3UV2A

Crystal structure of the bromodomain of human nucleosome-remodeling factor subunit bptf
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
119
structure length
119
Chain Sequence
EDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKASRSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords bromodomain of human nucleosome-remodeling factor subunit BP
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3uv2A00
4O7BA 3SVFA 5EV9A 4TZ8A 5ENEA 4A9FA 1F68A 4XY8A 4QSRA 5F25A 5ACYA 5DYCA 4WIVA 2OO1A 5II2A 5E74A 2RNYA 4XYAA 5D3PA 4KCXA 3G0JA 3AADA 5ETDA 4LDFA 5DKHA 4NUCA 4YATA 5A85A 5HELA 5DLXA 5I7YA 3QZVA 4Z1QA 5I29A 3P1EA 4YBSA 2R0YA 4CUPA 5IGNA 4YYJA 4IOOA 5F2PA 4UYEA 4YC9A 2N9GA 4NR4A 5C7NA 5EM3A 4QSVA 2E7OA 4ZW1A 5D3TA 4UIYA 4NRCA 5KU3A 4HXMA 3QZSA 5L8TA 3MQMA 3MB3A 4GPJA 5J0DA 2D9EA 3S92A 4Z6HA 5KTUA 4IR5A 5E9YA 5FFYA 5E3DA 5LJ2A 4A9OA 3TLPA 4HXRA 2I8NA 4NR5A 4ZC9A 5HENA 5ENFA 3HMHA 5BT5A 2RS9B 5HFRA 4Y03A 4TT4A 4BHWA 4Z1SA 2I7KA 4Z6IA 2L84A 5FFWA 3GG3A 5DKDA 1N72A 3U5MA 4Z93A 5CTLA 4J3IA 5CUBA 5JWMA 5DFBA 4HXOA 4MENA 5LKTA 4NS5A 3IU6A 4IOQA 2DVVA 4C66A 2WP2A 4UYGA 4QYLA 2L85A 5A83A 5EGUA 5AMEA 5F62A 4NUDA 5CP5A 4Q0OA 5DY7A 5HJCA 5ENCA 4QEWA 3I3JA 4LR6A 4QSWA 5CQ5A 5CRMA 5L97A 2D82A 4A9JA 5BT3A 2E7NA 4O76A 5HRXA 5EPRA 1WUMA 4HBXA 2YYNA 5FG4A 4PCIA 4YBMA 4QR3A 5LVQA 3UVYA 4XUBA 3MUKA 5I1QA 4E96A 5LUUA 4QSTA 2OSSA 5DYXA 4RVRA 5IBNA 4TT6A 5E0RA 4LYIA 4NXJA 1JM4B 2RFJA 4QSXA 5D3JA 4QNSA 5EWVA 5CQ4A 5EPSA 4NQNA 5E9LA 3AQAA 5E73A 3JVLA 5FBXA 5HFQA 4NQMA 4TYLA 5F60A 5IG6A 4PTBA 5EI4A 3SVHA 4KV1A 4QUTA 5C4QA 4NYWA 5D26A 5DKCA 3MB4A 4LZRA 4YK0A 5EP7A 4O7FA 4CFKA 4NR8A 2KTBB 2L5EA 4O75A 5CU8A 5FFVA 4C67A 4NR9A 3P1DA 5D3NA 3P1FA 4QZSA 5TCMA 4NR6A 3FKMX 4IORA 4IR6A 4LRGA 4UIXA 4UYDA 5TB6A 4O74A 5FB0A 2RNWA 4CUSA 5II1A 4UYHA 4QC1A 4LZ2A 4PS5A 3O37A 5EPBA 2YEKA 5ENIA 4TZ2A 4NR7A 4YABA 4QYDA 5L99A 5CQ8A 4MEOA 5F3AA 4X2IA 3UV5A 5FE4A 4OGIA 4QUUA 3UVDA 3SVGA 4CL9A 5FE2A 5HEMA 3ZYUA 4N4GA 3D7CA 4A9IA 4HXNA 4O78A 5C8GA 4A9LA 5F61A 3LJWA 3U5PA 5DW2A 4YBTA 4YH4A 5FH7A 2DVQA 4LYWA 5F63A 5FE3A 4A9NA 4ZQLA 4QEUA 5A5RA 5IIDA 4YYDA 4QR4A 4OGJA 4HXLA 4TU4A 5E9IA 5L8UA 5DW1A 4WHWA 5DYUA 5KHMA 5F1LA 4MR5A 5A81A 2YEMA 3UV2A 5EVAA 4WHUA 2F6NA 3UVXA 4CFLA 4N4FA 4PKLA 5CUCA 4UIZA 5ENGA 5CQ7A 4QSSA 5A7CA 3P5OA 2YDWA 5EQ1A 5H1VA 5COIA 5CUEA 5ENHA 5EWHA 5A5NA 2DKWA 4NRAA 4CUTA 4N4IA 4YYNA 3K2JA 4J0SA 2YELA 5HQ7A 5D25A 2G4AA 4UIVA 1ZS5A 3O34A 3LXJA 4PCEA 4BW4A 5EK9A 5HQ6A 4CUQA 2F6JA 5I40A 2DWWA 4KV4A 4QR5A 3O35A 4HXSA 2YW5A 3UVWA 4YAXA 4MEPA 4CURA 5CS8A 5IGLA 5CUAA 4QB3A 2DVSA 5E9VA 5EA1A 4A9EA 5ETBA 3ONIA 4LZSA 5I88A 5F36A 3HMEA 5DX4A 2DATA 5ENBA 3MULA 5E7DA 5BT4A 5I86A 4YYMA 5I7XA 5EISA 5LKZA 5C85A 5C87A 4NYVA 4YYGA 5DLZA 2RNXA 4CUUA 4A9HA 1EQFA 5CGPA 5LKXA 4OUFA 4LYSA 4A9KA 5LKUA 5LJ0A 5D7XA 5EWWA 4QSPA 3U5KA 4O7EA 4MR3A 5HM0A 2FSAA 4TU6A 5KTWA 3Q2FA 4YADA 3QZTA 4FLPA 3LQHA 3U5LA 4O7AA 4HBVA 5LVRA 3O33A 5FDZA 2H60A 2NXBA 2LSPB 5CFWA 4CLBA 4ALGA 5CQ3A 5FE9A 4O7CA 5HLSA 5ENJA 5DFDA 3NXBA 4MR4A 2WP1A 5G4SA 5L96A 4YY6A 3LQJA 5CZGA 5CUGA 2YQDA 5D3HA 5HRVA 4IR4A 5G4RA 4TS8A 5CY9A 4J1PA 5LJ1A 4MEQA 4NUEA 4AKNA 3U5JA 5IGKA 4UYFA 4QEVA 5H1TA 3U5NA 5H85A 3JVJA 5K29A 2OUOA 5CQTA 5AMFA 5F1HA 5FG5A 5I80A 2R10A 4BW1A 4QSUA 3HMFA 3S91A 3UW9A 3IU5A 3U5OA 5AD3A 4DONA 3Q2EA 5HCLA 4QSQA 2E3KA 5EWCA 2RO1A 5A5QA 4UYFB 5E3GA 4HXKA 4PY6A 3DAIA 5FE8A 5CUDA 5KO4A 5EICA 5CRZA 4YYKA 5AD2A 5HQ5A 5D0CA 4MR6A 5EU1A 5DBMA 5D24A 4BW3A 4TT2A 