3UV2A

Crystal structure of the bromodomain of human nucleosome-remodeling factor subunit bptf
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
119
structure length
119
Chain Sequence
b'EDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKASRSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords bromodomain of human nucleosome-remodeling factor subunit BP
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 50
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3uv2A00
4QNSA 4LC2A 4NR9A 4YYKA 4MR4A 5EVAA 4QEWA 4Z93A 1X0JA 5F63A 4N3WA 5EPBA 5HLSA 4WHUA 2D82A 4IR5A 4O76A 5A5QA 5KTXA 5CS8A 5ACYA 5KO4A 3G0LA 4QYLA 3S92A 5D3HA 4QSXA 5FE7A 3NXBA 4C66A 4QUTA 2FSAA 4QR3A 5IGMA 4PCIA 5EU1A 4BJXA 2DVQA 5FE5A 4CL9A 5CUEA 4O7CA 4A9JA 4C67A 5AMFA 1WUMA 3K2JA 2F6NA 2GRCA 5CU8A 4IR3A 5HELA 5FE8A 4HBYA 5F1LA 5EP7A 4TS8A 3HMHA 4HXMA 2RNXA 4O78A 5CQ5A 4QY4A 5FFYA 5HCLA 2KTBB 4E96A 4YADA 3U5KA 2YEKA 5CZGA 4BW4A 4UIYA 5FG4A 4A9MA 5HQ5A 4QYDA 1E6IA 5EICA 5A82A 3UV2A 4XY9A 5I88A 5KHMA 5CY9A 4NRCA 5EGUA 2R10A 2DWWA 3P1CA 4NS5A 5LKXA 5FE2A 3IU5A 4IOQA 3ONIA 5E9LA 4YYGA 2YDWA 5D3RA 4QSVA 3MUKA 4KCXA 4ZC9A 4YYNA 4QSPA 3P1DA 4HBWA 4XYAA 4YABA 4HXKA 4XUBA 5FG5A 5F3AA 5J0DA 5G4SA 5D3LA 5IGLA 3P1FA 5KTWA 4HXSA 4Z1SA 5E9VA 5CPEA 5FE4A 5C89A 1EQFA 2RFJA 4MR5A 3SVGA 4MENA 5II1A 2L84A 3G0JA 2MJVB 4YY6A 3LQIA 2YQDA 3O33A 5EWWA 4O75A 2YEMA 4MEOA 4NR8A 5C85A 4CUSA 5FBXA 5I80A 4NYWA 5DX4A 4Q0OA 3DAIA 2R0YA 5IBNA 4MR6A 4AKNA 4NRBA 3P5OA 4LZ2A 5CUGA 4YK0A 3RCWA 5F36A 5EI4A 3UVWA 3MXFA 5CRZA 2LSPB 1ZS5A 4OGJA 2D9EA 4O77A 5COIA 4NYVA 5IGKA 4LDFA 4QSTA 5DKDA 5D7XA 5CQ8A 4CUQA 4HXLA 2NXBA 5BT3A 5HRXA 3U5MA 5F61A 2YW5A 4UYHA 4YH3A 5BT4A 5LUUA 5ENHA 4CLBA 4LR6A 3U5OA 5EWHA 3O35A 4TT2A 4UIUA 5FFVA 4UIWA 4NUDA 5CUAA 5FE9A 4O7EA 5I29A 2RNYA 3UV5A 5IG6A 3JVJA 4QZSA 5LJ1A 5DFBA 3U5NA 4MR3A 5FH6A 3QZVA 4TU6A 5LKTA 5HRWA 5CRMA 5ENGA 2E7NA 5ETDA 5C8GA 4LZRA 3AADA 5CP5A 5FB0A 5EV9A 3AQAA 2DATA 3UVXA 4NXJA 3MULA 5FDZA 2WP2A 4BW1A 5FE0A 5LJ2A 3IU6A 4YY4A 5DKHA 4J0RA 4YYJA 1F68A 5DYXA 4YYHA 5A81A 5IGNA 3Q2FA 5F25A 4TT6A 2OO1A 5DLZA 4HBXA 2RI7A 2OUOA 2E3KA 4HXRA 5ETBA 5EQ1A 5E9KA 3Q2EA 5FE3A 3MB3A 5EA1A 4ALHA 5L97A 4YAXA 5DW2A 5E9MA 5D3PA 5LJ0A 4ZW1A 2YELA 5D0CA 4PY6A 3I3JA 3S91A 3O34A 3P1EA 4QBMA 3O37A 4CUPA 5FB1A 3HMFA 5FH7A 4LYIA 5EISA 1N72A 5BT5A 5E9IA 4DONA 4BW2A 2I7KA 4NR4A 5DFDA 2OSSA 2R0SA 5I86A 3JVLA 3SVFA 3QZSA 5H85A 5EWVA 5TCMA 4QSUA 4IR4A 4A9HA 3MQMA 5A5NA 5L98A 5E3DA 4TQNA 4N4HA 3FKMX 5CUCA 4Q0NA 5D26A 4J1PA 5CTLA 4NUEA 5EWDA 3O36A 2I8NA 4N4GA 4NR6A 5CQ4A 4QC3A 4TZ2A 3UW9A 4Z1QA 5CQ7A 5F60A 2DVVA 4IR6A 4UIVA 5II2A 5ENEA 5LVRA 5A85A 5L8TA 4QSRA 5A5RA 4WIVA 4PCEA 4A9LA 3LJWA 4ZQLA 5D24A 5CQ6A 3LXJA 5HQ7A 4X2IA 4A9OA 4LZSA 5DYUA 5A5SA 4QEUA 4NR7A 5F5ZA 4QSSA 3UVDA 5A7CA 4NR5A 5DYCA 4NYXA 4IORA 4UIXA 5ENCA 4QR4A 5IIDA 4O7AA 5DFCA 5EK9A 4YATA 5D25A 5H1UA 4QB3A 4UYEA 5HEMA 5I89A 4PS5A 5A83A 5A5OA 3UV4A 4UYDA 5AD3A 2DVSA 5FE6A 5F2PA 4A9EA 5AMEA 4UITA 4HXOA 4LYWA 2RS9B 4TU4A 5ENJA 5L96A 4TT4A 5EPSA 3U5JA 4RVRA 5DYAA 5CGPA 4IOOA 3JVMA 4HXPA 4UYFA 4LRGA 5CUBA 3U5LA 5I83A 5LVQA 5ENBA 5C7NA 5TB6A 3UVYA 5DW1A 5FG6A 2L85A 4YC9A 4O70A 4BW3A 5HENA 4NRAA 4FLPA 5L99A 4OUFA 5E0RA 5E7DA 5CQTA 4YYMA 5F1HA 4YH4A 5I40A 4YBSA 4QC1A 2YYNA 5I7XA 1JSPB 4NUCA 4QSWA 3LQHA 4CFLA 4QEVA 5DY7A 5K29A 4PTBA 3TLPA 5E3GA 5G4RA 5LKZA 5FFWA 4TZ8A 4YYIA 2RO1A 5F62A 5I7YA 3HMEA 3LQJA 5EWCA 4QR5A 4QSQA 4O72A 4LYSA 5FE1A 5H1TA 4A9FA 4YBMA 5E74A 4NQMA 1WUGA 5L8UA 4UYFB 