2YQDA

Solution structure of the fifth bromodomain from mouse polybromo-1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
120
structure length
120
Chain Sequence
b'GSSGSSGKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYBROMO-1
publication title Solution structure of the fifth bromodomain from mouse polybromo-1
rcsb
source organism Mus musculus
molecule tags Gene regulation
total genus 29
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2yqdA00
5HLSA 4YBTA 3S92A 5C89A 4J1PA 3HMEA 3O33A 5F1HA 4UIYA 3G0JA 5A5PA 2RNXA 5L8TA 4GPJA 5DLXA 5D3LA 5EA1A 2R0YA 5CFWA 4OUFA 2RNYA 3AQAA 5BT5A 2WP1A 5EGUA 3O37A 4MEOA 4NR4A 4QUUA 5CRMA 5E3DA 4Z1SA 2DWWA 2LSPB 5IGNA 2DVRA 4J3IA 4NYXA 5II1A 5I40A 3QZTA 5DKDA 4BHWA 4HXLA 4XY9A 4PTBA 4YBMA 5E9LA 3JVJA 4IORA 2YELA 3HMFA 4YH4A 2DATA 4QSVA 4N4GA 5FFYA 5CPEA 3O36A 5ETBA 5TB6A 2WP2A 5F25A 5ENCA 3SVHA 4TT4A 5E0RA 5FH8A 3U5NA 5EP7A 5EISA 3MB3A 4TYLA 2G4AA 4NR7A 5ETDA 4O7FA 2RS9B 5DFCA 4UIWA 3U5JA 5CUAA 3IU5A 5LJ1A 3UV2A 3P1EA 5D0CA 2F6NA 4C67A 5CGPA 4YYHA 5EWDA 4A9EA 5DYAA 5FFVA 4YYMA 4TTEA 5F3AA 5LKTA 5L8UA 3GG3A 5D24A 5FE3A 5I1QA 5EWHA 3SVFA 5D3RA 5I7XA 4IR3A 4QSXA 5EK9A 2FSAA 2YQDA 4HBXA 5E9YA 5EICA 4LRGA 4LZSA 4J0RA 4CURA 4YYDA 4QYLA 4O71A 2R0VA 4HXNA 2DVSA 5EWWA 5DW1A 4YK0A 5IIDA 5I29A 4IR6A 5CQTA 5A81A 3SVGA 5E7DA 3UVDA 5D3SA 5HRVA 4N4HA 5CQ8A 5J0DA 5F62A 5ENEA 4F3IA 4KV4A 4YAXA 4KCXA 5A83A 5ENFA 2OUOA 4YYKA 4PS5A 3UV4A 2D9EA 4QUTA 4IR4A 4O7CA 5EPRA 5A85A 5IBNA 1ZS5A 5KTXA 5DYCA 4YYIA 2RI7A 4ALHA 5G4RA 5EWCA 5FE5A 5EU1A 1JM4B 5DKCA 4YYNA 5C8GA 3P1FA 4Q0OA 4E96A 4NR5A 5HCLA 5C7NA 3DAIA 5CTLA 5ENGA 5DLZA 5II2A 4DONA 3UVXA 1WUGA 4HXSA 4XUAA 5CUGA 4TU4A 5CUEA 5DBMA 4A9HA 5COIA 4A9KA 5F5ZA 4LYWA 4HXOA 5FDZA 4BW2A 4LZRA 5FE7A 4HXPA 4O7BA 3G0LA 2RO1A 5CUBA 4LYIA 2OSSA 4NR8A 5H1UA 4IOQA 5H1VA 4HXRA 2DVVA 3IU6A 4N3WA 4QSTA 4NR6A 5E74A 4PKLA 4YY4A 1JSPB 5HENA 4O77A 4MR4A 2L84A 5JI8A 5E9KA 5DKHA 5D26A 2YW5A 5A7CA 5KO4A 4HXMA 4O78A 4UIXA 5ENBA 3P1CA 2DVQA 5LUUA 5CQAA 5L96A 4LR6A 4NS5A 4ZQLA 3U5LA 5CU8A 3NXBA 1E6IA 4BW3A 1F68A 4UYGA 2F6JA 4A9LA 4XYAA 5KU3A 4TT2A 5CQ6A 5C4QA 4XY8A 2RFJA 5EVAA 5DW2A 4CUSA 5CUCA 4C66A 3MULA 4UIZA 1EQFA 4UYDA 5DFBA 4NUCA 4NQNA 5FH7A 5LKZA 4XUBA 4CUQA 5H1TA 5CQ3A 5HEMA 4IR5A 4UYFB 4N4IA 5FFWA 3O35A 5AMFA 3FKMX 2N9GA 4MR3A 3RCWA 4ZC9A 4NQMA 5EI4A 4YBSA 5KTWA 4TZ2A 5FH6A 4CFKA 4YC9A 5BT3A 5CQ5A 2YDWA 3QZSA 4WHWA 2MJVB 5FE6A 3LJWA 5LVQA 3P5OA 2L5EA 4MENA 4MR5A 4CUTA 3MQMA 5IGKA 2NXBA 3MXFA 3P1DA 4CUUA 5LVRA 5HJCA 4PCIA 1N72A 4NXJA 2I7KA 2KTBB 4YADA 2E7OA 4N4FA 3TLPA 4ZW1A 4QEWA 4YH3A 2YEMA 4X2IA 4YYJA 5F1LA 5IGLA 4OGIA 4QSQA 5TCMA 4NRBA 4A9NA 5C87A 4NRAA 3U5OA 5CRZA 4UIUA 5LKXA 5FB0A 4NRCA 4UIVA 5BT4A 3UV5A 4O70A 5ENJA 5F2PA 4LC2A 4QR4A 5DYXA 5EPBA 5EWVA 5I83A 4QYDA 4ALGA 5HFQA 5E9VA 4QC3A 3JVLA 5F61A 4TQNA 2YYNA 5IGMA 5A5SA 4CFLA 5E73A 3UW9A 5CQ4A 3LQJA 5C85A 2RNWA 5ENHA 4HXKA 3LXJA 3S91A 5A5OA 5A5RA 3I3JA 4NYVA 5I80A 5I86A 3UVYA 4Q0NA 5LJ2A 5L98A 4IOOA 3UVWA 4FLPA 5HRWA 5FE9A 2R0SA 2E3KA 4WIVA 5CP5A 5FG6A 4MEPA 5JWMA 4A9FA 5HFRA 5F60A 4QSRA 4HBVA 4WHUA 4NUDA 3QZVA 5I89A 4Z6HA 4Z6IA 5F36A 5EV9A 4KV1A 5D3HA 4UYEA 5D25A 4QEUA 4UITA 5ENIA 4UYHA 5L97A 5G4SA 4RVRA 5HQ6A 4J0SA 4QY4A 5AMEA 4Z1QA 5HQ7A 4LDFA 5E9IA 4HBYA 3K2JA 5DYUA 5FG4A 4NR9A 4YY6A 3U5MA 5FE8A 4YABA 4QB3A 4QR5A 5KHMA 4QSWA 2DKWA 5I88A 2YEKA 5EPSA 4CLBA 5E3GA 4TT6A 4BW1A 5D7XA 3MB4A 2H60A 4HBWA 5L99A 2I8NA 3Q2FA 3U5KA 4Z93A 3LQHA 5CS8A 4QR3A 4QSUA 4LZ2A 5CY9A 4MEQA 3HMHA 5EM3A 