4ALHA 3RCWA 5F5ZA 4HBWA 4LC2A 5FG6A 3O36A 5IGMA 4BW2A 5D3SA 4F3IA 5FE0A 4UIUA 5C89A 4YY4A 5DFCA 5E9KA 4NYXA 5I83A 1E6IA 2R0VA 3G0LA 5A5OA 4J0RA 4IR3A 5CPEA 5DYAA 5FB1A 5FE5A 5CQ6A 5A5PA 5FH6A 5H1UA 5D3RA 5HRWA 4HXPA 4UIWA 5D3LA 4QC3A 1JSPB 5A5SA 4TQNA 4XUAA 5CQAA 4BJXA 4O71A 1X0JA 4QY4A 4O70A 4HBYA 4N3WA 4QBMA 4YYHA 2R0SA 3MXFA 4YH3A 5FH8A 4TTEA 4YYIA 5E9MA 3P1CA 5JI8A 3JVKA 4Q0NA 4A9MA 4UITA 4O77A 5FE6A 2GRCA 2MJVB 2DVRA 5FE7A 5EWDA 3DWYA 2RI7A 4NRBA 3JVMA 5I89A 5FE1A 3LQIA 4O72A 5L98A 4N4HA 5A82A 3UV4A 1WUGA 4XY9A 5KTXA
chains in the Genus database with same CATH superfamily
4O7BA 3SVFA 5EV9A 4TZ8A 5ENEA 4A9FA 1F68A 4XY8A 4QSRA 5F25A 5ACYA 5DYCA 4WIVA 2OO1A 5II2A 5E74A 2RNYA 4XYAA 5D3PA 4KCXA 3G0JA 3AADA 5ETDA 4LDFA 5DKHA 4NUCA 4YATA 5A85A 5HELA 5DLXA 5I7YA 3QZVA 4Z1QA 5I29A 3P1EA 4YBSA 2R0YA 4CUPA 5IGNA 4YYJA 4IOOA 5F2PA 4UYEA 4YC9A 2N9GA 4NR4A 5C7NA 5EM3A 4QSVA 2E7OA 4ZW1A 5D3TA 4UIYA 4NRCA 5KU3A 4HXMA 3QZSA 5L8TA 3MQMA 3MB3A 4GPJA 5J0DA 2D9EA 3S92A 4Z6HA 5KTUA 4IR5A 5E9YA 5FFYA 5E3DA 5LJ2A 4A9OA 3TLPA 4HXRA 2I8NA 4NR5A 4ZC9A 5HENA 5ENFA 3HMHA 5BT5A 2RS9B 5HFRA 4Y03A 4TT4A 4BHWA 4Z1SA 2I7KA 4Z6IA 2L84A 5FFWA 3GG3A 5DKDA 1N72A 3U5MA 4Z93A 5CTLA 4J3IA 5CUBA 5JWMA 5DFBA 4HXOA 4MENA 5LKTA 4NS5A 3IU6A 4IOQA 2DVVA 4C66A 2WP2A 4UYGA 4QYLA 2L85A 5A83A 5EGUA 5AMEA 5F62A 4NUDA 5CP5A 4Q0OA 3ERRA 5DY7A 5HJCA 5ENCA 4QEWA 3D1BA 3I3JA 4LR6A 4QSWA 5CRMA 5CQ5A 5L97A 2D82A 4A9JA 5BT3A 2E7NA 4O76A 5HRXA 5EPRA 1WUMA 4HBXA 2YYNA 5FG4A 4PCIA 4YBMA 4QR3A 5LVQA 3UVYA 4XUBA 3MUKA 5I1QA 4E96A 5LUUA 4QSTA 2OSSA 5DYXA 4RVRA 5IBNA 4TT6A 5E0RA 4LYIA 4NXJA 1JM4B 2RFJA 4QSXA 5D3JA 4QNSA 5EWVA 5CQ4A 5EPSA 4NQNA 5E9LA 3AQAA 5E73A 3JVLA 5FBXA 5HFQA 4NQMA 4TYLA 5F60A 5IG6A 4PTBA 5EI4A 3SVHA 4KV1A 4QUTA 5C4QA 4NYWA 5D26A 5DKCA 3MB4A 4LZRA 4YK0A 5EP7A 4O7FA 4CFKA 4NR8A 2EJNA 2KTBB 2L5EA 4O75A 5CU8A 5FFVA 4C67A 4NR9A 3P1DA 5D3NA 3P1FA 4QZSA 5TCMA 4NR6A 3FKMX 4IORA 4IR6A 4LRGA 4UIXA 4UYDA 5TB6A 4O74A 5FB0A 2RNWA 4CUSA 5II1A 4UYHA 4QC1A 4LZ2A 4PS5A 3O37A 5EPBA 2YEKA 5ENIA 4TZ2A 4NR7A 4YABA 4QYDA 5L99A 5CQ8A 4MEOA 5F3AA 4X2IA 3UV5A 5FE4A 4OGIA 4QUUA 3UVDA 3SVGA 4CL9A 5FE2A 5HEMA 3ZYUA 4N4GA 3D7CA 4A9IA 4HXNA 4O78A 5C8GA 4A9LA 5F61A 3LJWA 3U5PA 5DW2A 4YBTA 4YH4A 5FH7A 4AKIA 3VKHA 2DVQA 4LYWA 5F63A 5FE3A 4A9NA 4ZQLA 4QEUA 5A5RA 4AKHA 5IIDA 4YYDA 3VKGA 4QR4A 4OGJA 4HXLA 4TU4A 5E9IA 5L8UA 5DW1A 4WHWA 5DYUA 5KHMA 5F1LA 4MR5A 5A81A 2YEMA 3UV2A 5EVAA 4WHUA 2F6NA 3UVXA 4CFLA 4N4FA 4PKLA 5CUCA 4UIZA 5ENGA 5CQ7A 4QSSA 5A7CA 3P5OA 2YDWA 1ZKRA 5EQ1A 5H1VA 5COIA 5CUEA 4AKGA 5ENHA 5EWHA 5A5NA 2DKWA 4NRAA 4CUTA 4N4IA 4YYNA 3K2JA 4J0SA 2YELA 5HQ7A 5D25A 2G4AA 4UIVA 1ZS5A 3O34A 3LXJA 4PCEA 4BW4A 5EK9A 5HQ6A 4CUQA 2F6JA 5I40A 2DWWA 4KV4A 4QR5A 3O35A 4HXSA 2YW5A 3UVWA 4YAXA 4MEPA 4CURA 5CS8A 5IGLA 5CUAA 4QB3A 1PUOA 2DVSA 5E9VA 5EA1A 4A9EA 5ETBA 3ONIA 4LZSA 5I88A 5F36A 3HMEA 5DX4A 2DATA 5ENBA 3MULA 5E7DA 5BT4A 5I86A 4YYMA 5I7XA 5EISA 5LKZA 5C85A 5C87A 4NYVA 4YYGA 5DLZA 2RNXA 4CUUA 4A9HA 1EQFA 5CGPA 5LKXA 4OUFA 4LYSA 4A9KA 5LKUA 5LJ0A 5D7XA 5EWWA 4QSPA 3U5KA 4O7EA 4MR3A 5HM0A 2FSAA 4TU6A 5KTWA 3Q2FA 4YADA 3QZTA 4FLPA 3LQHA 3U5LA 4O7AA 4HBVA 5LVRA 3O33A 5FDZA 2H60A 2NXBA 2LSPB 5CFWA 4CLBA 4ALGA 5CQ3A 5FE9A 4O7CA 5HLSA 5ENJA 5DFDA 3NXBA 4MR4A 4AI6A 2WP1A 5G4SA 5L96A 4YY6A 3LQJA 5CZGA 5CUGA 2YQDA 5D3HA 5HRVA 4IR4A 5G4RA 4TS8A 5CY9A 4J1PA 5LJ1A 4MEQA 4NUEA 4AKNA 3U5JA 5IGKA 4UYFA 4QEVA 5H1TA 3U5NA 5H85A 3JVJA 5K29A 2OUOA 5CQTA 5AMFA 5F1HA 5FG5A 5I80A 