;  4LC2 A;  4TT2 A;  5CUE A;  5E9K A;  3U5O A;  5LJ2 A;  3SVF A;  4J1P A;  4YBM A;  5FE7 A;  5HQ6 A;  5EK9 A;  5FBX A;  5HEM A;  5CUB A;  4YYM A;  2FSA A;  5D0C A;  5D7X A;  4TZ2 A;  4ALG A;  1WUG A;  5L97 A;  4YC9 A;  5ENB A;  3MUL A;  5H1T A;  4A9E A;  5TB6 A;  4CFK A;  3HMH A;  3IU6 A;  3LQJ A;  4OGJ A;  4HBX A;  3G0J A;  5I7Y A;  4Z1S A;  5J0D A;  5CZG A;  2YQD A;  4LR6 A;  4YYK A;  5TCM A;  5D3H A;  5LKT A;  4O76 A;  5ENC A;  5D3P A;  4J0S A;  5D3T A;  3Q2E A;  4O71 A;  4A9O A;  4Z1Q A;  5DW1 A;  4Y03 A;  5DKC A;  4ZC9 A;  5II1 A;  4MEQ A;  4QC3 A;  2YDW A;  5CQA A;  5F63 A;  5DYU A;  3G0L A;  4QBM A;  2DVS A;  4N4I A;  1ZS5 A;  4WHW A;  4NQM A;  5CGP A;  2OSS A;  3U5K A;  5FE0 A;  5HLS A;  5IID A;  4YH4 A;  4J3I A;  4HXR A;  5D3L A;  5EPS A;  2GRC A;  5EI4 A;  5L8U A;  4F3I A;  1WUM A;  5I29 A;  3QZV A;  5E9Y A;  4BW3 A;  4Z93 A;  4CUU A;  5FE1 A;  5LVR A;  2DVQ A;  1EQF A;  5CQ4 A;  5FH8 A;  5F2P A;  5FG6 A;  3U5J A;  5HRV A;  5E7D A;  5FDZ A;  5IBN A;  5FH7 A;  5CQ7 A;  3DAI A;  5CY9 A;  3S92 A;  5EP7 A;  4HXP A;  4UIX A;  5AME A;  5FB1 A;  5C87 A;  4BW4 A;  5D25 A;  5F3A A;  3AQA A;  4HXS A;  5FB0 A;  3U5N A;  4IOR A;  4YY6 A;  4UIZ A;  5F36 A;  5C8G A;  4LYS A;  4QY4 A;  5A83 A;  4IOQ A;  4UIW A;  4CFL A;  3S91 A;  4UIT A;  4O75 A;  4N4G A;  5HEN A;  3UV5 A;  2E7N A;  4XYA A;  4Z6H A;  4NR7 A;  3UVY A;  4BJX A;  5EWD A;  4UYF B;  4MEO A;  4QNS A;  5D3J A;  5HFR A;  5CQ3 A;  4MR5 A;  4NS5 A;  4PY6 A;  4KV4 A;  4WIV A;  4QSR A;  4ZW1 A;  4O7C A;  4LZR A;  5EVA A;  4NYW A;  5F1H A;  5DFC A;  5IGL A;  3FKM X;  5K29 A;  5E3D A;  3QZT A;  3I3J A;  5F61 A;  3GG3 A;  5ENG A;  5LVQ A;  4UYF A;  3JVJ A;  4BW2 A;  5CS8 A;  4J0R A;  5G4R A;  2H60 A;  4YYG A;  2DVR A;  5CUC A;  4TTE A;  5FE5 A;  3SVH A;  2KTB B;  4HXO A;  5CU8 A;  4O7B A;  4QYL A;  4CUS A;  5A85 A;  5EWC A;  4CUR A;  5II2 A;  5C7N A;  3HME A;  3K2J A;  5CP5 A;  4N3W A;  5ENI A;  5KO4 A;  4RVR A;  5A81 A;  5H1U A;  4QSW A;  4QST A;  2E3K A;  4UIU A;  5AMF A;  5I89 A;  4YYN A;  2YW5 A;  3UVX A;  2L85 A;  5L8T A;  5CTL A;  4BW1 A;  4O7A A;  2YEK A;  5DFD A;  5I7X A;  2N9G A;  4TU4 A;  4UYH A;  5C85 A;  5IGK A;  4YAX A;  3UVD A;  5JI8 A;  4UYG A;  5ETD A;  4Z6I A;  4CL9 A;  4QUU A;  2RO1 A;  4X2I A;  4C66 A;  4QR3 A;  4NR4 A;  5FFW A;  4QEW A;  4QR4 A;  4CLB A;  5F62 A;  5EA1 A;  4QB3 A;  5A5O A;  5KTX A;  4WHU A;  5AD2 A;  3O37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...