5K29A 3MUKA 4AKNA 5A5QA 4PY6A 4O76A 4TU6A 2D82A 4O72A 5D3PA 5A5NA 4NUEA 5ACYA 4O7EA 3U5PA 4NYWA 5AD2A 3DWYA 5CUDA 3JVKA 5LKUA 3D7CA 4QNSA 3LQIA 4BW4A 5FB1A 5AD3A 5FE0A 4YYGA 3JVMA 5EQ1A 5FBXA 5IG6A 5D3NA 3ZYUA 5E9MA 5H85A 5CQ7A 4QBMA 4QEVA 5D3JA 4A9MA 5A82A 3O34A 5DFDA 5CZGA 3AADA 4TZ8A 4TS8A 4OGJA 4O75A 5HQ5A 4Y03A 5LJ0A 5FE1A 1WUMA 4QZSA 5F63A 4QC1A 2R10A 4O7AA 4CL9A 5FE4A 4CUPA 4A9JA 5D3TA 5HELA 4A9OA 4PCEA 5FE2A 2E7NA 2OO1A 4UYFA 5DY7A 5KTUA 5HRXA 1X0JA 5FG5A 5DX4A 4A9IA 2L85A 5I7YA 3ONIA 2GRCA 4MR6A 4YATA 5HM0A 4O74A 3Q2EA 4QSSA 4BJXA 4QSPA 4LYSA
chains in the Genus database with same CATH superfamily
5HLSA 4YBTA 3S92A 5C89A 4J1PA 3HMEA 3O33A 5F1HA 4UIYA 3G0JA 5A5PA 2RNXA 5L8TA 4GPJA 5DLXA 5D3LA 5EA1A 2R0YA 5CFWA 4OUFA 3AQAA 2RNYA 5BT5A 2WP1A 5EGUA 3O37A 4MEOA 4NR4A 4QUUA 5CRMA 5E3DA 4Z1SA 2DWWA 2LSPB 5IGNA 2DVRA 4J3IA 4NYXA 5II1A 5I40A 3QZTA 5DKDA 4BHWA 4HXLA 4XY9A 4PTBA 4YBMA 5E9LA 3JVJA 4IORA 2YELA 3HMFA 4YH4A 2DATA 4QSVA 4N4GA 5FFYA 5CPEA 3O36A 5ETBA 5TB6A 2WP2A 5F25A 5ENCA 3SVHA 4TT4A 5E0RA 5FH8A 3U5NA 5EP7A 5EISA 3MB3A 4TYLA 2G4AA 4NR7A 5ETDA 4O7FA 2RS9B 4UIWA 5DFCA 3U5JA 5CUAA 3IU5A 5LJ1A 3UV2A 3P1EA 5D0CA 2F6NA 4C67A 5CGPA 4YYHA 5EWDA 4A9EA 5DYAA 5FFVA 4YYMA 4TTEA 5F3AA 5LKTA 5L8UA 3GG3A 5D24A 5FE3A 5I1QA 5EWHA 3SVFA 5D3RA 5I7XA 4IR3A 4QSXA 5EK9A 2FSAA 2YQDA 4HBXA 5E9YA 5EICA 4LRGA 4LZSA 4J0RA 4CURA 4YYDA 4QYLA 4O71A 3VKGA 2R0VA 4HXNA 2DVSA 5EWWA 5DW1A 4YK0A 5IIDA 5I29A 4IR6A 5CQTA 5A81A 3SVGA 5E7DA 3UVDA 5D3SA 5HRVA 4N4HA 5CQ8A 5J0DA 5F62A 5ENEA 4F3IA 4KV4A 4YAXA 4KCXA 5A83A 5ENFA 2OUOA 4YYKA 4PS5A 3UV4A 2D9EA 4QUTA 4IR4A 4O7CA 5EPRA 5A85A 5IBNA 1ZS5A 5KTXA 5DYCA 4YYIA 2RI7A 4ALHA 5G4RA 5EWCA 5FE5A 5EU1A 1JM4B 5DKCA 4YYNA 5C8GA 3P1FA 4Q0OA 4E96A 4NR5A 5HCLA 5C7NA 3DAIA 5CTLA 5ENGA 5DLZA 5II2A 4DONA 3UVXA 1WUGA 4HXSA 4XUAA 5CUGA 4TU4A 5CUEA 5DBMA 4A9HA 5COIA 4A9KA 5F5ZA 4LYWA 4HXOA 5FDZA 4BW2A 4LZRA 5FE7A 4HXPA 4O7BA 3G0LA 2RO1A 1ZKRA 5CUBA 4LYIA 2OSSA 4NR8A 5H1UA 4IOQA 5H1VA 4HXRA 2DVVA 3IU6A 4N3WA 4QSTA 4NR6A 5E74A 4PKLA 4YY4A 1JSPB 5HENA 4O77A 4MR4A 2L84A 5JI8A 5E9KA 5DKHA 5D26A 2YW5A 5A7CA 5KO4A 4HXMA 4O78A 4UIXA 5ENBA 3P1CA 2DVQA 5LUUA 5CQAA 5L96A 4LR6A 4NS5A 4ZQLA 3U5LA 5CU8A 3NXBA 1E6IA 4BW3A 1F68A 4UYGA 2F6JA 4A9LA 4XYAA 5KU3A 4TT2A 5CQ6A 5C4QA 4XY8A 2RFJA 5EVAA 5DW2A 4CUSA 5CUCA 4C66A 3MULA 4UIZA 1EQFA 4UYDA 5DFBA 4NUCA 4NQNA 5FH7A 5LKZA 4XUBA 4CUQA 5H1TA 5CQ3A 5HEMA 4IR5A 4AKGA 4UYFB 4N4IA 5FFWA 3O35A 5AMFA 3FKMX 2N9GA 4MR3A 3RCWA 4ZC9A 4NQMA 5EI4A 4YBSA 5KTWA 4TZ2A 5FH6A 1PUOA 4CFKA 4YC9A 3ERRA 5BT3A 5CQ5A 2YDWA 3QZSA 4WHWA 2MJVB 3D1DA 5FE6A 3LJWA 5LVQA 3P5OA 2L5EA 4MENA 4MR5A 4CUTA 3MQMA 5IGKA 2NXBA 3MXFA 3P1DA 4CUUA 5LVRA 5HJCA 4PCIA 1N72A 4NXJA 2I7KA 2KTBB 4YADA 2E7OA 4N4FA 3TLPA 4ZW1A 4QEWA 4YH3A 2YEMA 4X2IA 4YYJA 5F1LA 5IGLA 4OGIA 4QSQA 5TCMA 4NRBA 4A9NA 5C87A 4NRAA 3U5OA 5CRZA 4UIUA 5LKXA 5FB0A 4NRCA 4UIVA 3D1BA 5BT4A 3UV5A 4O70A 5ENJA 5F2PA 4LC2A 4QR4A 5DYXA 5EPBA 5EWVA 5I83A 4QYDA 3VKHA 4ALGA 5HFQA 5E9VA 4QC3A 3JVLA 5F61A 4AI6A 4TQNA 2YYNA 5IGMA 5A5SA 4CFLA 5E73A 3UW9A 5CQ4A 3LQJA 5C85A 2RNWA 5ENHA 4HXKA 3LXJA 3S91A 5A5OA 5A5RA 3I3JA 4NYVA 5I80A 5I86A 3UVYA 4Q0NA 5LJ2A 5L98A 4IOOA 3UVWA 4FLPA 5HRWA 5FE9A 2R0SA 2E3KA 4WIVA 5CP5A 5FG6A 4MEPA 5JWMA 4A9FA 5HFRA 5F60A 4QSRA 4HBVA 4WHUA 4NUDA 3QZVA 5I89A 4Z6HA 4Z6IA 5F36A 5EV9A 4KV1A 5D3HA 4UYEA 5D25A 4QEUA 4UITA 5ENIA 4UYHA 5L97A 5G4SA 4RVRA 5HQ6A 4J0SA 4QY4A 5AMEA 4AKIA 4Z1QA 5HQ7A 4LDFA 5E9IA 4HBYA 3K2JA 5DYUA 5FG4A 