2R10A 4BW1A 4QSUA 3HMFA 3S91A 3UW9A 3IU5A 3U5OA 5AD3A 4DONA 3Q2EA 5HCLA 4QSQA 2E3KA 5EWCA 2RO1A 5A5QA 4UYFB 5E3GA 4HXKA 4PY6A 3DAIA 5FE8A 5CUDA 5KO4A 5EICA 5CRZA 4YYKA 5AD2A 5HQ5A 5D0CA 4MR6A 5EU1A 5DBMA 5D24A 4BW3A 4TT2A 4ALHA 3RCWA 5F5ZA 4HBWA 4LC2A 5FG6A 3O36A 5IGMA 4BW2A 5D3SA 4F3IA 5FE0A 4UIUA 5C89A 4YY4A 5DFCA 5E9KA 4NYXA 5I83A 1E6IA 2R0VA 3G0LA 5A5OA 4J0RA 4IR3A 5CPEA 5DYAA 5FB1A 5FE5A 5CQ6A 5A5PA 5FH6A 5H1UA 5D3RA 5HRWA 4HXPA 4UIWA 5D3LA 4QC3A 1JSPB 5A5SA 4TQNA 4XUAA 5CQAA 4BJXA 4O71A 1X0JA 4QY4A 4O70A 4HBYA 4N3WA 4QBMA 4YYHA 2R0SA 3MXFA 4YH3A 5FH8A 4TTEA 4YYIA 5E9MA 3P1CA 5JI8A 3JVKA 4Q0NA 4A9MA 4UITA 4O77A 5FE6A 2GRCA 2MJVB 2DVRA 5FE7A 5EWDA 3D1DA 3DWYA 2RI7A 4NRBA 3JVMA 5I89A 5FE1A 3LQIA 4O72A 5L98A 4N4HA 5A82A 3UV4A 1WUGA 4XY9A 5KTXA
chains in the Genus database with same CATH topology
4O7BA 3SVFA 5EV9A 4TZ8A 5ENEA 4A9FA 1F68A 4XY8A 4QSRA 5F25A 5ACYA 5DYCA 4WIVA 2OO1A 5II2A 5E74A 2RNYA 4XYAA 5D3PA 4KCXA 3G0JA 3AADA 5ETDA 4LDFA 5DKHA 4NUCA 4YATA 5A85A 5HELA 5DLXA 5I7YA 3QZVA 4Z1QA 5I29A 3P1EA 4YBSA 2R0YA 4CUPA 5IGNA 4YYJA 4IOOA 5F2PA 4UYEA 4YC9A 2N9GA 4NR4A 5C7NA 5EM3A 4QSVA 2E7OA 4ZW1A 5D3TA 4UIYA 4NRCA 5KU3A 4HXMA 3QZSA 5L8TA 3MQMA 3MB3A 4GPJA 5J0DA 2D9EA 3S92A 4Z6HA 5KTUA 4IR5A 5E9YA 5FFYA 5E3DA 5LJ2A 4A9OA 3TLPA 4HXRA 2I8NA 4NR5A 4ZC9A 5HENA 5ENFA 3HMHA 5BT5A 2RS9B 5HFRA 4Y03A 4TT4A 4BHWA 4Z1SA 2I7KA 4Z6IA 2L84A 5FFWA 3GG3A 5DKDA 1N72A 3U5MA 4Z93A 5CTLA 4J3IA 5CUBA 5JWMA 5DFBA 4HXOA 4MENA 5LKTA 4NS5A 3IU6A 4IOQA 2DVVA 4C66A 2WP2A 4UYGA 4QYLA 2L85A 5A83A 5EGUA 5AMEA 5F62A 4NUDA 5CP5A 4Q0OA 5DY7A 5HJCA 5ENCA 4QEWA 3I3JA 4LR6A 4QSWA 5CQ5A 5CRMA 5L97A 2D82A 4A9JA 5BT3A 2E7NA 4O76A 5HRXA 5EPRA 1WUMA 4HBXA 2YYNA 5FG4A 4PCIA 4YBMA 4QR3A 5LVQA 3UVYA 4XUBA 3MUKA 5I1QA 4E96A 5LUUA 4QSTA 2OSSA 5DYXA 4RVRA 5IBNA 4TT6A 5E0RA 4LYIA 4NXJA 1JM4B 2RFJA 4QSXA 5D3JA 4QNSA 5EWVA 5CQ4A 5EPSA 4NQNA 5E9LA 3AQAA 5E73A 3JVLA 5FBXA 5HFQA 4NQMA 4TYLA 5F60A 5IG6A 4PTBA 5EI4A 3SVHA 4KV1A 4QUTA 5C4QA 4NYWA 5D26A 5DKCA 3MB4A 4LZRA 4YK0A 5EP7A 4O7FA 4CFKA 4NR8A 2KTBB 2L5EA 4O75A 5CU8A 5FFVA 4C67A 4NR9A 3P1DA 5D3NA 3P1FA 4QZSA 5TCMA 4NR6A 3FKMX 4IORA 4IR6A 4LRGA 4UIXA 4UYDA 5TB6A 4O74A 5FB0A 2RNWA 4CUSA 5II1A 4UYHA 4QC1A 4LZ2A 4PS5A 3O37A 5EPBA 2YEKA 5ENIA 4TZ2A 4NR7A 4YABA 4QYDA 5L99A 5CQ8A 4MEOA 5F3AA 4X2IA 3UV5A 5FE4A 4OGIA 4QUUA 3UVDA 3SVGA 4CL9A 5FE2A 5HEMA 3ZYUA 4N4GA 3D7CA 4A9IA 4HXNA 4O78A 5C8GA 4A9LA 5F61A 3LJWA 3U5PA 5DW2A 4YBTA 4YH4A 5FH7A 2DVQA 4LYWA 5F63A 5FE3A 4A9NA 4ZQLA 4QEUA 5A5RA 5IIDA 4YYDA 4QR4A 4OGJA 4HXLA 4TU4A 5E9IA 5L8UA 5DW1A 4WHWA 5DYUA 5KHMA 5F1LA 4MR5A 5A81A 2YEMA 3UV2A 5EVAA 4WHUA 2F6NA 3UVXA 4CFLA 4N4FA 4PKLA 5CUCA 4UIZA 5ENGA 5CQ7A 4QSSA 5A7CA 3P5OA 2YDWA 5EQ1A 5H1VA 5COIA 5CUEA 5ENHA 5EWHA 5A5NA 2DKWA 4NRAA 4CUTA 4N4IA 4YYNA 3K2JA 4J0SA 2YELA 5HQ7A 5D25A 2G4AA 4UIVA 1ZS5A 3O34A 3LXJA 4PCEA 4BW4A 5EK9A 5HQ6A 4CUQA 2F6JA 5I40A 2DWWA 4KV4A 4QR5A 3O35A 4HXSA 2YW5A 3UVWA 4YAXA 4MEPA 4CURA 5CS8A 5IGLA 5CUAA 4QB3A 2DVSA 5E9VA 5EA1A 4A9EA 5ETBA 3ONIA 4LZSA 5I88A 5F36A 3HMEA 5DX4A 2DATA 5ENBA 3MULA 5E7DA 5BT4A 5I86A 4YYMA 5I7XA 5EISA 5LKZA 5C85A 5C87A 4NYVA 4YYGA 5DLZA 2RNXA 4CUUA 4A9HA 1EQFA 5CGPA 5LKXA 4OUFA 4LYSA 4A9KA 5LKUA 5LJ0A 5D7XA 5EWWA 4QSPA 3U5KA 4O7EA 4MR3A 5HM0A 2FSAA 4TU6A 5KTWA 3Q2FA 4YADA 3QZTA 4FLPA 3LQHA 3U5LA 4O7AA 4HBVA 5LVRA 3O33A 5FDZA 2H60A 2NXBA 2LSPB 5CFWA 4CLBA 4ALGA 5CQ3A 5FE9A 4O7CA 5HLSA 5ENJA 5DFDA 3NXBA 4MR4A 2WP1A 5G4SA 5L96A 4YY6A 3LQJA 5CZGA 5CUGA 