3D7CA 5A5PA 2H60A 5FH8A 5HRVA 3ZYUA 3U5PA 4J0SA 5ENIA 5CUDA 4ALGA 2E7OA 2G4AA 4F3IA 4UIZA 4PKLA 5HFQA 4BHWA 5D3NA 4KV4A 4Z6IA 4N4FA 5DKCA 2F6JA 5I1QA 5ENFA 3SVHA 5KU3A 4Z6HA 4CUTA 4GPJA 2WP1A 5HM0A 1JM4B 4O71A 5AD2A 3DWYA 5D3TA 3QZTA 4O7BA 5C87A 2R0VA 2N9GA 3JVKA 5CFWA 5DLXA 4UYGA 4MEQA 4XUAA 5D3SA 4QUUA 5LKUA 4Y03A 5D3JA 4A9NA 5EPRA 3MB4A 3GG3A 4XY8A 4N4IA 5H1VA 4J3IA 5CQAA 5KTUA 4NQNA 5JI8A 2DVRA 5HQ6A 4HXNA 4A9IA 4MEPA 5HJCA 5E73A 4TYLA 5E9YA 4YYDA 4CFKA 4O74A 5JWMA 4KV1A 2RNWA 4HBVA 4YBTA 5HFRA 4O7FA 2DKWA 5CQ3A 4OGIA 2L5EA 4WHWA 4CUUA 4TTEA 5C4QA 5DBMA 5EM3A 4CURA 4A9KA
chains in the Genus database with same CATH superfamily
4QNSA 4LC2A 4NR9A 4YYKA 4MR4A 5EVAA 4QEWA 3D1DA 1X0JA 4Z93A 5F63A 4N3WA 5EPBA 5HLSA 4WHUA 2D82A 4IR5A 4O76A 5A5QA 5KTXA 5CS8A 5ACYA 5KO4A 3G0LA 4QYLA 3S92A 5D3HA 4QSXA 5FE7A 3NXBA 4C66A 4QUTA 2FSAA 4QR3A 5IGMA 4PCIA 5EU1A 4BJXA 2DVQA 3VKHA 5FE5A 4CL9A 2EJNA 5CUEA 4O7CA 4A9JA 4C67A 5AMFA 1WUMA 3K2JA 2F6NA 2GRCA 5CU8A 4IR3A 5HELA 5FE8A 4HBYA 5F1LA 5EP7A 4TS8A 3HMHA 4HXMA 2RNXA 4O78A 5CQ5A 4QY4A 5FFYA 5HCLA 2KTBB 4E96A 4YADA 3U5KA 2YEKA 5CZGA 4BW4A 4UIYA 5FG4A 4A9MA 5HQ5A 4QYDA 1E6IA 5EICA 5A82A 3UV2A 4XY9A 5I88A 5KHMA 5CY9A 4NRCA 5EGUA 2R10A 2DWWA 3P1CA 4NS5A 5LKXA 5FE2A 3IU5A 4IOQA 3ONIA 5E9LA 4YYGA 2YDWA 5D3RA 4QSVA 3MUKA 4KCXA 4ZC9A 4YYNA 4QSPA 3P1DA 4HBWA 4XYAA 4YABA 4HXKA 4XUBA 5FG5A 5F3AA 3ERRA 5J0DA 5G4SA 5D3LA 5IGLA 3P1FA 5KTWA 4HXSA 4Z1SA 5E9VA 5CPEA 5FE4A 5C89A 1EQFA 2RFJA 4MR5A 3SVGA 4MENA 5II1A 2L84A 3G0JA 2MJVB 4YY6A 3LQIA 2YQDA 3O33A 5EWWA 4O75A 2YEMA 4MEOA 4NR8A 5C85A 4CUSA 5FBXA 5I80A 4NYWA 5DX4A 4Q0OA 3DAIA 2R0YA 4AI6A 5IBNA 4MR6A 4AKNA 4NRBA 3P5OA 4LZ2A 5CUGA 4YK0A 3RCWA 5F36A 5EI4A 3UVWA 3MXFA 5CRZA 2LSPB 1ZS5A 4OGJA 2D9EA 4O77A 5COIA 4NYVA 5IGKA 4LDFA 4QSTA 5DKDA 5D7XA 5CQ8A 4CUQA 4HXLA 2NXBA 5BT3A 5HRXA 3U5MA 5F61A 2YW5A 4UYHA 4YH3A 5BT4A 5LUUA 5ENHA 4CLBA 4LR6A 3U5OA 5EWHA 3O35A 4TT2A 4UIUA 5FFVA 4UIWA 4NUDA 5CUAA 5FE9A 4O7EA 5I29A 2RNYA 3UV5A 5IG6A 3JVJA 4QZSA 5LJ1A 5DFBA 3U5NA 4MR3A 5FH6A 3QZVA 4TU6A 5LKTA 5HRWA 5CRMA 5ENGA 2E7NA 5ETDA 5C8GA 4LZRA 3AADA 5CP5A 5FB0A 5EV9A 3AQAA 2DATA 3UVXA 4NXJA 3MULA 5FDZA 2WP2A 4BW1A 5FE0A 5LJ2A 3IU6A 4YY4A 5DKHA 4J0RA 4YYJA 1F68A 5DYXA 4YYHA 5A81A 5IGNA 3Q2FA 5F25A 4TT6A 2OO1A 5DLZA 4HBXA 2RI7A 2OUOA 2E3KA 4HXRA 5ETBA 5EQ1A 5E9KA 3Q2EA 5FE3A 3MB3A 5EA1A 4ALHA 5L97A 4YAXA 5DW2A 5E9MA 5D3PA 5LJ0A 4ZW1A 2YELA 5D0CA 4AKGA 4PY6A 3I3JA 3S91A 3O34A 3P1EA 4QBMA 3O37A 4CUPA 5FB1A 3HMFA 5FH7A 4LYIA 5EISA 1N72A 5BT5A 5E9IA 4DONA 4BW2A 2I7KA 4NR4A 5DFDA 2OSSA 2R0SA 5I86A 3JVLA 3SVFA 3QZSA 5H85A 5EWVA 5TCMA 4QSUA 4IR4A 4A9HA 3MQMA 5A5NA 5L98A 5E3DA 4TQNA 4N4HA 3FKMX 5CUCA 4Q0NA 5D26A 4J1PA 5CTLA 4NUEA 5EWDA 3O36A 2I8NA 4N4GA 4NR6A 5CQ4A 4QC3A 4TZ2A 3UW9A 4Z1QA 5CQ7A 5F60A 2DVVA 4IR6A 4UIVA 5II2A 5ENEA 5LVRA 1ZKRA 5A85A 5L8TA 4QSRA 5A5RA 4WIVA 4PCEA 4A9LA 3LJWA 4ZQLA 5D24A 5CQ6A 3LXJA 5HQ7A 4X2IA 4A9OA 4LZSA 5DYUA 5A5SA 4QEUA 4NR7A 5F5ZA 4QSSA 3UVDA 5A7CA 4NR5A 5DYCA 4NYXA 4IORA 4UIXA 1PUOA 5ENCA 4QR4A 5IIDA 4O7AA 5DFCA 5EK9A 4YATA 5D25A 5H1UA 4QB3A 4UYEA 5HEMA 5I89A 4PS5A 5A83A 5A5OA 3UV4A 4UYDA 5AD3A 2DVSA 5FE6A 5F2PA 4A9EA 5AMEA 4UITA 4HXOA 4LYWA 2RS9B 4TU4A 5ENJA 5L96A 4TT4A 5EPSA 3U5JA 4RVRA 5DYAA 5CGPA 4IOOA 3JVMA 4HXPA 4UYFA 4LRGA 5CUBA 3U5LA 5I83A 5LVQA 5ENBA 5C7NA 5TB6A 3UVYA 5DW1A 5FG6A 2L85A 4YC9A 4O70A 4BW3A 5HENA 4NRAA 4FLPA 5L99A 4OUFA 5E0RA 5E7DA 5CQTA 4YYMA 5F1HA 4YH4A 5I40A 4YBSA 4QC1A 2YYNA 5I7XA 1JSPB 4NUCA 4QSWA 