4NR9A 4YY6A 3U5MA 5FE8A 4YABA 4QB3A 4QR5A 5KHMA 4QSWA 2DKWA 5I88A 2YEKA 5EPSA 4CLBA 5E3GA 4TT6A 4BW1A 5D7XA 3MB4A 2H60A 4HBWA 5L99A 2I8NA 3Q2FA 3U5KA 4Z93A 3LQHA 5CS8A 4QR3A 4QSUA 4LZ2A 5CY9A 4MEQA 3HMHA 5EM3A 5K29A 3MUKA 4AKNA 5A5QA 4PY6A 4O76A 4TU6A 2D82A 4O72A 5D3PA 5A5NA 4NUEA 5ACYA 4O7EA 3U5PA 4NYWA 5AD2A 3DWYA 5CUDA 3JVKA 5LKUA 3D7CA 4QNSA 3LQIA 4BW4A 5FB1A 5AD3A 5FE0A 4YYGA 3JVMA 5EQ1A 5FBXA 5IG6A 5D3NA 3ZYUA 5E9MA 5H85A 5CQ7A 4QBMA 4QEVA 5D3JA 4A9MA 5A82A 3O34A 5DFDA 5CZGA 3AADA 4TZ8A 4TS8A 4OGJA 4O75A 2EJNA 5HQ5A 4AKHA 4Y03A 5LJ0A 5FE1A 1WUMA 4QZSA 5F63A 4QC1A 2R10A 4O7AA 4CL9A 5FE4A 4CUPA 4A9JA 5D3TA 5HELA 4A9OA 4PCEA 5FE2A 2E7NA 2OO1A 4UYFA 5DY7A 5KTUA 5HRXA 1X0JA 5FG5A 5DX4A 4A9IA 2L85A 5I7YA 3ONIA 2GRCA 4MR6A 4YATA 5HM0A 4O74A 3Q2EA 4QSSA 4BJXA 4QSPA 4LYSA
chains in the Genus database with same CATH topology
5HLSA 4YBTA 3S92A 5C89A 4J1PA 3HMEA 3O33A 5F1HA 4UIYA 3G0JA 5A5PA 2RNXA 5L8TA 4GPJA 5DLXA 5D3LA 5EA1A 2R0YA 5CFWA 4OUFA 2RNYA 3AQAA 5BT5A 2WP1A 5EGUA 3O37A 4MEOA 4NR4A 4QUUA 5CRMA 5E3DA 4Z1SA 2DWWA 2LSPB 5IGNA 2DVRA 4J3IA 4NYXA 5II1A 5I40A 3QZTA 5DKDA 4BHWA 4HXLA 4XY9A 4PTBA 4YBMA 5E9LA 3JVJA 4IORA 2YELA 3HMFA 4YH4A 2DATA 4QSVA 4N4GA 5FFYA 5CPEA 3O36A 5ETBA 5TB6A 2WP2A 5F25A 5ENCA 3SVHA 4TT4A 5E0RA 5FH8A 3U5NA 5EP7A 5EISA 3MB3A 4TYLA 2G4AA 4NR7A 5ETDA 4O7FA 2RS9B 5DFCA 4UIWA 3U5JA 5CUAA 3IU5A 5LJ1A 3UV2A 3P1EA 5D0CA 2F6NA 4C67A 5CGPA 4YYHA 5EWDA 4A9EA 5DYAA 5FFVA 4YYMA 4TTEA 5F3AA 5LKTA 5L8UA 3GG3A 5D24A 5FE3A 5I1QA 5EWHA 3SVFA 5D3RA 5I7XA 4IR3A 4QSXA 5EK9A 2FSAA 2YQDA 4HBXA 5E9YA 5EICA 4LRGA 4LZSA 4J0RA 4CURA 4YYDA 4QYLA 4O71A 2R0VA 4HXNA 2DVSA 5EWWA 5DW1A 4YK0A 5IIDA 5I29A 4IR6A 5CQTA 5A81A 3SVGA 5E7DA 3UVDA 5D3SA 5HRVA 4N4HA 5CQ8A 5J0DA 5F62A 5ENEA 4F3IA 4KV4A 4YAXA 4KCXA 5A83A 5ENFA 2OUOA 4YYKA 4PS5A 3UV4A 2D9EA 4QUTA 4IR4A 4O7CA 5EPRA 5A85A 5IBNA 1ZS5A 5KTXA 5DYCA 4YYIA 2RI7A 4ALHA 5G4RA 5EWCA 5FE5A 5EU1A 1JM4B 5DKCA 4YYNA 5C8GA 3P1FA 4Q0OA 4E96A 4NR5A 5HCLA 5C7NA 3DAIA 5CTLA 5ENGA 5DLZA 5II2A 4DONA 3UVXA 1WUGA 4HXSA 4XUAA 5CUGA 4TU4A 5CUEA 5DBMA 4A9HA 5COIA 4A9KA 5F5ZA 4LYWA 4HXOA 5FDZA 4BW2A 4LZRA 5FE7A 4HXPA 4O7BA 3G0LA 2RO1A 5CUBA 4LYIA 2OSSA 4NR8A 5H1UA 4IOQA 5H1VA 4HXRA 2DVVA 3IU6A 4N3WA 4QSTA 4NR6A 5E74A 4PKLA 4YY4A 1JSPB 5HENA 4O77A 4MR4A 2L84A 5JI8A 5E9KA 5DKHA 5D26A 2YW5A 5A7CA 5KO4A 4HXMA 4O78A 4UIXA 5ENBA 3P1CA 2DVQA 5LUUA 5CQAA 5L96A 4LR6A 4NS5A 4ZQLA 3U5LA 5CU8A 3NXBA 1E6IA 4BW3A 1F68A 4UYGA 2F6JA 4A9LA 4XYAA 5KU3A 4TT2A 5CQ6A 5C4QA 4XY8A 2RFJA 5EVAA 5DW2A 4CUSA 5CUCA 4C66A 3MULA 4UIZA 1EQFA 4UYDA 5DFBA 4NUCA 4NQNA 5FH7A 5LKZA 4XUBA 4CUQA 5H1TA 5CQ3A 5HEMA 4IR5A 4UYFB 4N4IA 5FFWA 3O35A 5AMFA 3FKMX 2N9GA 4MR3A 3RCWA 4ZC9A 4NQMA 5EI4A 4YBSA 5KTWA 4TZ2A 5FH6A 4CFKA 4YC9A 5BT3A 5CQ5A 2YDWA 3QZSA 4WHWA 2MJVB 5FE6A 3LJWA 5LVQA 3P5OA 2L5EA 4MENA 4MR5A 4CUTA 3MQMA 5IGKA 2NXBA 3MXFA 3P1DA 4CUUA 5LVRA 5HJCA 4PCIA 1N72A 4NXJA 2I7KA 2KTBB 4YADA 2E7OA 4N4FA 3TLPA 4ZW1A 4QEWA 4YH3A 2YEMA 4X2IA 4YYJA 5F1LA 5IGLA 4OGIA 4QSQA 5TCMA 4NRBA 4A9NA 5C87A 4NRAA 3U5OA 5CRZA 4UIUA 5LKXA 5FB0A 4NRCA 4UIVA 5BT4A 3UV5A 4O70A 5ENJA 5F2PA 4LC2A 4QR4A 5DYXA 5EPBA 5EWVA 5I83A 4QYDA 4ALGA 5HFQA 5E9VA 4QC3A 3JVLA 5F61A 4TQNA 2YYNA 5IGMA 5A5SA 4CFLA 5E73A 3UW9A 5CQ4A 3LQJA 5C85A 2RNWA 5ENHA 4HXKA 3LXJA 3S91A 5A5OA 5A5RA 3I3JA 4NYVA 5I80A 5I86A 3UVYA 4Q0NA 5LJ2A 5L98A 4IOOA 3UVWA 4FLPA 5HRWA 5FE9A 2R0SA 2E3KA 4WIVA 5CP5A 5FG6A 4MEPA 5JWMA 4A9FA 5HFRA 5F60A 4QSRA 4HBVA 4WHUA 4NUDA 3QZVA 5I89A 