2YQDA 5D3HA 5HRVA 4IR4A 5G4RA 4TS8A 5CY9A 4J1PA 5LJ1A 4MEQA 4NUEA 4AKNA 3U5JA 5IGKA 4UYFA 4QEVA 5H1TA 3U5NA 5H85A 3JVJA 5K29A 2OUOA 5CQTA 5AMFA 5F1HA 5FG5A 5I80A 2R10A 4BW1A 4QSUA 3HMFA 3S91A 3UW9A 3IU5A 3U5OA 5AD3A 4DONA 3Q2EA 5HCLA 4QSQA 2E3KA 5EWCA 2RO1A 5A5QA 4UYFB 5E3GA 4HXKA 4PY6A 3DAIA 5FE8A 5CUDA 5KO4A 5EICA 5CRZA 4YYKA 5AD2A 5HQ5A 5D0CA 4MR6A 5EU1A 5DBMA 5D24A 4BW3A 4TT2A 4ALHA 3RCWA 5F5ZA 4HBWA 4LC2A 5FG6A 3O36A 5IGMA 4BW2A 5D3SA 4F3IA 5FE0A 4UIUA 5C89A 4YY4A 5DFCA 5E9KA 4NYXA 5I83A 1E6IA 2R0VA 3G0LA 5A5OA 4J0RA 4IR3A 5CPEA 5DYAA 5FB1A 5FE5A 5CQ6A 5A5PA 5FH6A 5H1UA 5D3RA 5HRWA 4HXPA 4UIWA 5D3LA 4QC3A 1JSPB 5A5SA 4TQNA 4XUAA 5CQAA 4BJXA 4O71A 1X0JA 4QY4A 4O70A 4HBYA 4N3WA 4QBMA 4YYHA 2R0SA 3MXFA 4YH3A 5FH8A 4TTEA 4YYIA 5E9MA 3P1CA 5JI8A 3JVKA 4Q0NA 4A9MA 4UITA 4O77A 5FE6A 2GRCA 2MJVB 2DVRA 5FE7A 5EWDA 3DWYA 2RI7A 4NRBA 3JVMA 5I89A 5FE1A 3LQIA 4O72A 5L98A 4N4HA 5A82A 3UV4A 1WUGA 4XY9A 5KTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7B A;  3SVF A;  5EV9 A;  4TZ8 A;  5ENE A;  4A9F A;  1F68 A;  4XY8 A;  4QSR A;  5F25 A;  5ACY A;  5DYC A;  4WIV A;  2OO1 A;  5II2 A;  5E74 A;  2RNY A;  4XYA A;  5D3P A;  4KCX A;  3G0J A;  3AAD A;  5ETD A;  4LDF A;  5DKH A;  4NUC A;  4YAT A;  5A85 A;  5HEL A;  5DLX A;  5I7Y A;  3QZV A;  4Z1Q A;  5I29 A;  3P1E A;  4YBS A;  2R0Y A;  4CUP A;  5IGN A;  4YYJ A;  4IOO A;  5F2P A;  4UYE A;  4YC9 A;  2N9G A;  4NR4 A;  5C7N A;  5EM3 A;  4QSV A;  2E7O A;  4ZW1 A;  5D3T A;  4UIY A;  4NRC A;  5KU3 A;  4HXM A;  3QZS A;  5L8T A;  3MQM A;  3MB3 A;  4GPJ A;  5J0D A;  2D9E A;  3S92 A;  4Z6H A;  5KTU A;  4IR5 A;  5E9Y A;  5FFY A;  5E3D A;  5LJ2 A;  4A9O A;  3TLP A;  4HXR A;  2I8N A;  4NR5 A;  4ZC9 A;  5HEN A;  5ENF A;  3HMH A;  5BT5 A;  2RS9 B;  5HFR A;  4Y03 A;  4TT4 A;  4BHW A;  4Z1S A;  2I7K A;  4Z6I A;  2L84 A;  5FFW A;  3GG3 A;  5DKD A;  1N72 A;  3U5M A;  4Z93 A;  5CTL A;  4J3I A;  5CUB A;  5JWM A;  5DFB A;  4HXO A;  4MEN A;  5LKT A;  4NS5 A;  3IU6 A;  4IOQ A;  2DVV A;  4C66 A;  2WP2 A;  4UYG A;  4QYL A;  2L85 A;  5A83 A;  5EGU A;  5AME A;  5F62 A;  4NUD A;  5CP5 A;  4Q0O A;  5DY7 A;  5HJC A;  5ENC A;  4QEW A;  3I3J A;  4LR6 A;  4QSW A;  5CQ5 A;  5CRM A;  5L97 A;  2D82 A;  4A9J A;  5BT3 A;  2E7N A;  4O76 A;  5HRX A;  5EPR A;  1WUM A;  4HBX A;  2YYN A;  5FG4 A;  4PCI A;  4YBM A;  4QR3 A;  5LVQ A;  3UVY A;  4XUB A;  3MUK A;  5I1Q A;  4E96 A;  5LUU A;  4QST A;  2OSS A;  5DYX A;  4RVR A;  5IBN A;  4TT6 A;  5E0R A;  4LYI A;  4NXJ A;  1JM4 B;  2RFJ A;  4QSX A;  5D3J A;  4QNS A;  5EWV A;  5CQ4 A;  5EPS A;  4NQN A;  5E9L A;  3AQA A;  5E73 A;  3JVL A;  5FBX A;  5HFQ A;  4NQM A;  4TYL A;  5F60 A;  5IG6 A;  4PTB A;  5EI4 A;  3SVH A;  4KV1 A;  4QUT A;  5C4Q A;  4NYW A;  5D26 A;  5DKC A;  3MB4 A;  4LZR A;  4YK0 A;  5EP7 A;  4O7F A;  4CFK A;  4NR8 A;  2KTB B;  2L5E A;  4O75 A;  5CU8 A;  5FFV A;  4C67 A;  4NR9 A;  3P1D A;  5D3N A;  3P1F A;  4QZS A;  5TCM A;  4NR6 A;  3FKM X;  4IOR A;  4IR6 A;  4LRG A;  4UIX A;  4UYD A;  5TB6 A;  4O74 A;  5FB0 A;  2RNW A;  4CUS A;  5II1 A;  4UYH A;  4QC1 A;  4LZ2 A;  4PS5 A;  3O37 A;  5EPB A;  2YEK A;  5ENI A;  4TZ2 A;  4NR7 A;  4YAB A;  4QYD A;  5L99 A;  5CQ8 A;  4MEO A;  5F3A A;  4X2I A;  3UV5 A;  5FE4 A;  4OGI A;  4QUU A;  3UVD A;  3SVG A;  4CL9 A;  5FE2 A;  5HEM A;  3ZYU A;  4N4G A;  3D7C A;  4A9I A;  4HXN A;  4O78 A;  5C8G A;  4A9L A;  5F61 A;  3LJW A;  3U5P A;  5DW2 A;  4YBT A;  4YH4 A;  5FH7 A;  2DVQ A;  4LYW A;  5F63 A;  5FE3 A;  4A9N A;  