3LQHA 4CFLA 4QEVA 5DY7A 5K29A 4PTBA 3TLPA 5E3GA 5G4RA 5LKZA 5FFWA 4TZ8A 4YYIA 2RO1A 5F62A 5I7YA 3HMEA 3LQJA 5EWCA 4QR5A 4QSQA 4O72A 4LYSA 5FE1A 5H1TA 4A9FA 4YBMA 5E74A 4NQMA 1WUGA 5L8UA 4UYFB 3D7CA 5A5PA 2H60A 5FH8A 5HRVA 3ZYUA 3U5PA 4J0SA 5ENIA 5CUDA 4ALGA 2E7OA 2G4AA 4F3IA 4UIZA 4PKLA 5HFQA 4BHWA 5D3NA 4KV4A 4Z6IA 4N4FA 5DKCA 2F6JA 5I1QA 5ENFA 3SVHA 5KU3A 4Z6HA 4CUTA 4GPJA 2WP1A 5HM0A 1JM4B 4O71A 5AD2A 3DWYA 5D3TA 3QZTA 4O7BA 5C87A 2R0VA 2N9GA 3JVKA 5CFWA 4AKHA 5DLXA 4UYGA 4MEQA 4XUAA 5D3SA 4QUUA 5LKUA 3D1BA 4Y03A 4AKIA 5D3JA 4A9NA 5EPRA 3VKGA 3MB4A 3GG3A 4XY8A 4N4IA 5H1VA 4J3IA 5CQAA 5KTUA 4NQNA 5JI8A 2DVRA 5HQ6A 4HXNA 4A9IA 4MEPA 5HJCA 5E73A 4TYLA 5E9YA 4YYDA 4CFKA 4O74A 5JWMA 4KV1A 2RNWA 4HBVA 4YBTA 5HFRA 4O7FA 2DKWA 5CQ3A 4OGIA 2L5EA 4WHWA 4CUUA 4TTEA 5C4QA 5DBMA 5EM3A 4CURA 4A9KA
chains in the Genus database with same CATH topology
4QNSA 4LC2A 4NR9A 4YYKA 4MR4A 5EVAA 4QEWA 4Z93A 1X0JA 5F63A 4N3WA 5EPBA 5HLSA 4WHUA 2D82A 4IR5A 4O76A 5A5QA 5KTXA 5CS8A 5ACYA 5KO4A 3G0LA 4QYLA 3S92A 5D3HA 4QSXA 5FE7A 3NXBA 4C66A 4QUTA 2FSAA 4QR3A 5IGMA 4PCIA 5EU1A 4BJXA 2DVQA 5FE5A 4CL9A 5CUEA 4O7CA 4A9JA 4C67A 5AMFA 1WUMA 3K2JA 2F6NA 2GRCA 5CU8A 4IR3A 5HELA 5FE8A 4HBYA 5F1LA 5EP7A 4TS8A 3HMHA 4HXMA 2RNXA 4O78A 5CQ5A 4QY4A 5FFYA 5HCLA 2KTBB 4E96A 4YADA 3U5KA 2YEKA 5CZGA 4BW4A 4UIYA 5FG4A 4A9MA 5HQ5A 4QYDA 1E6IA 5EICA 5A82A 3UV2A 4XY9A 5I88A 5KHMA 5CY9A 4NRCA 5EGUA 2R10A 2DWWA 3P1CA 4NS5A 5LKXA 5FE2A 3IU5A 4IOQA 3ONIA 5E9LA 4YYGA 2YDWA 5D3RA 4QSVA 3MUKA 4KCXA 4ZC9A 4YYNA 4QSPA 3P1DA 4HBWA 4XYAA 4YABA 4HXKA 4XUBA 5FG5A 5F3AA 5J0DA 5G4SA 5D3LA 5IGLA 3P1FA 5KTWA 4HXSA 4Z1SA 5E9VA 5CPEA 5FE4A 5C89A 1EQFA 2RFJA 4MR5A 3SVGA 4MENA 5II1A 2L84A 3G0JA 2MJVB 4YY6A 3LQIA 2YQDA 3O33A 5EWWA 4O75A 2YEMA 4MEOA 4NR8A 5C85A 4CUSA 5FBXA 5I80A 4NYWA 5DX4A 4Q0OA 3DAIA 2R0YA 5IBNA 4MR6A 4AKNA 4NRBA 3P5OA 4LZ2A 5CUGA 4YK0A 3RCWA 5F36A 5EI4A 3UVWA 3MXFA 5CRZA 2LSPB 1ZS5A 4OGJA 2D9EA 4O77A 5COIA 4NYVA 5IGKA 4LDFA 4QSTA 5DKDA 5D7XA 5CQ8A 4CUQA 4HXLA 2NXBA 5BT3A 5HRXA 3U5MA 5F61A 2YW5A 4UYHA 4YH3A 5BT4A 5LUUA 5ENHA 4CLBA 4LR6A 3U5OA 5EWHA 3O35A 4TT2A 4UIUA 5FFVA 4UIWA 4NUDA 5CUAA 5FE9A 4O7EA 5I29A 2RNYA 3UV5A 5IG6A 3JVJA 4QZSA 5LJ1A 5DFBA 3U5NA 4MR3A 5FH6A 3QZVA 4TU6A 5LKTA 5HRWA 5CRMA 5ENGA 2E7NA 5ETDA 5C8GA 4LZRA 3AADA 5CP5A 5FB0A 5EV9A 3AQAA 2DATA 3UVXA 4NXJA 3MULA 5FDZA 2WP2A 4BW1A 5FE0A 5LJ2A 3IU6A 4YY4A 5DKHA 4J0RA 4YYJA 1F68A 5DYXA 4YYHA 5A81A 5IGNA 3Q2FA 5F25A 4TT6A 2OO1A 5DLZA 4HBXA 2RI7A 2OUOA 2E3KA 4HXRA 5ETBA 5EQ1A 5E9KA 3Q2EA 5FE3A 3MB3A 5EA1A 4ALHA 5L97A 4YAXA 5DW2A 5E9MA 5D3PA 5LJ0A 4ZW1A 2YELA 5D0CA 4PY6A 3I3JA 3S91A 3O34A 3P1EA 4QBMA 3O37A 4CUPA 5FB1A 3HMFA 5FH7A 4LYIA 5EISA 1N72A 5BT5A 5E9IA 4DONA 4BW2A 2I7KA 4NR4A 5DFDA 2OSSA 2R0SA 5I86A 3JVLA 3SVFA 3QZSA 5H85A 5EWVA 5TCMA 4QSUA 4IR4A 4A9HA 3MQMA 5A5NA 5L98A 5E3DA 4TQNA 4N4HA 3FKMX 5CUCA 4Q0NA 5D26A 4J1PA 5CTLA 4NUEA 5EWDA 3O36A 2I8NA 4N4GA 4NR6A 5CQ4A 4QC3A 4TZ2A 3UW9A 4Z1QA 5CQ7A 5F60A 2DVVA 4IR6A 4UIVA 5II2A 5ENEA 5LVRA 5A85A 5L8TA 4QSRA 5A5RA 4WIVA 4PCEA 4A9LA 3LJWA 4ZQLA 5D24A 5CQ6A 3LXJA 5HQ7A 4X2IA 4A9OA 4LZSA 5DYUA 5A5SA 4QEUA 4NR7A 5F5ZA 4QSSA 3UVDA 5A7CA 4NR5A 5DYCA 4NYXA 4IORA 4UIXA 5ENCA 4QR4A 5IIDA 4O7AA 5DFCA 5EK9A 4YATA 5D25A 5H1UA 4QB3A 4UYEA 5HEMA 5I89A 4PS5A 5A83A 5A5OA 3UV4A 4UYDA 5AD3A 2DVSA 5FE6A 5F2PA 4A9EA 5AMEA 4UITA 4HXOA 4LYWA 2RS9B 4TU4A 5ENJA 5L96A 4TT4A 5EPSA 3U5JA 4RVRA 5DYAA 5CGPA 4IOOA 3JVMA 4HXPA 4UYFA 4LRGA 5CUBA 3U5LA 5I83A 5LVQA 