4Z6HA 4Z6IA 5F36A 5EV9A 4KV1A 5D3HA 4UYEA 5D25A 4QEUA 4UITA 5ENIA 4UYHA 5L97A 5G4SA 4RVRA 5HQ6A 4J0SA 4QY4A 5AMEA 4Z1QA 5HQ7A 4LDFA 5E9IA 4HBYA 3K2JA 5DYUA 5FG4A 4NR9A 4YY6A 3U5MA 5FE8A 4YABA 4QB3A 4QR5A 5KHMA 4QSWA 2DKWA 5I88A 2YEKA 5EPSA 4CLBA 5E3GA 4TT6A 4BW1A 5D7XA 3MB4A 2H60A 4HBWA 5L99A 2I8NA 3Q2FA 3U5KA 4Z93A 3LQHA 5CS8A 4QR3A 4QSUA 4LZ2A 5CY9A 4MEQA 3HMHA 5EM3A 5K29A 3MUKA 4AKNA 5A5QA 4PY6A 4O76A 4TU6A 2D82A 4O72A 5D3PA 5A5NA 4NUEA 5ACYA 4O7EA 3U5PA 4NYWA 5AD2A 3DWYA 5CUDA 3JVKA 5LKUA 3D7CA 4QNSA 3LQIA 4BW4A 5FB1A 5AD3A 5FE0A 4YYGA 3JVMA 5EQ1A 5FBXA 5IG6A 5D3NA 3ZYUA 5E9MA 5H85A 5CQ7A 4QBMA 4QEVA 5D3JA 4A9MA 5A82A 3O34A 5DFDA 5CZGA 3AADA 4TZ8A 4TS8A 4OGJA 4O75A 5HQ5A 4Y03A 5LJ0A 5FE1A 1WUMA 4QZSA 5F63A 4QC1A 2R10A 4O7AA 4CL9A 5FE4A 4CUPA 4A9JA 5D3TA 5HELA 4A9OA 4PCEA 5FE2A 2E7NA 2OO1A 4UYFA 5DY7A 5KTUA 5HRXA 1X0JA 5FG5A 5DX4A 4A9IA 2L85A 5I7YA 3ONIA 2GRCA 4MR6A 4YATA 5HM0A 4O74A 3Q2EA 4QSSA 4BJXA 4QSPA 4LYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HLS A;  4YBT A;  3S92 A;  5C89 A;  4J1P A;  3HME A;  3O33 A;  5F1H A;  4UIY A;  3G0J A;  5A5P A;  2RNX A;  5L8T A;  4GPJ A;  5DLX A;  5D3L A;  5EA1 A;  2R0Y A;  5CFW A;  4OUF A;  2RNY A;  3AQA A;  5BT5 A;  2WP1 A;  5EGU A;  3O37 A;  4MEO A;  4NR4 A;  4QUU A;  5CRM A;  5E3D A;  4Z1S A;  2DWW A;  2LSP B;  5IGN A;  2DVR A;  4J3I A;  4NYX A;  5II1 A;  5I40 A;  3QZT A;  5DKD A;  4BHW A;  4HXL A;  4XY9 A;  4PTB A;  4YBM A;  5E9L A;  3JVJ A;  4IOR A;  2YEL A;  3HMF A;  4YH4 A;  2DAT A;  4QSV A;  4N4G A;  5FFY A;  5CPE A;  3O36 A;  5ETB A;  5TB6 A;  2WP2 A;  5F25 A;  5ENC A;  3SVH A;  4TT4 A;  5E0R A;  5FH8 A;  3U5N A;  5EP7 A;  5EIS A;  3MB3 A;  4TYL A;  2G4A A;  4NR7 A;  5ETD A;  4O7F A;  2RS9 B;  5DFC A;  4UIW A;  3U5J A;  5CUA A;  3IU5 A;  5LJ1 A;  3UV2 A;  3P1E A;  5D0C A;  2F6N A;  4C67 A;  5CGP A;  4YYH A;  5EWD A;  4A9E A;  5DYA A;  5FFV A;  4YYM A;  4TTE A;  5F3A A;  5LKT A;  5L8U A;  3GG3 A;  5D24 A;  5FE3 A;  5I1Q A;  5EWH A;  3SVF A;  5D3R A;  5I7X A;  4IR3 A;  4QSX A;  5EK9 A;  2FSA A;  2YQD A;  4HBX A;  5E9Y A;  5EIC A;  4LRG A;  4LZS A;  4J0R A;  4CUR A;  4YYD A;  4QYL A;  4O71 A;  2R0V A;  4HXN A;  2DVS A;  5EWW A;  5DW1 A;  4YK0 A;  5IID A;  5I29 A;  4IR6 A;  5CQT A;  5A81 A;  3SVG A;  5E7D A;  3UVD A;  5D3S A;  5HRV A;  4N4H A;  5CQ8 A;  5J0D A;  5F62 A;  5ENE A;  4F3I A;  4KV4 A;  4YAX A;  4KCX A;  5A83 A;  5ENF A;  2OUO A;  4YYK A;  4PS5 A;  3UV4 A;  2D9E A;  4QUT A;  4IR4 A;  4O7C A;  5EPR A;  5A85 A;  5IBN A;  1ZS5 A;  5KTX A;  5DYC A;  4YYI A;  2RI7 A;  4ALH A;  5G4R A;  5EWC A;  5FE5 A;  5EU1 A;  1JM4 B;  5DKC A;  4YYN A;  5C8G A;  3P1F A;  4Q0O A;  4E96 A;  4NR5 A;  5HCL A;  5C7N A;  3DAI A;  5CTL A;  5ENG A;  5DLZ A;  5II2 A;  4DON A;  3UVX A;  1WUG A;  4HXS A;  4XUA A;  5CUG A;  4TU4 A;  5CUE A;  5DBM A;  4A9H A;  5COI A;  4A9K A;  5F5Z A;  4LYW A;  4HXO A;  5FDZ A;  4BW2 A;  4LZR A;  5FE7 A;  4HXP A;  4O7B A;  3G0L A;  2RO1 A;  5CUB A;  4LYI A;  2OSS A;  4NR8 A;  5H1U A;  4IOQ A;  5H1V A;  4HXR A;  2DVV A;  3IU6 A;  4N3W A;  4QST A;  4NR6 A;  5E74 A;  4PKL A;  4YY4 A;  1JSP B;  5HEN A;  4O77 A;  4MR4 A;  2L84 A;  5JI8 A;  5E9K A;  5DKH A;  5D26 A;  2YW5 A;  5A7C A;  5KO4 A;  4HXM A;  4O78 A;  4UIX A;  5ENB A;  3P1C A;  2DVQ A;  5LUU A;  5CQA A;  5L96 A;  4LR6 A;  4NS5 A;  4ZQL A;  3U5L A;  5CU8 A;  3NXB A;  1E6I A;  4BW3 A;  1F68 A;  4UYG A;  2F6J A;  4A9L A;  4XYA A;  5KU3 A;  4TT2 A;  5CQ6 A;  5C4Q A;  4XY8 A;  