4ZQL A;  4QEU A;  5A5R A;  5IID A;  4YYD A;  4QR4 A;  4OGJ A;  4HXL A;  4TU4 A;  5E9I A;  5L8U A;  5DW1 A;  4WHW A;  5DYU A;  5KHM A;  5F1L A;  4MR5 A;  5A81 A;  2YEM A;  3UV2 A;  5EVA A;  4WHU A;  2F6N A;  3UVX A;  4CFL A;  4N4F A;  4PKL A;  5CUC A;  4UIZ A;  5ENG A;  5CQ7 A;  4QSS A;  5A7C A;  3P5O A;  2YDW A;  5EQ1 A;  5H1V A;  5COI A;  5CUE A;  5ENH A;  5EWH A;  5A5N A;  2DKW A;  4NRA A;  4CUT A;  4N4I A;  4YYN A;  3K2J A;  4J0S A;  2YEL A;  5HQ7 A;  5D25 A;  2G4A A;  4UIV A;  1ZS5 A;  3O34 A;  3LXJ A;  4PCE A;  4BW4 A;  5EK9 A;  5HQ6 A;  4CUQ A;  2F6J A;  5I40 A;  2DWW A;  4KV4 A;  4QR5 A;  3O35 A;  4HXS A;  2YW5 A;  3UVW A;  4YAX A;  4MEP A;  4CUR A;  5CS8 A;  5IGL A;  5CUA A;  4QB3 A;  2DVS A;  5E9V A;  5EA1 A;  4A9E A;  5ETB A;  3ONI A;  4LZS A;  5I88 A;  5F36 A;  3HME A;  5DX4 A;  2DAT A;  5ENB A;  3MUL A;  5E7D A;  5BT4 A;  5I86 A;  4YYM A;  5I7X A;  5EIS A;  5LKZ A;  5C85 A;  5C87 A;  4NYV A;  4YYG A;  5DLZ A;  2RNX A;  4CUU A;  4A9H A;  1EQF A;  5CGP A;  5LKX A;  4OUF A;  4LYS A;  4A9K A;  5LKU A;  5LJ0 A;  5D7X A;  5EWW A;  4QSP A;  3U5K A;  4O7E A;  4MR3 A;  5HM0 A;  2FSA A;  4TU6 A;  5KTW A;  3Q2F A;  4YAD A;  3QZT A;  4FLP A;  3LQH A;  3U5L A;  4O7A A;  4HBV A;  5LVR A;  3O33 A;  5FDZ A;  2H60 A;  2NXB A;  2LSP B;  5CFW A;  4CLB A;  4ALG A;  5CQ3 A;  5FE9 A;  4O7C A;  5HLS A;  5ENJ A;  5DFD A;  3NXB A;  4MR4 A;  2WP1 A;  5G4S A;  5L96 A;  4YY6 A;  3LQJ A;  5CZG A;  5CUG A;  2YQD A;  5D3H A;  5HRV A;  4IR4 A;  5G4R A;  4TS8 A;  5CY9 A;  4J1P A;  5LJ1 A;  4MEQ A;  4NUE A;  4AKN A;  3U5J A;  5IGK A;  4UYF A;  4QEV A;  5H1T A;  3U5N A;  5H85 A;  3JVJ A;  5K29 A;  2OUO A;  5CQT A;  5AMF A;  5F1H A;  5FG5 A;  5I80 A;  2R10 A;  4BW1 A;  4QSU A;  3HMF A;  3S91 A;  3UW9 A;  3IU5 A;  3U5O A;  5AD3 A;  4DON A;  3Q2E A;  5HCL A;  4QSQ A;  2E3K A;  5EWC A;  2RO1 A;  5A5Q A;  4UYF B;  5E3G A;  4HXK A;  4PY6 A;  3DAI A;  5FE8 A;  5CUD A;  5KO4 A;  5EIC A;  5CRZ A;  4YYK A;  5AD2 A;  5HQ5 A;  5D0C A;  4MR6 A;  5EU1 A;  5DBM A;  5D24 A;  4BW3 A;  4TT2 A;  4ALH A;  3RCW A;  5F5Z A;  4HBW A;  4LC2 A;  5FG6 A;  3O36 A;  5IGM A;  4BW2 A;  5D3S A;  4F3I A;  5FE0 A;  4UIU A;  5C89 A;  4YY4 A;  5DFC A;  5E9K A;  4NYX A;  5I83 A;  1E6I A;  2R0V A;  3G0L A;  5A5O A;  4J0R A;  4IR3 A;  5CPE A;  5DYA A;  5FB1 A;  5FE5 A;  5CQ6 A;  5A5P A;  5FH6 A;  5H1U A;  5D3R A;  5HRW A;  4HXP A;  4UIW A;  5D3L A;  4QC3 A;  1JSP B;  5A5S A;  4TQN A;  4XUA A;  5CQA A;  4BJX A;  4O71 A;  1X0J A;  4QY4 A;  4O70 A;  4HBY A;  4N3W A;  4QBM A;  4YYH A;  2R0S A;  3MXF A;  4YH3 A;  5FH8 A;  4TTE A;  4YYI A;  5E9M A;  3P1C A;  5JI8 A;  3JVK A;  4Q0N A;  4A9M A;  4UIT A;  4O77 A;  5FE6 A;  2GRC A;  2MJV B;  2DVR A;  5FE7 A;  5EWD A;  3DWY A;  2RI7 A;  4NRB A;  3JVM A;  5I89 A;  5FE1 A;  3LQI A;  4O72 A;  5L98 A;  4N4H A;  5A82 A;  3UV4 A;  1WUG A;  4XY9 A;  5KTX A; 
#chains in the Genus database with same CATH topology
 4O7B A;  3SVF A;  5EV9 A;  4TZ8 A;  5ENE A;  4A9F A;  1F68 A;  4XY8 A;  4QSR A;  5F25 A;  5ACY A;  5DYC A;  4WIV A;  2OO1 A;  5II2 A;  5E74 A;  2RNY A;  4XYA A;  5D3P A;  4KCX A;  3G0J A;  3AAD A;  5ETD A;  4LDF A;  5DKH A;  4NUC A;  4YAT A;  5A85 A;  5HEL A;  5DLX A;  5I7Y A;  3QZV A;  4Z1Q A;  5I29 A;  3P1E A;  4YBS A;  2R0Y A;  4CUP A;  5IGN A;  4YYJ A;  4IOO A;  5F2P A;  4UYE A;  4YC9 A;  2N9G A;  4NR4 A;  5C7N A;  5EM3 A;  4QSV A;  2E7O A;  4ZW1 A;  5D3T A;  4UIY A;  4NRC A;  5KU3 A;  4HXM A;  3QZS A;  