5ENBA 5C7NA 5TB6A 3UVYA 5DW1A 5FG6A 2L85A 4YC9A 4O70A 4BW3A 5HENA 4NRAA 4FLPA 5L99A 4OUFA 5E0RA 5E7DA 5CQTA 4YYMA 5F1HA 4YH4A 5I40A 4YBSA 4QC1A 2YYNA 5I7XA 1JSPB 4NUCA 4QSWA 3LQHA 4CFLA 4QEVA 5DY7A 5K29A 4PTBA 3TLPA 5E3GA 5G4RA 5LKZA 5FFWA 4TZ8A 4YYIA 2RO1A 5F62A 5I7YA 3HMEA 3LQJA 5EWCA 4QR5A 4QSQA 4O72A 4LYSA 5FE1A 5H1TA 4A9FA 4YBMA 5E74A 4NQMA 1WUGA 5L8UA 4UYFB 3D7CA 5A5PA 2H60A 5FH8A 5HRVA 3ZYUA 3U5PA 4J0SA 5ENIA 5CUDA 4ALGA 2E7OA 2G4AA 4F3IA 4UIZA 4PKLA 5HFQA 4BHWA 5D3NA 4KV4A 4Z6IA 4N4FA 5DKCA 2F6JA 5I1QA 5ENFA 3SVHA 5KU3A 4Z6HA 4CUTA 4GPJA 2WP1A 5HM0A 1JM4B 4O71A 5AD2A 3DWYA 5D3TA 3QZTA 4O7BA 5C87A 2R0VA 2N9GA 3JVKA 5CFWA 5DLXA 4UYGA 4MEQA 4XUAA 5D3SA 4QUUA 5LKUA 4Y03A 5D3JA 4A9NA 5EPRA 3MB4A 3GG3A 4XY8A 4N4IA 5H1VA 4J3IA 5CQAA 5KTUA 4NQNA 5JI8A 2DVRA 5HQ6A 4HXNA 4A9IA 4MEPA 5HJCA 5E73A 4TYLA 5E9YA 4YYDA 4CFKA 4O74A 5JWMA 4KV1A 2RNWA 4HBVA 4YBTA 5HFRA 4O7FA 2DKWA 5CQ3A 4OGIA 2L5EA 4WHWA 4CUUA 4TTEA 5C4QA 5DBMA 5EM3A 4CURA 4A9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QNS A;  4LC2 A;  4NR9 A;  4YYK A;  4MR4 A;  5EVA A;  4QEW A;  4Z93 A;  1X0J A;  5F63 A;  4N3W A;  5EPB A;  5HLS A;  4WHU A;  2D82 A;  4IR5 A;  4O76 A;  5A5Q A;  5KTX A;  5CS8 A;  5ACY A;  5KO4 A;  3G0L A;  4QYL A;  3S92 A;  5D3H A;  4QSX A;  5FE7 A;  3NXB A;  4C66 A;  4QUT A;  2FSA A;  4QR3 A;  5IGM A;  4PCI A;  5EU1 A;  4BJX A;  2DVQ A;  5FE5 A;  4CL9 A;  5CUE A;  4O7C A;  4A9J A;  4C67 A;  5AMF A;  1WUM A;  3K2J A;  2F6N A;  2GRC A;  5CU8 A;  4IR3 A;  5HEL A;  5FE8 A;  4HBY A;  5F1L A;  5EP7 A;  4TS8 A;  3HMH A;  4HXM A;  2RNX A;  4O78 A;  5CQ5 A;  4QY4 A;  5FFY A;  5HCL A;  2KTB B;  4E96 A;  4YAD A;  3U5K A;  2YEK A;  5CZG A;  4BW4 A;  4UIY A;  5FG4 A;  4A9M A;  5HQ5 A;  4QYD A;  1E6I A;  5EIC A;  5A82 A;  3UV2 A;  4XY9 A;  5I88 A;  5KHM A;  5CY9 A;  4NRC A;  5EGU A;  2R10 A;  2DWW A;  3P1C A;  4NS5 A;  5LKX A;  5FE2 A;  3IU5 A;  4IOQ A;  3ONI A;  5E9L A;  4YYG A;  2YDW A;  5D3R A;  4QSV A;  3MUK A;  4KCX A;  4ZC9 A;  4YYN A;  4QSP A;  3P1D A;  4HBW A;  4XYA A;  4YAB A;  4HXK A;  4XUB A;  5FG5 A;  5F3A A;  5J0D A;  5G4S A;  5D3L A;  5IGL A;  3P1F A;  5KTW A;  4HXS A;  4Z1S A;  5E9V A;  5CPE A;  5FE4 A;  5C89 A;  1EQF A;  2RFJ A;  4MR5 A;  3SVG A;  4MEN A;  5II1 A;  2L84 A;  3G0J A;  2MJV B;  4YY6 A;  3LQI A;  2YQD A;  3O33 A;  5EWW A;  4O75 A;  2YEM A;  4MEO A;  4NR8 A;  5C85 A;  4CUS A;  5FBX A;  5I80 A;  4NYW A;  5DX4 A;  4Q0O A;  3DAI A;  2R0Y A;  5IBN A;  4MR6 A;  4AKN A;  4NRB A;  3P5O A;  4LZ2 A;  5CUG A;  4YK0 A;  3RCW A;  5F36 A;  5EI4 A;  3UVW A;  3MXF A;  5CRZ A;  2LSP B;  1ZS5 A;  4OGJ A;  2D9E A;  4O77 A;  5COI A;  4NYV A;  5IGK A;  4LDF A;  4QST A;  5DKD A;  5D7X A;  5CQ8 A;  4CUQ A;  4HXL A;  2NXB A;  5BT3 A;  5HRX A;  3U5M A;  5F61 A;  2YW5 A;  4UYH A;  4YH3 A;  5BT4 A;  5LUU A;  5ENH A;  4CLB A;  4LR6 A;  3U5O A;  5EWH A;  3O35 A;  4TT2 A;  4UIU A;  5FFV A;  4UIW A;  4NUD A;  5CUA A;  5FE9 A;  4O7E A;  5I29 A;  2RNY A;  3UV5 A;  5IG6 A;  3JVJ A;  4QZS A;  5LJ1 A;  5DFB A;  3U5N A;  4MR3 A;  5FH6 A;  3QZV A;  4TU6 A;  5LKT A;  5HRW A;  5CRM A;  5ENG A;  2E7N A;  5ETD A;  5C8G A;  4LZR A;  3AAD A;  5CP5 A;  5FB0 A;  5EV9 A;  3AQA A;  2DAT A;  3UVX A;  4NXJ A;  3MUL A;  5FDZ A;  2WP2 A;  4BW1 A;  5FE0 A;  5LJ2 A;  3IU6 A;  4YY4 A;  5DKH A;  4J0R A;  4YYJ A;  1F68 A;  5DYX A;  4YYH A;  5A81 A;  5IGN A;  3Q2F A;  5F25 A;  4TT6 A;  2OO1 A;  5DLZ A;  4HBX A;  2RI7 A;  2OUO A;  2E3K A;  4HXR A;  5ETB A;  5EQ1 