2RFJ A;  5EVA A;  5DW2 A;  4CUS A;  5CUC A;  4C66 A;  3MUL A;  4UIZ A;  1EQF A;  4UYD A;  5DFB A;  4NUC A;  4NQN A;  5FH7 A;  5LKZ A;  4XUB A;  4CUQ A;  5H1T A;  5CQ3 A;  5HEM A;  4IR5 A;  4UYF B;  4N4I A;  5FFW A;  3O35 A;  5AMF A;  3FKM X;  2N9G A;  4MR3 A;  3RCW A;  4ZC9 A;  4NQM A;  5EI4 A;  4YBS A;  5KTW A;  4TZ2 A;  5FH6 A;  4CFK A;  4YC9 A;  5BT3 A;  5CQ5 A;  2YDW A;  3QZS A;  4WHW A;  2MJV B;  5FE6 A;  3LJW A;  5LVQ A;  3P5O A;  2L5E A;  4MEN A;  4MR5 A;  4CUT A;  3MQM A;  5IGK A;  2NXB A;  3MXF A;  3P1D A;  4CUU A;  5LVR A;  5HJC A;  4PCI A;  1N72 A;  4NXJ A;  2I7K A;  2KTB B;  4YAD A;  2E7O A;  4N4F A;  3TLP A;  4ZW1 A;  4QEW A;  4YH3 A;  2YEM A;  4X2I A;  4YYJ A;  5F1L A;  5IGL A;  4OGI A;  4QSQ A;  5TCM A;  4NRB A;  4A9N A;  5C87 A;  4NRA A;  3U5O A;  5CRZ A;  4UIU A;  5LKX A;  5FB0 A;  4NRC A;  4UIV A;  5BT4 A;  3UV5 A;  4O70 A;  5ENJ A;  5F2P A;  4LC2 A;  4QR4 A;  5DYX A;  5EPB A;  5EWV A;  5I83 A;  4QYD A;  4ALG A;  5HFQ A;  5E9V A;  4QC3 A;  3JVL A;  5F61 A;  4TQN A;  2YYN A;  5IGM A;  5A5S A;  4CFL A;  5E73 A;  3UW9 A;  5CQ4 A;  3LQJ A;  5C85 A;  2RNW A;  5ENH A;  4HXK A;  3LXJ A;  3S91 A;  5A5O A;  5A5R A;  3I3J A;  4NYV A;  5I80 A;  5I86 A;  3UVY A;  4Q0N A;  5LJ2 A;  5L98 A;  4IOO A;  3UVW A;  4FLP A;  5HRW A;  5FE9 A;  2R0S A;  2E3K A;  4WIV A;  5CP5 A;  5FG6 A;  4MEP A;  5JWM A;  4A9F A;  5HFR A;  5F60 A;  4QSR A;  4HBV A;  4WHU A;  4NUD A;  3QZV A;  5I89 A;  4Z6H A;  4Z6I A;  5F36 A;  5EV9 A;  4KV1 A;  5D3H A;  4UYE A;  5D25 A;  4QEU A;  4UIT A;  5ENI A;  4UYH A;  5L97 A;  5G4S A;  4RVR A;  5HQ6 A;  4J0S A;  4QY4 A;  5AME A;  4Z1Q A;  5HQ7 A;  4LDF A;  5E9I A;  4HBY A;  3K2J A;  5DYU A;  5FG4 A;  4NR9 A;  4YY6 A;  3U5M A;  5FE8 A;  4YAB A;  4QB3 A;  4QR5 A;  5KHM A;  4QSW A;  2DKW A;  5I88 A;  2YEK A;  5EPS A;  4CLB A;  5E3G A;  4TT6 A;  4BW1 A;  5D7X A;  3MB4 A;  2H60 A;  4HBW A;  5L99 A;  2I8N A;  3Q2F A;  3U5K A;  4Z93 A;  3LQH A;  5CS8 A;  4QR3 A;  4QSU A;  4LZ2 A;  5CY9 A;  4MEQ A;  3HMH A;  5EM3 A;  5K29 A;  3MUK A;  4AKN A;  5A5Q A;  4PY6 A;  4O76 A;  4TU6 A;  2D82 A;  4O72 A;  5D3P A;  5A5N A;  4NUE A;  5ACY A;  4O7E A;  3U5P A;  4NYW A;  5AD2 A;  3DWY A;  5CUD A;  3JVK A;  5LKU A;  3D7C A;  4QNS A;  3LQI A;  4BW4 A;  5FB1 A;  5AD3 A;  5FE0 A;  4YYG A;  3JVM A;  5EQ1 A;  5FBX A;  5IG6 A;  5D3N A;  3ZYU A;  5E9M A;  5H85 A;  5CQ7 A;  4QBM A;  4QEV A;  5D3J A;  4A9M A;  5A82 A;  3O34 A;  5DFD A;  5CZG A;  3AAD A;  4TZ8 A;  4TS8 A;  4OGJ A;  4O75 A;  5HQ5 A;  4Y03 A;  5LJ0 A;  5FE1 A;  1WUM A;  4QZS A;  5F63 A;  4QC1 A;  2R10 A;  4O7A A;  4CL9 A;  5FE4 A;  4CUP A;  4A9J A;  5D3T A;  5HEL A;  4A9O A;  4PCE A;  5FE2 A;  2E7N A;  2OO1 A;  4UYF A;  5DY7 A;  5KTU A;  5HRX A;  1X0J A;  5FG5 A;  5DX4 A;  4A9I A;  2L85 A;  5I7Y A;  3ONI A;  2GRC A;  4MR6 A;  4YAT A;  5HM0 A;  4O74 A;  3Q2E A;  4QSS A;  4BJX A;  4QSP A;  4LYS A; 
#chains in the Genus database with same CATH topology