5L8T A;  3MQM A;  3MB3 A;  4GPJ A;  5J0D A;  2D9E A;  3S92 A;  4Z6H A;  5KTU A;  4IR5 A;  5E9Y A;  5FFY A;  5E3D A;  5LJ2 A;  4A9O A;  3TLP A;  4HXR A;  2I8N A;  4NR5 A;  4ZC9 A;  5HEN A;  5ENF A;  3HMH A;  5BT5 A;  2RS9 B;  5HFR A;  4Y03 A;  4TT4 A;  4BHW A;  4Z1S A;  2I7K A;  4Z6I A;  2L84 A;  5FFW A;  3GG3 A;  5DKD A;  1N72 A;  3U5M A;  4Z93 A;  5CTL A;  4J3I A;  5CUB A;  5JWM A;  5DFB A;  4HXO A;  4MEN A;  5LKT A;  4NS5 A;  3IU6 A;  4IOQ A;  2DVV A;  4C66 A;  2WP2 A;  4UYG A;  4QYL A;  2L85 A;  5A83 A;  5EGU A;  5AME A;  5F62 A;  4NUD A;  5CP5 A;  4Q0O A;  3ERR A;  5DY7 A;  5HJC A;  5ENC A;  4QEW A;  3D1B A;  3I3J A;  4LR6 A;  4QSW A;  5CRM A;  5CQ5 A;  5L97 A;  2D82 A;  4A9J A;  5BT3 A;  2E7N A;  4O76 A;  5HRX A;  5EPR A;  1WUM A;  4HBX A;  2YYN A;  5FG4 A;  4PCI A;  4YBM A;  4QR3 A;  5LVQ A;  3UVY A;  4XUB A;  3MUK A;  5I1Q A;  4E96 A;  5LUU A;  4QST A;  2OSS A;  5DYX A;  4RVR A;  5IBN A;  4TT6 A;  5E0R A;  4LYI A;  4NXJ A;  1JM4 B;  2RFJ A;  4QSX A;  5D3J A;  4QNS A;  5EWV A;  5CQ4 A;  5EPS A;  4NQN A;  5E9L A;  3AQA A;  5E73 A;  3JVL A;  5FBX A;  5HFQ A;  4NQM A;  4TYL A;  5F60 A;  5IG6 A;  4PTB A;  5EI4 A;  3SVH A;  4KV1 A;  4QUT A;  5C4Q A;  4NYW A;  5D26 A;  5DKC A;  3MB4 A;  4LZR A;  4YK0 A;  5EP7 A;  4O7F A;  4CFK A;  4NR8 A;  2EJN A;  2KTB B;  2L5E A;  4O75 A;  5CU8 A;  5FFV A;  4C67 A;  4NR9 A;  3P1D A;  5D3N A;  3P1F A;  4QZS A;  5TCM A;  4NR6 A;  3FKM X;  4IOR A;  4IR6 A;  4LRG A;  4UIX A;  4UYD A;  5TB6 A;  4O74 A;  5FB0 A;  2RNW A;  4CUS A;  5II1 A;  4UYH A;  4QC1 A;  4LZ2 A;  4PS5 A;  3O37 A;  5EPB A;  2YEK A;  5ENI A;  4TZ2 A;  4NR7 A;  4YAB A;  4QYD A;  5L99 A;  5CQ8 A;  4MEO A;  5F3A A;  4X2I A;  3UV5 A;  5FE4 A;  4OGI A;  4QUU A;  3UVD A;  3SVG A;  4CL9 A;  5FE2 A;  5HEM A;  3ZYU A;  4N4G A;  3D7C A;  4A9I A;  4HXN A;  4O78 A;  5C8G A;  4A9L A;  5F61 A;  3LJW A;  3U5P A;  5DW2 A;  4YBT A;  4YH4 A;  5FH7 A;  4AKI A;  3VKH A;  2DVQ A;  4LYW A;  5F63 A;  5FE3 A;  4A9N A;  4ZQL A;  4QEU A;  5A5R A;  4AKH A;  5IID A;  4YYD A;  3VKG A;  4QR4 A;  4OGJ A;  4HXL A;  4TU4 A;  5E9I A;  5L8U A;  5DW1 A;  4WHW A;  5DYU A;  5KHM A;  5F1L A;  4MR5 A;  5A81 A;  2YEM A;  3UV2 A;  5EVA A;  4WHU A;  2F6N A;  3UVX A;  4CFL A;  4N4F A;  4PKL A;  5CUC A;  4UIZ A;  5ENG A;  5CQ7 A;  4QSS A;  5A7C A;  3P5O A;  2YDW A;  1ZKR A;  5EQ1 A;  5H1V A;  5COI A;  5CUE A;  4AKG A;  5ENH A;  5EWH A;  5A5N A;  2DKW A;  4NRA A;  4CUT A;  4N4I A;  4YYN A;  3K2J A;  4J0S A;  2YEL A;  5HQ7 A;  5D25 A;  2G4A A;  4UIV A;  1ZS5 A;  3O34 A;  3LXJ A;  4PCE A;  4BW4 A;  5EK9 A;  5HQ6 A;  4CUQ A;  2F6J A;  5I40 A;  2DWW A;  4KV4 A;  4QR5 A;  3O35 A;  4HXS A;  2YW5 A;  3UVW A;  4YAX A;  4MEP A;  4CUR A;  5CS8 A;  5IGL A;  5CUA A;  4QB3 A;  1PUO A;  2DVS A;  5E9V A;  5EA1 A;  4A9E A;  5ETB A;  3ONI A;  4LZS A;  5I88 A;  5F36 A;  3HME A;  5DX4 A;  2DAT A;  5ENB A;  3MUL A;  5E7D A;  5BT4 A;  5I86 A;  4YYM A;  5I7X A;  5EIS A;  5LKZ A;  5C85 A;  5C87 A;  4NYV A;  4YYG A;  5DLZ A;  2RNX A;  4CUU A;  4A9H A;  1EQF A;  5CGP A;  5LKX A;  4OUF A;  4LYS A;  4A9K A;  5LKU A;  5LJ0 A;  5D7X A;  5EWW A;  4QSP A;  3U5K A;  4O7E A;  4MR3 A;  5HM0 A;  2FSA A;  4TU6 A;  5KTW A;  3Q2F A;  4YAD A;  3QZT A;  4FLP A;  3LQH A;  3U5L A;  4O7A A;  4HBV A;  5LVR A;  3O33 A;  5FDZ A;  2H60 A;  2NXB A;  2LSP B;  5CFW A;  4CLB A;  4ALG A;  5CQ3 A;  5FE9 A;  4O7C A;  5HLS A;  5ENJ A;  5DFD A;  3NXB A;  4MR4 A;  4AI6 A;  2WP1 A;  5G4S A;  