5EV9A

Crystal structure of the human brpf1 bromodomain in complex with seed15
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ev9A00
2YW5A 4ALGA 4UIXA 4LYWA 4YH4A 4A9OA 4LR6A 2I8NA 3JVKA 2F6NA 5LKTA 5BT3A 1EQFA 3QZTA 4DONA 5FB0A 4YY4A 5L8UA 4QSUA 3K2JA 5DFDA 5CTLA 5EI4A 4UIWA 3GG3A 5EA1A 4UIYA 5EV9A 5FH8A 3UV5A 5FE7A 5FE8A 4O77A 2RS9B 5CRZA 3IU6A 5F61A 5EQ1A 4QB3A 5CUCA 4LRGA 5KO4A 3IU5A 3FKMX 4J3IA 4QC1A 4N3WA 3U5MA 5E9KA 4LYSA 4UIVA 4QSXA 4QYLA 4TYLA 2E3KA 5G4SA 3RCWA 5TCMA 5ENBA 4YYIA 5F60A 4WIVA 5D0CA 4O75A 4HXMA 3AADA 3DWYA 2OUOA 2KTBB 2R0SA 3G0LA 5DW2A 3AQAA 3U5LA 4N4FA 1F68A 5CUDA 2D9EA 2YDWA 5D3RA 4PKLA 2N9GA 5C85A 1JSPB 5ENHA 5AMFA 2OO1A 5ENIA 3P1EA 5CQ8A 5DY7A 4HXPA 5DYXA 4C67A 4UYDA 5H1TA 4UYFA 4QZSA 5CQ5A 5ENCA 4QY4A 4IOOA 5HQ7A 4HXLA 5LJ2A 4YK0A 5CS8A 4Y03A 4YH3A 4LC2A 5D3NA 5E73A 4XUAA 4AKNA 5EPSA 5A5PA 4MR5A 4N4HA 4Q0NA 4QEVA 4QUUA 4YATA 4CFLA 4KV4A 5LVRA 5FH6A 2YELA 4BHWA 4ZC9A 3UV2A 5C87A 4YC9A 3LJWA 4QUTA 5EWHA 4PS5A 4NR5A 5HEMA 4YAXA 4NQMA 4HBVA 3MB3A 5ETDA 5F1HA 4QC3A 5HFQA 4OGIA 2WP1A 5AD2A 5EK9A 4HBWA 4NRAA 5COIA 3U5OA 4ZW1A 5DBMA 4PCEA 5CP5A 3MXFA 5CFWA 5FE3A 3P5OA 5E9IA 5FE2A 2YEMA 5A85A 4QR4A 2YQDA 4PCIA 5EPBA 5KTWA 3LQIA 5FG6A 3Q2FA 4HXSA 5KU3A 4NR4A 4TTEA 5DYUA 5DFBA 5IGLA 2DVSA 4CUPA 5FE4A 5ENJA 3UVWA 5CRMA 2DWWA 4XY8A 3S92A 3JVJA 3U5JA 4NUCA 5BT4A 4BW4A 3U5PA 2H60A 4KCXA 3UW9A 4CUUA 4CUQA 4YYKA 5C89A 5A5NA 2YYNA 2RNWA 3UVYA 5F3AA 2DKWA 3G0JA 3MQMA 4MENA 4QEWA 2RNXA 5II2A 4YBMA 4X2IA 5D3HA 4QSQA 5CQAA 5KTXA 4LYIA 3SVFA 5H1UA 5D3SA 4TU6A 5ENEA 4UYHA 4CURA 2LSPB 4QSVA 5I7YA 5IGKA 5HJCA 5EPRA 4A9LA 5C7NA 5EVAA 5I40A 5FG4A 5F62A 3O36A 4YYDA 4O70A 4Z6IA 4PY6A 4UYEA 4HXRA 5E7DA 2L84A 4HXOA 4J0RA 5F5ZA 5H1VA 4LZRA 5FE5A 4N4IA 5CQ4A 4MR6A 5CUBA 2FSAA 5FE1A 4Z1QA 4ALHA 4MR4A 4CL9A 4QSRA 3JVMA 5DYAA 5IGNA 5CQ6A 5FDZA 4GPJA 4TS8A 4O71A 3ZYUA 5EP7A 5K29A 5L99A 