 5HLS A;  4YBT A;  3S92 A;  5C89 A;  4J1P A;  3HME A;  3O33 A;  5F1H A;  4UIY A;  3G0J A;  5A5P A;  2RNX A;  5L8T A;  4GPJ A;  5DLX A;  5D3L A;  5EA1 A;  2R0Y A;  5CFW A;  4OUF A;  3AQA A;  2RNY A;  5BT5 A;  2WP1 A;  5EGU A;  3O37 A;  4MEO A;  4NR4 A;  4QUU A;  5CRM A;  5E3D A;  4Z1S A;  2DWW A;  2LSP B;  5IGN A;  2DVR A;  4J3I A;  4NYX A;  5II1 A;  5I40 A;  3QZT A;  5DKD A;  4BHW A;  4HXL A;  4XY9 A;  4PTB A;  4YBM A;  5E9L A;  3JVJ A;  4IOR A;  2YEL A;  3HMF A;  4YH4 A;  2DAT A;  4QSV A;  4N4G A;  5FFY A;  5CPE A;  3O36 A;  5ETB A;  5TB6 A;  2WP2 A;  5F25 A;  5ENC A;  3SVH A;  4TT4 A;  5E0R A;  5FH8 A;  3U5N A;  5EP7 A;  5EIS A;  3MB3 A;  4TYL A;  2G4A A;  4NR7 A;  5ETD A;  4O7F A;  2RS9 B;  4UIW A;  5DFC A;  3U5J A;  5CUA A;  3IU5 A;  5LJ1 A;  3UV2 A;  3P1E A;  5D0C A;  2F6N A;  4C67 A;  5CGP A;  4YYH A;  5EWD A;  4A9E A;  5DYA A;  5FFV A;  4YYM A;  4TTE A;  5F3A A;  5LKT A;  5L8U A;  3GG3 A;  5D24 A;  5FE3 A;  5I1Q A;  5EWH A;  3SVF A;  5D3R A;  5I7X A;  4IR3 A;  4QSX A;  5EK9 A;  2FSA A;  2YQD A;  4HBX A;  5E9Y A;  5EIC A;  4LRG A;  4LZS A;  4J0R A;  4CUR A;  4YYD A;  4QYL A;  4O71 A;  3VKG A;  2R0V A;  4HXN A;  2DVS A;  5EWW A;  5DW1 A;  4YK0 A;  5IID A;  5I29 A;  4IR6 A;  5CQT A;  5A81 A;  3SVG A;  5E7D A;  3UVD A;  5D3S A;  5HRV A;  4N4H A;  5CQ8 A;  5J0D A;  5F62 A;  5ENE A;  4F3I A;  4KV4 A;  4YAX A;  4KCX A;  5A83 A;  5ENF A;  2OUO A;  4YYK A;  4PS5 A;  3UV4 A;  2D9E A;  4QUT A;  4IR4 A;  4O7C A;  5EPR A;  5A85 A;  5IBN A;  1ZS5 A;  5KTX A;  5DYC A;  4YYI A;  2RI7 A;  4ALH A;  5G4R A;  5EWC A;  5FE5 A;  5EU1 A;  1JM4 B;  5DKC A;  4YYN A;  5C8G A;  3P1F A;  4Q0O A;  4E96 A;  4NR5 A;  5HCL A;  5C7N A;  3DAI A;  5CTL A;  5ENG A;  5DLZ A;  5II2 A;  4DON A;  3UVX A;  1WUG A;  4HXS A;  4XUA A;  5CUG A;  4TU4 A;  5CUE A;  5DBM A;  4A9H A;  5COI A;  4A9K A;  5F5Z A;  4LYW A;  4HXO A;  5FDZ A;  4BW2 A;  4LZR A;  5FE7 A;  4HXP A;  4O7B A;  3G0L A;  2RO1 A;  1ZKR A;  5CUB A;  4LYI A;  2OSS A;  4NR8 A;  5H1U A;  4IOQ A;  5H1V A;  4HXR A;  2DVV A;  3IU6 A;  4N3W A;  4QST A;  4NR6 A;  5E74 A;  4PKL A;  4YY4 A;  1JSP B;  5HEN A;  4O77 A;  4MR4 A;  2L84 A;  5JI8 A;  5E9K A;  5DKH A;  5D26 A;  2YW5 A;  5A7C A;  5KO4 A;  4HXM A;  4O78 A;  4UIX A;  5ENB A;  3P1C A;  2DVQ A;  5LUU A;  5CQA A;  5L96 A;  4LR6 A;  4NS5 A;  4ZQL A;  3U5L A;  5CU8 A;  3NXB A;  1E6I A;  4BW3 A;  1F68 A;  4UYG A;  2F6J A;  4A9L A;  4XYA A;  5KU3 A;  4TT2 A;  5CQ6 A;  5C4Q A;  4XY8 A;  2RFJ A;  5EVA A;  5DW2 A;  4CUS A;  5CUC A;  4C66 A;  3MUL A;  4UIZ A;  1EQF A;  4UYD A;  5DFB A;  4NUC A;  4NQN A;  5FH7 A;  5LKZ A;  4XUB A;  4CUQ A;  5H1T A;  5CQ3 A;  5HEM A;  4IR5 A;  4AKG A;  4UYF B;  4N4I A;  5FFW A;  3O35 A;  5AMF A;  3FKM X;  2N9G A;  4MR3 A;  3RCW A;  4ZC9 A;  4NQM A;  5EI4 A;  4YBS A;  5KTW A;  4TZ2 A;  5FH6 A;  1PUO A;  4CFK A;  4YC9 A;  3ERR A;  5BT3 A;  5CQ5 A;  2YDW A;  3QZS A;  4WHW A;  2MJV B;  3D1D A;  5FE6 A;  3LJW A;  5LVQ A;  3P5O A;  2L5E A;  4MEN A;  4MR5 A;  4CUT A;  3MQM A;  5IGK A;  2NXB A;  3MXF A;  3P1D A;  4CUU A;  5LVR A;  5HJC A;  4PCI A;  1N72 A;  4NXJ A;  2I7K A;  2KTB B;  4YAD A;  2E7O A;  4N4F A;  3TLP A;  4ZW1 A;  4QEW A;  4YH3 A;  2YEM A;  4X2I A;  4YYJ A;  5F1L A;  5IGL A;  4OGI A;  4QSQ A;  5TCM A;  4NRB A;  4A9N A;  5C87 A;  4NRA A;  3U5O A;  5CRZ A;  4UIU A;  5LKX A;  5FB0 A;  4NRC A;  4UIV A;  3D1B A;  5BT4 A;  3UV5 A;  4O70 A;  5ENJ A;  5F2P A;  4LC2 A;  4QR4 A;  5DYX A;  5EPB A;  5EWV A;  5I83 A;  4QYD A;  3VKH A;  4ALG A;  5HFQ A;  5E9V A;  4QC3 A;  3JVL A;  5F61 A;  4AI6 A;  4TQN A;  2YYN A;  5IGM A;  5A5S A;  4CFL A;  5E73 A;  3UW9 A;  5CQ4 A;  3LQJ A;  5C85 A;  2RNW A;  5ENH A;  4HXK A;  3LXJ A;  3S91 A;  5A5O A;  5A5R A;  3I3J A;  4NYV A;  5I80 A;  5I86 A;  3UVY A;  4Q0N A;  5LJ2 A;  5L98 A;  4IOO A;  3UVW A;  4FLP A;  5HRW A;  5FE9 A;  2R0S A;  2E3K A;  4WIV A;  5CP5 A;  5FG6 A;  4MEP A;  5JWM A;  4A9F A;  5HFR A;  5F60 A;  4QSR A;  4HBV A;  4WHU A;  4NUD A;  3QZV A;  