5L96 A;  4YY6 A;  3LQJ A;  5CZG A;  5CUG A;  2YQD A;  5D3H A;  5HRV A;  4IR4 A;  5G4R A;  4TS8 A;  5CY9 A;  4J1P A;  5LJ1 A;  4MEQ A;  4NUE A;  4AKN A;  3U5J A;  5IGK A;  4UYF A;  4QEV A;  5H1T A;  3U5N A;  5H85 A;  3JVJ A;  5K29 A;  2OUO A;  5CQT A;  5AMF A;  5F1H A;  5FG5 A;  5I80 A;  2R10 A;  4BW1 A;  4QSU A;  3HMF A;  3S91 A;  3UW9 A;  3IU5 A;  3U5O A;  5AD3 A;  4DON A;  3Q2E A;  5HCL A;  4QSQ A;  2E3K A;  5EWC A;  2RO1 A;  5A5Q A;  4UYF B;  5E3G A;  4HXK A;  4PY6 A;  3DAI A;  5FE8 A;  5CUD A;  5KO4 A;  5EIC A;  5CRZ A;  4YYK A;  5AD2 A;  5HQ5 A;  5D0C A;  4MR6 A;  5EU1 A;  5DBM A;  5D24 A;  4BW3 A;  4TT2 A;  4ALH A;  3RCW A;  5F5Z A;  4HBW A;  4LC2 A;  5FG6 A;  3O36 A;  5IGM A;  4BW2 A;  5D3S A;  4F3I A;  5FE0 A;  4UIU A;  5C89 A;  4YY4 A;  5DFC A;  5E9K A;  4NYX A;  5I83 A;  1E6I A;  2R0V A;  3G0L A;  5A5O A;  4J0R A;  4IR3 A;  5CPE A;  5DYA A;  5FB1 A;  5FE5 A;  5CQ6 A;  5A5P A;  5FH6 A;  5H1U A;  5D3R A;  5HRW A;  4HXP A;  4UIW A;  5D3L A;  4QC3 A;  1JSP B;  5A5S A;  4TQN A;  4XUA A;  5CQA A;  4BJX A;  4O71 A;  1X0J A;  4QY4 A;  4O70 A;  4HBY A;  4N3W A;  4QBM A;  4YYH A;  2R0S A;  3MXF A;  4YH3 A;  5FH8 A;  4TTE A;  4YYI A;  5E9M A;  3P1C A;  5JI8 A;  3JVK A;  4Q0N A;  4A9M A;  4UIT A;  4O77 A;  5FE6 A;  2GRC A;  2MJV B;  2DVR A;  5FE7 A;  5EWD A;  3D1D A;  3DWY A;  2RI7 A;  4NRB A;  3JVM A;  5I89 A;  5FE1 A;  3LQI A;  4O72 A;  5L98 A;  4N4H A;  5A82 A;  3UV4 A;  1WUG A;  4XY9 A;  5KTX A; 
#chains in the Genus database with same CATH homology
 4O7B A;  3SVF A;  5EV9 A;  4TZ8 A;  5ENE A;  4A9F A;  1F68 A;  4XY8 A;  4QSR A;  5F25 A;  5ACY A;  5DYC A;  4WIV A;  2OO1 A;  5II2 A;  5E74 A;  2RNY A;  4XYA A;  5D3P A;  4KCX A;  3G0J A;  3AAD A;  5ETD A;  4LDF A;  5DKH A;  4NUC A;  4YAT A;  5A85 A;  5HEL A;  5DLX A;  5I7Y A;  3QZV A;  4Z1Q A;  5I29 A;  3P1E A;  4YBS A;  2R0Y A;  4CUP A;  5IGN A;  4YYJ A;  4IOO A;  5F2P A;  4UYE A;  4YC9 A;  2N9G A;  4NR4 A;  5C7N A;  5EM3 A;  4QSV A;  2E7O A;  4ZW1 A;  5D3T A;  4UIY A;  4NRC A;  5KU3 A;  4HXM A;  3QZS A;  5L8T A;  3MQM A;  3MB3 A;  4GPJ A;  5J0D A;  2D9E A;  3S92 A;  4Z6H A;  5KTU A;  4IR5 A;  5E9Y A;  5FFY A;  5E3D A;  5LJ2 A;  4A9O A;  3TLP A;  4HXR A;  2I8N A;  4NR5 A;  4ZC9 A;  5HEN A;  5ENF A;  3HMH A;  5BT5 A;  2RS9 B;  5HFR A;  4Y03 A;  4TT4 A;  4BHW A;  4Z1S A;  2I7K A;  4Z6I A;  2L84 A;  5FFW A;  3GG3 A;  5DKD A;  1N72 A;  3U5M A;  4Z93 A;  5CTL A;  4J3I A;  5CUB A;  5JWM A;  5DFB A;  4HXO A;  4MEN A;  5LKT A;  4NS5 A;  3IU6 A;  4IOQ A;  2DVV A;  4C66 A;  2WP2 A;  4UYG A;  4QYL A;  2L85 A;  5A83 A;  5EGU A;  5AME A;  5F62 A;  4NUD A;  5CP5 A;  4Q0O A;  5DY7 A;  5HJC A;  5ENC A;  4QEW A;  3I3J A;  4LR6 A;  4QSW A;  5CQ5 A;  5CRM A;  5L97 A;  2D82 A;  4A9J A;  5BT3 A;  2E7N A;  4O76 A;  5HRX A;  5EPR A;  1WUM A;  4HBX A;  2YYN A;  5FG4 A;  4PCI A;  4YBM A;  4QR3 A;  5LVQ A;  3UVY A;  4XUB A;  3MUK A;  5I1Q A;  4E96 A;  5LUU A;  4QST A;  2OSS A;  5DYX A;  4RVR A;  5IBN A;  4TT6 A;  5E0R A;  4LYI A;  4NXJ A;  1JM4 B;  2RFJ A;  4QSX A;  5D3J A;  4QNS A;  5EWV A;  5CQ4 A;  5EPS A;  4NQN A;  5E9L A;  3AQA A;  5E73 A;  3JVL A;  5FBX A;  5HFQ A;  4NQM A;  4TYL A;  5F60 A;  5IG6 A;  4PTB A;  5EI4 A;  3SVH A;  4KV1 A;  4QUT A;  5C4Q A;  4NYW A;  5D26 A;  5DKC A;  3MB4 A;  4LZR A;  4YK0 A;  5EP7 A;  4O7F A;  4CFK A;  4NR8 A;  2KTB B;  2L5E A;  4O75 A;  5CU8 A;  5FFV A;  4C67 A;  4NR9 A;  3P1D A;  5D3N A;  3P1F A;  4QZS A;  5TCM A;  4NR6 A;  3FKM