A;  5E9K A;  3Q2E A;  5FE3 A;  3MB3 A;  5EA1 A;  4ALH A;  5L97 A;  4YAX A;  5DW2 A;  5E9M A;  5D3P A;  5LJ0 A;  4ZW1 A;  2YEL A;  5D0C A;  4PY6 A;  3I3J A;  3S91 A;  3O34 A;  3P1E A;  4QBM A;  3O37 A;  4CUP A;  5FB1 A;  3HMF A;  5FH7 A;  4LYI A;  5EIS A;  1N72 A;  5BT5 A;  5E9I A;  4DON A;  4BW2 A;  2I7K A;  4NR4 A;  5DFD A;  2OSS A;  2R0S A;  5I86 A;  3JVL A;  3SVF A;  3QZS A;  5H85 A;  5EWV A;  5TCM A;  4QSU A;  4IR4 A;  4A9H A;  3MQM A;  5A5N A;  5L98 A;  5E3D A;  4TQN A;  4N4H A;  3FKM X;  5CUC A;  4Q0N A;  5D26 A;  4J1P A;  5CTL A;  4NUE A;  5EWD A;  3O36 A;  2I8N A;  4N4G A;  4NR6 A;  5CQ4 A;  4QC3 A;  4TZ2 A;  3UW9 A;  4Z1Q A;  5CQ7 A;  5F60 A;  2DVV A;  4IR6 A;  4UIV A;  5II2 A;  5ENE A;  5LVR A;  5A85 A;  5L8T A;  4QSR A;  5A5R A;  4WIV A;  4PCE A;  4A9L A;  3LJW A;  4ZQL A;  5D24 A;  5CQ6 A;  3LXJ A;  5HQ7 A;  4X2I A;  4A9O A;  4LZS A;  5DYU A;  5A5S A;  4QEU A;  4NR7 A;  5F5Z A;  4QSS A;  3UVD A;  5A7C A;  4NR5 A;  5DYC A;  4NYX A;  4IOR A;  4UIX A;  5ENC A;  4QR4 A;  5IID A;  4O7A A;  5DFC A;  5EK9 A;  4YAT A;  5D25 A;  5H1U A;  4QB3 A;  4UYE A;  5HEM A;  5I89 A;  4PS5 A;  5A83 A;  5A5O A;  3UV4 A;  4UYD A;  5AD3 A;  2DVS A;  5FE6 A;  5F2P A;  4A9E A;  5AME A;  4UIT A;  4HXO A;  4LYW A;  2RS9 B;  4TU4 A;  5ENJ A;  5L96 A;  4TT4 A;  5EPS A;  3U5J A;  4RVR A;  5DYA A;  5CGP A;  4IOO A;  3JVM A;  4HXP A;  4UYF A;  4LRG A;  5CUB A;  3U5L A;  5I83 A;  5LVQ A;  5ENB A;  5C7N A;  5TB6 A;  3UVY A;  5DW1 A;  5FG6 A;  2L85 A;  4YC9 A;  4O70 A;  4BW3 A;  5HEN A;  4NRA A;  4FLP A;  5L99 A;  4OUF A;  5E0R A;  5E7D A;  5CQT A;  4YYM A;  5F1H A;  4YH4 A;  5I40 A;  4YBS A;  4QC1 A;  2YYN A;  5I7X A;  1JSP B;  4NUC A;  4QSW A;  3LQH A;  4CFL A;  4QEV A;  5DY7 A;  5K29 A;  4PTB A;  3TLP A;  5E3G A;  5G4R A;  5LKZ A;  5FFW A;  4TZ8 A;  4YYI A;  2RO1 A;  5F62 A;  5I7Y A;  3HME A;  3LQJ A;  5EWC A;  4QR5 A;  4QSQ A;  4O72 A;  4LYS A;  5FE1 A;  5H1T A;  4A9F A;  4YBM A;  5E74 A;  4NQM A;  1WUG A;  5L8U A;  4UYF B;  3D7C A;  5A5P A;  2H60 A;  5FH8 A;  5HRV A;  3ZYU A;  3U5P A;  4J0S A;  5ENI A;  5CUD A;  4ALG A;  2E7O A;  2G4A A;  4F3I A;  4UIZ A;  4PKL A;  5HFQ A;  4BHW A;  5D3N A;  4KV4 A;  4Z6I A;  4N4F A;  5DKC A;  2F6J A;  5I1Q A;  5ENF A;  3SVH A;  5KU3 A;  4Z6H A;  4CUT A;  4GPJ A;  2WP1 A;  5HM0 A;  1JM4 B;  4O71 A;  5AD2 A;  3DWY A;  5D3T A;  3QZT A;  4O7B A;  5C87 A;  2R0V A;  2N9G A;  3JVK A;  5CFW A;  5DLX A;  4UYG A;  4MEQ A;  4XUA A;  5D3S A;  4QUU A;  5LKU A;  4Y03 A;  5D3J A;  4A9N A;  5EPR A;  3MB4 A;  3GG3 A;  4XY8 A;  4N4I A;  5H1V A;  4J3I A;  5CQA A;  5KTU A;  4NQN A;  5JI8 A;  2DVR A;  5HQ6 A;  4HXN A;  4A9I A;  4MEP A;  5HJC A;  5E73 A;  4TYL A;  5E9Y A;  4YYD A;  4CFK A;  4O74 A;  5JWM A;  4KV1 A;  2RNW A;  4HBV A;  4YBT A;  5HFR A;  4O7F A;  2DKW A;  5CQ3 A;  4OGI A;  2L5E A;  4WHW A;  4CUU A;  4TTE A;  5C4Q A;  5DBM A;  5EM3 A;  4CUR A;  4A9K A; 
#chains in the Genus database with same CATH topology