5I89 A;  4Z6H A;  4Z6I A;  5F36 A;  5EV9 A;  4KV1 A;  5D3H A;  4UYE A;  5D25 A;  4QEU A;  4UIT A;  5ENI A;  4UYH A;  5L97 A;  5G4S A;  4RVR A;  5HQ6 A;  4J0S A;  4QY4 A;  5AME A;  4AKI A;  4Z1Q A;  5HQ7 A;  4LDF A;  5E9I A;  4HBY A;  3K2J A;  5DYU A;  5FG4 A;  4NR9 A;  4YY6 A;  3U5M A;  5FE8 A;  4YAB A;  4QB3 A;  4QR5 A;  5KHM A;  4QSW A;  2DKW A;  5I88 A;  2YEK A;  5EPS A;  4CLB A;  5E3G A;  4TT6 A;  4BW1 A;  5D7X A;  3MB4 A;  2H60 A;  4HBW A;  5L99 A;  2I8N A;  3Q2F A;  3U5K A;  4Z93 A;  3LQH A;  5CS8 A;  4QR3 A;  4QSU A;  4LZ2 A;  5CY9 A;  4MEQ A;  3HMH A;  5EM3 A;  5K29 A;  3MUK A;  4AKN A;  5A5Q A;  4PY6 A;  4O76 A;  4TU6 A;  2D82 A;  4O72 A;  5D3P A;  5A5N A;  4NUE A;  5ACY A;  4O7E A;  3U5P A;  4NYW A;  5AD2 A;  3DWY A;  5CUD A;  3JVK A;  5LKU A;  3D7C A;  4QNS A;  3LQI A;  4BW4 A;  5FB1 A;  5AD3 A;  5FE0 A;  4YYG A;  3JVM A;  5EQ1 A;  5FBX A;  5IG6 A;  5D3N A;  3ZYU A;  5E9M A;  5H85 A;  5CQ7 A;  4QBM A;  4QEV A;  5D3J A;  4A9M A;  5A82 A;  3O34 A;  5DFD A;  5CZG A;  3AAD A;  4TZ8 A;  4TS8 A;  4OGJ A;  4O75 A;  2EJN A;  5HQ5 A;  4AKH A;  4Y03 A;  5LJ0 A;  5FE1 A;  1WUM A;  4QZS A;  5F63 A;  4QC1 A;  2R10 A;  4O7A A;  4CL9 A;  5FE4 A;  4CUP A;  4A9J A;  5D3T A;  5HEL A;  4A9O A;  4PCE A;  5FE2 A;  2E7N A;  2OO1 A;  4UYF A;  5DY7 A;  5KTU A;  5HRX A;  1X0J A;  5FG5 A;  5DX4 A;  4A9I A;  2L85 A;  5I7Y A;  3ONI A;  2GRC A;  4MR6 A;  4YAT A;  5HM0 A;  4O74 A;  3Q2E A;  4QSS A;  4BJX A;  4QSP A;  4LYS A; 
#chains in the Genus database with same CATH homology
 5HLS A;  4YBT A;  3S92 A;  5C89 A;  4J1P A;  3HME A;  3O33 A;  5F1H A;  4UIY A;  3G0J A;  5A5P A;  2RNX A;  5L8T A;  4GPJ A;  5DLX A;  5D3L A;  5EA1 A;  2R0Y A;  5CFW A;  4OUF A;  2RNY A;  3AQA A;  5BT5 A;  2WP1 A;  5EGU A;  3O37 A;  4MEO A;  4NR4 A;  4QUU A;  5CRM A;  5E3D A;  4Z1S A;  2DWW A;  2LSP B;  5IGN A;  2DVR A;  4J3I A;  4NYX A;  5II1 A;  5I40 A;  3QZT A;  5DKD A;  4BHW A;  4HXL A;  4XY9 A;  4PTB A;  4YBM A;  5E9L A;  3JVJ A;  4IOR A;  2YEL A;  3HMF A;  4YH4 A;  2DAT A;  4QSV A;  4N4G A;  5FFY A;  5CPE A;  3O36 A;  5ETB A;  5TB6 A;  2WP2 A;  5F25 A;  5ENC A;  3SVH A;  4TT4 A;  5E0R A;  5FH8 A;  3U5N A;  5EP7 A;  5EIS A;  3MB3 A;  4TYL A;  2G4A A;  4NR7 A;  5ETD A;  4O7F A;  2RS9 B;  5DFC A;  4UIW A;  3U5J A;  5CUA A;  3IU5 A;  5LJ1 A;  3UV2 A;  3P1E A;  5D0C A;  2F6N A;  4C67 A;  5CGP A;  4YYH A;  5EWD A;  4A9E A;  5DYA A;  5FFV A;  4YYM A;  4TTE A;  5F3A A;  5LKT A;  5L8U A;  3GG3 A;  5D24 A;  5FE3 A;  5I1Q A;  5EWH A;  3SVF A;  5D3R A;  5I7X A;  4IR3 A;  4QSX A;  5EK9 A;  2FSA A;  2YQD A;  4HBX A;  5E9Y A;  5EIC A;  4LRG A;  4LZS A;  4J0R A;  4CUR A;  4YYD A;  4QYL A;  4O71 A;  2R0V A;  4HXN A;  2DVS A;  5EWW A;  5DW1 A;  4YK0 A;  5IID A;  5I29 A;  4IR6 A;  5CQT A;  5A81 A;  3SVG A;  5E7D A;  3UVD A;  5D3S A;  5HRV A;  4N4H A;  5CQ8 A;  5J0D A;  5F62 A;  5ENE A;  4F3I A;  4KV4 A;  4YAX A;  4KCX A;  5A83 A;  5ENF A;  2OUO A;  4YYK A;  4PS5 A;  3UV4 A;  2D9E A;  4QUT A;  4IR4 A;  4O7C A;  5EPR A;  5A85 A;  5IBN A;  1ZS5 A;  5KTX A;  5DYC A;  4YYI A;  2RI7 A;  4ALH A;  5G4R A;  5EWC A;  5FE5 A;  5EU1 A;  1JM4 B;  5DKC A;  4YYN A;  5C8G A;  3P1F A;  4Q0O A;  4E96 A;  4NR5 A;  5HCL A;  5C7N A;  3DAI A;  5CTL A;  5ENG A;  5DLZ A;  5II2 A;  4DON A;  3UVX A;  1WUG A;  4HXS A;  4XUA A;  5CUG A;  4TU4 A;  5CUE A;  5DBM A;  4A9H A;  5COI A;  4A9K A;  5F5Z A;  4LYW A;  4HXO A;  5FDZ A;  4BW2 A;  4LZR A;  5FE7 A;  4HXP A;  4O7B A;  3G0L A;  