X;  4IOR A;  4IR6 A;  4LRG A;  4UIX A;  4UYD A;  5TB6 A;  4O74 A;  5FB0 A;  2RNW A;  4CUS A;  5II1 A;  4UYH A;  4QC1 A;  4LZ2 A;  4PS5 A;  3O37 A;  5EPB A;  2YEK A;  5ENI A;  4TZ2 A;  4NR7 A;  4YAB A;  4QYD A;  5L99 A;  5CQ8 A;  4MEO A;  5F3A A;  4X2I A;  3UV5 A;  5FE4 A;  4OGI A;  4QUU A;  3UVD A;  3SVG A;  4CL9 A;  5FE2 A;  5HEM A;  3ZYU A;  4N4G A;  3D7C A;  4A9I A;  4HXN A;  4O78 A;  5C8G A;  4A9L A;  5F61 A;  3LJW A;  3U5P A;  5DW2 A;  4YBT A;  4YH4 A;  5FH7 A;  2DVQ A;  4LYW A;  5F63 A;  5FE3 A;  4A9N A;  4ZQL A;  4QEU A;  5A5R A;  5IID A;  4YYD A;  4QR4 A;  4OGJ A;  4HXL A;  4TU4 A;  5E9I A;  5L8U A;  5DW1 A;  4WHW A;  5DYU A;  5KHM A;  5F1L A;  4MR5 A;  5A81 A;  2YEM A;  3UV2 A;  5EVA A;  4WHU A;  2F6N A;  3UVX A;  4CFL A;  4N4F A;  4PKL A;  5CUC A;  4UIZ A;  5ENG A;  5CQ7 A;  4QSS A;  5A7C A;  3P5O A;  2YDW A;  5EQ1 A;  5H1V A;  5COI A;  5CUE A;  5ENH A;  5EWH A;  5A5N A;  2DKW A;  4NRA A;  4CUT A;  4N4I A;  4YYN A;  3K2J A;  4J0S A;  2YEL A;  5HQ7 A;  5D25 A;  2G4A A;  4UIV A;  1ZS5 A;  3O34 A;  3LXJ A;  4PCE A;  4BW4 A;  5EK9 A;  5HQ6 A;  4CUQ A;  2F6J A;  5I40 A;  2DWW A;  4KV4 A;  4QR5 A;  3O35 A;  4HXS A;  2YW5 A;  3UVW A;  4YAX A;  4MEP A;  4CUR A;  5CS8 A;  5IGL A;  5CUA A;  4QB3 A;  2DVS A;  5E9V A;  5EA1 A;  4A9E A;  5ETB A;  3ONI A;  4LZS A;  5I88 A;  5F36 A;  3HME A;  5DX4 A;  2DAT A;  5ENB A;  3MUL A;  5E7D A;  5BT4 A;  5I86 A;  4YYM A;  5I7X A;  5EIS A;  5LKZ A;  5C85 A;  5C87 A;  4NYV A;  4YYG A;  5DLZ A;  2RNX A;  4CUU A;  4A9H A;  1EQF A;  5CGP A;  5LKX A;  4OUF A;  4LYS A;  4A9K A;  5LKU A;  5LJ0 A;  5D7X A;  5EWW A;  4QSP A;  3U5K A;  4O7E A;  4MR3 A;  5HM0 A;  2FSA A;  4TU6 A;  5KTW A;  3Q2F A;  4YAD A;  3QZT A;  4FLP A;  3LQH A;  3U5L A;  4O7A A;  4HBV A;  5LVR A;  3O33 A;  5FDZ A;  2H60 A;  2NXB A;  2LSP B;  5CFW A;  4CLB A;  4ALG A;  5CQ3 A;  5FE9 A;  4O7C A;  5HLS A;  5ENJ A;  5DFD A;  3NXB A;  4MR4 A;  2WP1 A;  5G4S A;  5L96 A;  4YY6 A;  3LQJ A;  5CZG A;  5CUG A;  2YQD A;  5D3H A;  5HRV A;  4IR4 A;  5G4R A;  4TS8 A;  5CY9 A;  4J1P A;  5LJ1 A;  4MEQ A;  4NUE A;  4AKN A;  3U5J A;  5IGK A;  4UYF A;  4QEV A;  5H1T A;  3U5N A;  5H85 A;  3JVJ A;  5K29 A;  2OUO A;  5CQT A;  5AMF A;  5F1H A;  5FG5 A;  5I80 A;  2R10 A;  4BW1 A;  4QSU A;  3HMF A;  3S91 A;  3UW9 A;  3IU5 A;  3U5O A;  5AD3 A;  4DON A;  3Q2E A;  5HCL A;  4QSQ A;  2E3K A;  5EWC A;  2RO1 A;  5A5Q A;  4UYF B;  5E3G A;  4HXK A;  4PY6 A;  3DAI A;  5FE8 A;  5CUD A;  5KO4 A;  5EIC A;  5CRZ A;  4YYK A;  5AD2 A;  5HQ5 A;  5D0C A;  4MR6 A;  5EU1 A;  5DBM A;  5D24 A;  4BW3 A;  4TT2 A;  4ALH A;  3RCW A;  5F5Z A;  4HBW A;  4LC2 A;  5FG6 A;  3O36 A;  5IGM A;  4BW2 A;  5D3S A;  4F3I A;  5FE0 A;  4UIU A;  5C89 A;  4YY4 A;  5DFC A;  5E9K A;  4NYX A;  5I83 A;  1E6I A;  2R0V A;  3G0L A;  5A5O A;  4J0R A;  4IR3 A;  5CPE A;  5DYA A;  5FB1 A;  5FE5 A;  5CQ6 A;  5A5P A;  5FH6 A;  5H1U A;  5D3R A;  5HRW A;  4HXP A;  4UIW A;  5D3L A;  4QC3 A;  1JSP B;  5A5S A;  4TQN A;  4XUA A;  5CQA A;  4BJX A;  4O71 A;  1X0J A;  4QY4 A;  4O70 A;  4HBY A;  4N3W A;  4QBM A;  4YYH A;  2R0S A;  3MXF A;  4YH3 A;  5FH8 A;  4TTE A;  4YYI A;  5E9M A;  3P1C A;  5JI8 A;  3JVK A;  4Q0N A;  4A9M A;  4UIT A;  4O77 A;  5FE6 A;  2GRC A;  2MJV B;  2DVR A;  5FE7 A;  5EWD A;  3DWY A;  2RI7 A;  4NRB A;  3JVM A;  5I89 A;  5FE1 A;  3LQI A;  4O72 A;  5L98 A;  4N4H A;  5A82 A;  3UV4 A;  1WUG A;  4XY9 A;  5KTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...