 4QNS A;  4LC2 A;  4NR9 A;  4YYK A;  4MR4 A;  5EVA A;  4QEW A;  3D1D A;  1X0J A;  4Z93 A;  5F63 A;  4N3W A;  5EPB A;  5HLS A;  4WHU A;  2D82 A;  4IR5 A;  4O76 A;  5A5Q A;  5KTX A;  5CS8 A;  5ACY A;  5KO4 A;  3G0L A;  4QYL A;  3S92 A;  5D3H A;  4QSX A;  5FE7 A;  3NXB A;  4C66 A;  4QUT A;  2FSA A;  4QR3 A;  5IGM A;  4PCI A;  5EU1 A;  4BJX A;  2DVQ A;  3VKH A;  5FE5 A;  4CL9 A;  2EJN A;  5CUE A;  4O7C A;  4A9J A;  4C67 A;  5AMF A;  1WUM A;  3K2J A;  2F6N A;  2GRC A;  5CU8 A;  4IR3 A;  5HEL A;  5FE8 A;  4HBY A;  5F1L A;  5EP7 A;  4TS8 A;  3HMH A;  4HXM A;  2RNX A;  4O78 A;  5CQ5 A;  4QY4 A;  5FFY A;  5HCL A;  2KTB B;  4E96 A;  4YAD A;  3U5K A;  2YEK A;  5CZG A;  4BW4 A;  4UIY A;  5FG4 A;  4A9M A;  5HQ5 A;  4QYD A;  1E6I A;  5EIC A;  5A82 A;  3UV2 A;  4XY9 A;  5I88 A;  5KHM A;  5CY9 A;  4NRC A;  5EGU A;  2R10 A;  2DWW A;  3P1C A;  4NS5 A;  5LKX A;  5FE2 A;  3IU5 A;  4IOQ A;  3ONI A;  5E9L A;  4YYG A;  2YDW A;  5D3R A;  4QSV A;  3MUK A;  4KCX A;  4ZC9 A;  4YYN A;  4QSP A;  3P1D A;  4HBW A;  4XYA A;  4YAB A;  4HXK A;  4XUB A;  5FG5 A;  5F3A A;  3ERR A;  5J0D A;  5G4S A;  5D3L A;  5IGL A;  3P1F A;  5KTW A;  4HXS A;  4Z1S A;  5E9V A;  5CPE A;  5FE4 A;  5C89 A;  1EQF A;  2RFJ A;  4MR5 A;  3SVG A;  4MEN A;  5II1 A;  2L84 A;  3G0J A;  2MJV B;  4YY6 A;  3LQI A;  2YQD A;  3O33 A;  5EWW A;  4O75 A;  2YEM A;  4MEO A;  4NR8 A;  5C85 A;  4CUS A;  5FBX A;  5I80 A;  4NYW A;  5DX4 A;  4Q0O A;  3DAI A;  2R0Y A;  4AI6 A;  5IBN A;  4MR6 A;  4AKN A;  4NRB A;  3P5O A;  4LZ2 A;  5CUG A;  4YK0 A;  3RCW A;  5F36 A;  5EI4 A;  3UVW A;  3MXF A;  5CRZ A;  2LSP B;  1ZS5 A;  4OGJ A;  2D9E A;  4O77 A;  5COI A;  4NYV A;  5IGK A;  4LDF A;  4QST A;  5DKD A;  5D7X A;  5CQ8 A;  4CUQ A;  4HXL A;  2NXB A;  5BT3 A;  5HRX A;  3U5M A;  5F61 A;  2YW5 A;  4UYH A;  4YH3 A;  5BT4 A;  5LUU A;  5ENH A;  4CLB A;  4LR6 A;  3U5O A;  5EWH A;  3O35 A;  4TT2 A;  4UIU A;  5FFV A;  4UIW A;  4NUD A;  5CUA A;  5FE9 A;  4O7E A;  5I29 A;  2RNY A;  3UV5 A;  5IG6 A;  3JVJ A;  4QZS A;  5LJ1 A;  5DFB A;  3U5N A;  4MR3 A;  5FH6 A;  3QZV A;  4TU6 A;  5LKT A;  5HRW A;  5CRM A;  5ENG A;  2E7N A;  5ETD A;  5C8G A;  4LZR A;  3AAD A;  5CP5 A;  5FB0 A;  5EV9 A;  3AQA A;  2DAT A;  3UVX A;  4NXJ A;  3MUL A;  5FDZ A;  2WP2 A;  4BW1 A;  5FE0 A;  5LJ2 A;  3IU6 A;  4YY4 A;  5DKH A;  4J0R A;  4YYJ A;  1F68 A;  5DYX A;  4YYH A;  5A81 A;  5IGN A;  3Q2F A;  5F25 A;  4TT6 A;  2OO1 A;  5DLZ A;  4HBX A;  2RI7 A;  2OUO A;  2E3K A;  4HXR A;  5ETB A;  5EQ1 A;  5E9K A;  3Q2E A;  5FE3 A;  3MB3 A;  5EA1 A;  4ALH A;  5L97 A;  4YAX A;  5DW2 A;  5E9M A;  5D3P A;  5LJ0 A;  4ZW1 A;  2YEL A;  5D0C A;  4AKG A;  4PY6 A;  3I3J A;  3S91 A;  3O34 A;  3P1E A;  4QBM A;  3O37 A;  4CUP A;  5FB1 A;  3HMF A;  5FH7 A;  4LYI A;  5EIS A;  1N72 A;  5BT5 A;  5E9I A;  4DON A;  4BW2 A;  2I7K A;  4NR4 A;  5DFD A;  2OSS A;  2R0S A;  5I86 A;  3JVL A;  3SVF A;  3QZS A;  5H85 A;  5EWV A;  5TCM A;  4QSU A;  4IR4 A;  4A9H A;  3MQM A;  5A5N A;  5L98 A;  5E3D A;  4TQN A;  4N4H A;  3FKM X;  5CUC A;  4Q0N A;  5D26 A;  4J1P A;  5CTL A;  4NUE A;  5EWD A;  3O36 A;  2I8N A;  4N4G A;  4NR6 A;  5CQ4 A;  4QC3 A;  4TZ2 A;  3UW9 A;  4Z1Q A;  5CQ7 A;  5F60 A;  2DVV A;  4IR6 A;  4UIV A;  5II2 A;  5ENE A;  5LVR A;  1ZKR A;  5A85 A;  5L8T A;  4QSR A;  5A5R A;  4WIV A;  4PCE A;  4A9L A;  3LJW A;  4ZQL A;  5D24 A;  5CQ6 A;  3LXJ A;  5HQ7 A;  4X2I A;  4A9O A;  4LZS A;  5DYU A;  5A5S A;  4QEU A;  4NR7 A;  5F5Z A;  4QSS A;  3UVD A;  5A7C A;  4NR5 A;  5DYC A;  4NYX A;  4IOR A;  4UIX A;  1PUO A;  5ENC A;  4QR4 A;  5IID A;  4O7A A;  5DFC A;  5EK9 A;  4YAT A;  5D25 A;  5H1U A;  4QB3 A;  4UYE A;  5HEM A;  5I89 A;  4PS5 A;  5A83 A;  5A5O A;  3UV4 A;  4UYD A;  5AD3 A;  2DVS A;  5FE6 A;  5F2P A;  4A9E A;  5AME A;  4UIT A;  4HXO A;  4LYW A;  2RS9 B;  4TU4 A;  5ENJ A;  5L96 A;  4TT4 A;  5EPS A;  3U5J A;  4RVR A;  5DYA A;  5CGP A;  4IOO A;  3JVM A;  4HXP A;  4UYF A;  4LRG A;  5CUB A;  3U5L A;  5I83 A;  5LVQ A;  5ENB A;  5C7N A;  5TB6 