2RO1 A;  5CUB A;  4LYI A;  2OSS A;  4NR8 A;  5H1U A;  4IOQ A;  5H1V A;  4HXR A;  2DVV A;  3IU6 A;  4N3W A;  4QST A;  4NR6 A;  5E74 A;  4PKL A;  4YY4 A;  1JSP B;  5HEN A;  4O77 A;  4MR4 A;  2L84 A;  5JI8 A;  5E9K A;  5DKH A;  5D26 A;  2YW5 A;  5A7C A;  5KO4 A;  4HXM A;  4O78 A;  4UIX A;  5ENB A;  3P1C A;  2DVQ A;  5LUU A;  5CQA A;  5L96 A;  4LR6 A;  4NS5 A;  4ZQL A;  3U5L A;  5CU8 A;  3NXB A;  1E6I A;  4BW3 A;  1F68 A;  4UYG A;  2F6J A;  4A9L A;  4XYA A;  5KU3 A;  4TT2 A;  5CQ6 A;  5C4Q A;  4XY8 A;  2RFJ A;  5EVA A;  5DW2 A;  4CUS A;  5CUC A;  4C66 A;  3MUL A;  4UIZ A;  1EQF A;  4UYD A;  5DFB A;  4NUC A;  4NQN A;  5FH7 A;  5LKZ A;  4XUB A;  4CUQ A;  5H1T A;  5CQ3 A;  5HEM A;  4IR5 A;  4UYF B;  4N4I A;  5FFW A;  3O35 A;  5AMF A;  3FKM X;  2N9G A;  4MR3 A;  3RCW A;  4ZC9 A;  4NQM A;  5EI4 A;  4YBS A;  5KTW A;  4TZ2 A;  5FH6 A;  4CFK A;  4YC9 A;  5BT3 A;  5CQ5 A;  2YDW A;  3QZS A;  4WHW A;  2MJV B;  5FE6 A;  3LJW A;  5LVQ A;  3P5O A;  2L5E A;  4MEN A;  4MR5 A;  4CUT A;  3MQM A;  5IGK A;  2NXB A;  3MXF A;  3P1D A;  4CUU A;  5LVR A;  5HJC A;  4PCI A;  1N72 A;  4NXJ A;  2I7K A;  2KTB B;  4YAD A;  2E7O A;  4N4F A;  3TLP A;  4ZW1 A;  4QEW A;  4YH3 A;  2YEM A;  4X2I A;  4YYJ A;  5F1L A;  5IGL A;  4OGI A;  4QSQ A;  5TCM A;  4NRB A;  4A9N A;  5C87 A;  4NRA A;  3U5O A;  5CRZ A;  4UIU A;  5LKX A;  5FB0 A;  4NRC A;  4UIV A;  5BT4 A;  3UV5 A;  4O70 A;  5ENJ A;  5F2P A;  4LC2 A;  4QR4 A;  5DYX A;  5EPB A;  5EWV A;  5I83 A;  4QYD A;  4ALG A;  5HFQ A;  5E9V A;  4QC3 A;  3JVL A;  5F61 A;  4TQN A;  2YYN A;  5IGM A;  5A5S A;  4CFL A;  5E73 A;  3UW9 A;  5CQ4 A;  3LQJ A;  5C85 A;  2RNW A;  5ENH A;  4HXK A;  3LXJ A;  3S91 A;  5A5O A;  5A5R A;  3I3J A;  4NYV A;  5I80 A;  5I86 A;  3UVY A;  4Q0N A;  5LJ2 A;  5L98 A;  4IOO A;  3UVW A;  4FLP A;  5HRW A;  5FE9 A;  2R0S A;  2E3K A;  4WIV A;  5CP5 A;  5FG6 A;  4MEP A;  5JWM A;  4A9F A;  5HFR A;  5F60 A;  4QSR A;  4HBV A;  4WHU A;  4NUD A;  3QZV A;  5I89 A;  4Z6H A;  4Z6I A;  5F36 A;  5EV9 A;  4KV1 A;  5D3H A;  4UYE A;  5D25 A;  4QEU A;  4UIT A;  5ENI A;  4UYH A;  5L97 A;  5G4S A;  4RVR A;  5HQ6 A;  4J0S A;  4QY4 A;  5AME A;  4Z1Q A;  5HQ7 A;  4LDF A;  5E9I A;  4HBY A;  3K2J A;  5DYU A;  5FG4 A;  4NR9 A;  4YY6 A;  3U5M A;  5FE8 A;  4YAB A;  4QB3 A;  4QR5 A;  5KHM A;  4QSW A;  2DKW A;  5I88 A;  2YEK A;  5EPS A;  4CLB A;  5E3G A;  4TT6 A;  4BW1 A;  5D7X A;  3MB4 A;  2H60 A;  4HBW A;  5L99 A;  2I8N A;  3Q2F A;  3U5K A;  4Z93 A;  3LQH A;  5CS8 A;  4QR3 A;  4QSU A;  4LZ2 A;  5CY9 A;  4MEQ A;  3HMH A;  5EM3 A;  5K29 A;  3MUK A;  4AKN A;  5A5Q A;  4PY6 A;  4O76 A;  4TU6 A;  2D82 A;  4O72 A;  5D3P A;  5A5N A;  4NUE A;  5ACY A;  4O7E A;  3U5P A;  4NYW A;  5AD2 A;  3DWY A;  5CUD A;  3JVK A;  5LKU A;  3D7C A;  4QNS A;  3LQI A;  4BW4 A;  5FB1 A;  5AD3 A;  5FE0 A;  4YYG A;  3JVM A;  5EQ1 A;  5FBX A;  5IG6 A;  5D3N A;  3ZYU A;  5E9M A;  5H85 A;  5CQ7 A;  4QBM A;  4QEV A;  5D3J A;  4A9M A;  5A82 A;  3O34 A;  5DFD A;  5CZG A;  3AAD A;  4TZ8 A;  4TS8 A;  4OGJ A;  4O75 A;  5HQ5 A;  4Y03 A;  5LJ0 A;  5FE1 A;  1WUM A;  4QZS A;  5F63 A;  4QC1 A;  2R10 A;  4O7A A;  4CL9 A;  5FE4 A;  4CUP A;  4A9J A;  5D3T A;  5HEL A;  4A9O A;  4PCE A;  5FE2 A;  2E7N A;  2OO1 A;  4UYF A;  5DY7 A;  5KTU A;  5HRX A;  1X0J A;  5FG5 A;  5DX4 A;  4A9I A;  2L85 A;  5I7Y A;  3ONI A;  2GRC A;  4MR6 A;  4YAT A;  5HM0 A;  4O74 A;  3Q2E A;  4QSS A;  4BJX A;  4QSP A;  4LYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...