A;  3UVY A;  5DW1 A;  5FG6 A;  2L85 A;  4YC9 A;  4O70 A;  4BW3 A;  5HEN A;  4NRA A;  4FLP A;  5L99 A;  4OUF A;  5E0R A;  5E7D A;  5CQT A;  4YYM A;  5F1H A;  4YH4 A;  5I40 A;  4YBS A;  4QC1 A;  2YYN A;  5I7X A;  1JSP B;  4NUC A;  4QSW A;  3LQH A;  4CFL A;  4QEV A;  5DY7 A;  5K29 A;  4PTB A;  3TLP A;  5E3G A;  5G4R A;  5LKZ A;  5FFW A;  4TZ8 A;  4YYI A;  2RO1 A;  5F62 A;  5I7Y A;  3HME A;  3LQJ A;  5EWC A;  4QR5 A;  4QSQ A;  4O72 A;  4LYS A;  5FE1 A;  5H1T A;  4A9F A;  4YBM A;  5E74 A;  4NQM A;  1WUG A;  5L8U A;  4UYF B;  3D7C A;  5A5P A;  2H60 A;  5FH8 A;  5HRV A;  3ZYU A;  3U5P A;  4J0S A;  5ENI A;  5CUD A;  4ALG A;  2E7O A;  2G4A A;  4F3I A;  4UIZ A;  4PKL A;  5HFQ A;  4BHW A;  5D3N A;  4KV4 A;  4Z6I A;  4N4F A;  5DKC A;  2F6J A;  5I1Q A;  5ENF A;  3SVH A;  5KU3 A;  4Z6H A;  4CUT A;  4GPJ A;  2WP1 A;  5HM0 A;  1JM4 B;  4O71 A;  5AD2 A;  3DWY A;  5D3T A;  3QZT A;  4O7B A;  5C87 A;  2R0V A;  2N9G A;  3JVK A;  5CFW A;  4AKH A;  5DLX A;  4UYG A;  4MEQ A;  4XUA A;  5D3S A;  4QUU A;  5LKU A;  3D1B A;  4Y03 A;  4AKI A;  5D3J A;  4A9N A;  5EPR A;  3VKG A;  3MB4 A;  3GG3 A;  4XY8 A;  4N4I A;  5H1V A;  4J3I A;  5CQA A;  5KTU A;  4NQN A;  5JI8 A;  2DVR A;  5HQ6 A;  4HXN A;  4A9I A;  4MEP A;  5HJC A;  5E73 A;  4TYL A;  5E9Y A;  4YYD A;  4CFK A;  4O74 A;  5JWM A;  4KV1 A;  2RNW A;  4HBV A;  4YBT A;  5HFR A;  4O7F A;  2DKW A;  5CQ3 A;  4OGI A;  2L5E A;  4WHW A;  4CUU A;  4TTE A;  5C4Q A;  5DBM A;  5EM3 A;  4CUR A;  4A9K A; 
#chains in the Genus database with same CATH homology
 4QNS A;  4LC2 A;  4NR9 A;  4YYK A;  4MR4 A;  5EVA A;  4QEW A;  4Z93 A;  1X0J A;  5F63 A;  4N3W A;  5EPB A;  5HLS A;  4WHU A;  2D82 A;  4IR5 A;  4O76 A;  5A5Q A;  5KTX A;  5CS8 A;  5ACY A;  5KO4 A;  3G0L A;  4QYL A;  3S92 A;  5D3H A;  4QSX A;  5FE7 A;  3NXB A;  4C66 A;  4QUT A;  2FSA A;  4QR3 A;  5IGM A;  4PCI A;  5EU1 A;  4BJX A;  2DVQ A;  5FE5 A;  4CL9 A;  5CUE A;  4O7C A;  4A9J A;  4C67 A;  5AMF A;  1WUM A;  3K2J A;  2F6N A;  2GRC A;  5CU8 A;  4IR3 A;  5HEL A;  5FE8 A;  4HBY A;  5F1L A;  5EP7 A;  4TS8 A;  3HMH A;  4HXM A;  2RNX A;  4O78 A;  5CQ5 A;  4QY4 A;  5FFY A;  5HCL A;  2KTB B;  4E96 A;  4YAD A;  3U5K A;  2YEK A;  5CZG A;  4BW4 A;  4UIY A;  5FG4 A;  4A9M A;  5HQ5 A;  4QYD A;  1E6I A;  5EIC A;  5A82 A;  3UV2 A;  4XY9 A;  5I88 A;  5KHM A;  5CY9 A;  4NRC A;  5EGU A;  2R10 A;  2DWW A;  3P1C A;  4NS5 A;  5LKX A;  5FE2 A;  3IU5 A;  4IOQ A;  3ONI A;  5E9L A;  4YYG A;  2YDW A;  5D3R A;  4QSV A;  3MUK A;  4KCX A;  4ZC9 A;  4YYN A;  4QSP A;  3P1D A;  4HBW A;  4XYA A;  4YAB A;  4HXK A;  4XUB A;  5FG5 A;  5F3A A;  5J0D A;  5G4S A;  5D3L A;  5IGL A;  3P1F A;  5KTW A;  4HXS A;  4Z1S A;  5E9V A;  5CPE A;  5FE4 A;  5C89 A;  1EQF A;  2RFJ A;  4MR5 A;  3SVG A;  4MEN A;  5II1 A;  2L84 A;  3G0J A;  2MJV B;  4YY6 A;  3LQI A;  2YQD A;  3O33 A;  5EWW A;  4O75 A;  2YEM A;  4MEO A;  4NR8 A;  5C85 A;  4CUS A;  5FBX A;  5I80 A;  4NYW A;  5DX4 A;  4Q0O A;  3DAI A;  2R0Y A;  5IBN A;  4MR6 A;  4AKN A;  4NRB A;  3P5O A;  4LZ2 A;  5CUG A;  4YK0 A;  3RCW A;  5F36 A;  5EI4 A;  3UVW A;  3MXF A;  5CRZ A;  2LSP B;  1ZS5 A;  4OGJ A;  2D9E A;  4O77 A;  5COI A;  4NYV A;  5IGK A;  4LDF A;  4QST A;  5DKD A;  5D7X A;  5CQ8 A;  4CUQ A;  4HXL A;  2NXB A;  5BT3 A;  5HRX A;  3U5M A;  5F61 A;  2YW5 A;  4UYH A;  4YH3 A;  5BT4 A;  5LUU A;  5ENH A;  4CLB A;  4LR6 A;  3U5O A;  5EWH A;  3O35 A;  4TT2 A;  4UIU A;  5FFV A;  4UIW A;  4NUD A;  5CUA A;  5FE9 A;  4O7E A;  5I29 A;  2RNY A;  3UV5 A;  5IG6 A;  3JVJ A;  4QZS A;  5LJ1 A;  5DFB A;  3U5N A;  4MR3 A;  5FH6 A;  3QZV A;  4TU6 A;  5LKT A;  5HRW A;  5CRM A;  5ENG A;  2E7N A;  5ETD A;  5C8G A;  4LZR A;  3AAD A;  5CP5 A;  5FB0 A;  5EV9 A;  3AQA A;  2DAT A;  3UVX A;  4NXJ A;  3MUL A;  5FDZ A;  2WP2 A;  4BW1 A;  5FE0 A;  5LJ2 A;  3IU6 A;  4YY4 A;  5DKH A;  4J0R A;  4YYJ A;  1F68 A;  5DYX A;  4YYH A;  5A81 A;  5IGN A;  3Q2F A;  5F25 A;  4TT6 A;  2OO1 A;  5DLZ A;  4HBX A;  2RI7 A;  2OUO A;  2E3K A;  4HXR A;  5ETB A;  5EQ1 A;  5E9K A;  3Q2E A;  5FE3 A;  3MB3 A;  5EA1 A;  4ALH A;  5L97 A;  4YAX A;  5DW2 A;  5E9M A;  5D3P A;  5LJ0 A;  4ZW1 A;  2YEL A;  5D0C A;  4PY6 A;  3I3J A;  3S91 A;  3O34 A;  3P1E A;  4QBM A;  3O37 A;  4CUP A;  5FB1 A;  3HMF A;  5FH7 A;  4LYI A;  5EIS A;  1N72 A;  5BT5 A;  5E9I A;  4DON A;  4BW2 A;  2I7K A;  4NR4 A;  5DFD A;  2OSS A;  2R0S A;  5I86 A;  3JVL A;  3SVF A;  3QZS A;  5H85 A;  5EWV A;  5TCM A;  4QSU A;  4IR4 A;  4A9H A;  3MQM A;  5A5N A;  5L98 A;  5E3D A;  4TQN A;  4N4H A;  3FKM X;  5CUC A;  4Q0N A;  5D26 A;  4J1P A;  5CTL A;  4NUE A;  5EWD A;  3O36 A;  2I8N A;  4N4G A;  4NR6 A;  5CQ4 A;  4QC3 A;  4TZ2 A;  3UW9 A;  4Z1Q A;  5CQ7 A;  5F60 A;  2DVV A;  4IR6 A;  4UIV A;  5II2 A;  5ENE A;  5LVR A;  5A85 A;  5L8T A;  4QSR A;  5A5R A;  4WIV A;  4PCE A;  4A9L A;  3LJW A;  4ZQL A;  5D24 A;  5CQ6 A;  3LXJ A;  5HQ7 A;  4X2I A;  4A9O A;  4LZS A;  5DYU A;  5A5S A;  4QEU A;  4NR7 A;  5F5Z A;  4QSS A;  3UVD A;  5A7C A;  4NR5 A;  5DYC A;  4NYX A;  4IOR A;  4UIX A;  5ENC A;  4QR4 A;  5IID A;  4O7A A;  5DFC A;  5EK9 A;  4YAT A;  5D25 A;  5H1U A;  4QB3 A;  4UYE A;  5HEM A;  5I89 A;  4PS5 A;  5A83 A;  5A5O A;  3UV4 A;  4UYD A;  5AD3 A;  2DVS A;  5FE6 A;  5F2P A;  4A9E A;  5AME A;  4UIT A;  4HXO A;  4LYW A;  2RS9 B;  4TU4 A;  5ENJ A;  5L96 A;  4TT4 A;  5EPS A;  3U5J A;  4RVR A;  5DYA A;  5CGP A;  4IOO A;  3JVM A;  4HXP A;  4UYF A;  4LRG A;  5CUB A;  3U5L A;  5I83 A;  5LVQ A;  5ENB A;  5C7N A;  5TB6 A;  3UVY A;  5DW1 A;  5FG6 A;  2L85 A;  4YC9 A;  4O70 A;  4BW3 A;  5HEN A;  4NRA A;  4FLP A;  5L99 A;  4OUF A;  5E0R A;  5E7D A;  5CQT A;  4YYM A;  5F1H A;  4YH4 A;  5I40 A;  4YBS A;  4QC1 A;  2YYN A;  5I7X A;  1JSP B;  4NUC A;  4QSW A;  3LQH A;  4CFL A;  4QEV A;  5DY7 A;  5K29 A;  4PTB A;  3TLP A;  5E3G A;  5G4R A;  5LKZ A;  5FFW A;  4TZ8 A;  4YYI A;  2RO1 A;  5F62 A;  5I7Y A;  3HME A;  3LQJ A;  5EWC A;  4QR5 A;  4QSQ A;  4O72 A;  4LYS A;  5FE1 A;  5H1T A;  4A9F A;  4YBM A;  5E74 A;  4NQM A;  1WUG A;  5L8U A;  4UYF B;  3D7C A;  5A5P A;  2H60 A;  5FH8 A;  5HRV A;  3ZYU A;  3U5P A;  4J0S A;  5ENI A;  5CUD A;  4ALG A;  2E7O A;  2G4A A;  4F3I A;  4UIZ A;  4PKL A;  5HFQ A;  4BHW A;  5D3N A;  4KV4 A;  4Z6I A;  4N4F A;  5DKC A;  2F6J A;  5I1Q A;  5ENF A;  3SVH A;  5KU3 A;  4Z6H A;  4CUT A;  4GPJ A;  2WP1 A;  5HM0 A;  1JM4 B;  4O71 A;  5AD2 A;  3DWY A;  5D3T A;  3QZT A;  4O7B A;  5C87 A;  2R0V A;  2N9G A;  3JVK A;  5CFW A;  5DLX A;  4UYG A;  4MEQ A;  4XUA A;  5D3S A;  4QUU A;  5LKU A;  4Y03 A;  5D3J A;  4A9N A;  5EPR A;  3MB4 A;  3GG3 A;  4XY8 A;  4N4I A;  5H1V A;  4J3I A;  5CQA A;  5KTU A;  4NQN A;  5JI8 A;  2DVR A;  5HQ6 A;  4HXN A;  4A9I A;  4MEP A;  5HJC A;  5E73 A;  4TYL A;  5E9Y A;  4YYD A;  4CFK A;  4O74 A;  5JWM A;  4KV1 A;  2RNW A;  4HBV A;  4YBT A;  5HFR A;  4O7F A;  2DKW A;  5CQ3 A;  4OGI A;  2L5E A;  4WHW A;  4CUU A;  4TTE A;  5C4Q A;  5DBM A;  5EM3 A;  4CUR A;  4A9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...