3U5NA 3I3JA 3MB4A 4J1PA 4O76A 4YADA 4CUTA 3HMEA 2DATA 4YBTA 5E9LA 4LZ2A 4O7CA 5F63A 5FE9A 3S91A 5LJ0A 3HMFA 4KV1A 4O7FA 5ENGA 3SVHA 4OGJA 5E9VA 5HCLA 4QYDA 5A5OA 4HXNA 2L5EA 5E0RA 5FFYA 4UYGA 3P1FA 5I7XA 5I83A 5A83A 5CY9A 5D24A 5DW1A 5EICA 5DLXA 5I29A 1N72A 1E6IA 2RI7A 4NR6A 4TT2A 5LKXA 4CUSA 4A9FA 4MR3A 5I1QA 4Z1SA 3LXJA 3O35A 4YYGA 5CQ3A 5E9YA 3O37A 3ONIA 5EWCA 5EGUA 4HXKA 3O34A 4QSSA 5KHMA 4IOQA 5FFVA 4UITA 5E3GA 5HQ5A 5CPEA 5LJ1A 4QNSA 4Q0OA 5CZGA 3P1CA 5I86A 4PTBA 4CLBA 2DVVA 5CQ7A 4NXJA 5HRWA 5H85A 2I7KA 5FE0A 4BW1A 5HM0A 5DKDA 4XY9A 5C8GA 5IBNA 4O74A 4Z6HA 3QZSA 5ETBA 5F2PA 4OUFA 4YYJA 5JWMA 2GRCA 5DKCA 3O33A 5ENFA 5DLZA 2NXBA 4WHUA 5FH7A 4BJXA 4BW3A 5LKUA 5EM3A 5HRXA 1JM4B 4QSWA 4IR6A 4YYMA 3UVDA 4NRBA 5IG6A 4A9HA 5EWDA 5LVQA 2RO1A 5FE6A 2E7OA 5IIDA 4NR9A 5FB1A 5BT5A 4Z93A 2OSSA 5D3PA 1WUGA 4FLPA 4O78A 4YY6A 3UV4A 4YBSA 5CUAA 4NQNA 4XYAA 5D25A 5DKHA 4A9IA 4NRCA 5AD3A 2R0VA 4LDFA 5I89A 5DFCA 4NYXA 4QEUA 3P1DA 5HENA 4F3IA 4A9NA 4NYVA 3MUKA 3QZVA 2MJVB 2DVQA 2DVRA 4NUDA 4YYNA 3JVLA 1X0JA 2L85A 5L98A 4IR4A 4IR3A 5F25A 3NXBA 5II1A 4BW2A 3U5KA 5EWVA 3LQHA 5E74A 5CU8A 4N4GA 5D26A 2RNYA 5E9MA 3LQJA 4QR3A 4CFKA 4TQNA 4YYHA 5LKZA 5A82A 5AMEA 4A9MA 2YEKA 5EU1A 4WHWA 2F6JA 5KTUA 2R0YA 4MEQA 3TLPA 5D7XA 3HMHA 4ZQLA 4NR7A 5DYCA 1WUMA 5EISA 1ZS5A 4HBXA 5E3DA 4IORA 4UIUA 4NS5A 4YABA 4QSPA 5CUEA 5I80A 4J0SA 4HBYA 4QBMA 5D3JA 4A9JA 4NR8A 4MEPA 4O7EA 4TT6A 4TU4A 2RFJA 4E96A 4RVRA 4MEOA 5A5QA 4TZ8A 4XUBA 5HQ6A 5FBXA 5D3LA 5HELA 5JI8A 4TT4A 5L96A 4O72A 4O7AA 4C66A 5A5SA 5A7CA 4TZ2A 5FFWA 3UVXA 4QSTA 2D82A 3D7CA 4IR5A 5DX4A 4QR5A 4O7BA 5HRVA 3DAIA 2E7NA 2WP2A 4LZSA 5CUGA 5A81A 5TB6A 5A5RA 5ACYA 5LUUA 4UIZA 5CGPA 5J0DA 3SVGA 5F36A 5HLSA 4UYFB 3Q2EA 5FG5A 5G4RA 2R10A 4NUEA 4A9KA 3MULA 5C4QA 5I88A 5L97A 5HFRA 5L8TA 4NYWA 5IGMA 5F1LA 5EWWA 5CQTA 4A9EA 5D3TA 2G4AA
chains in the Genus database with same CATH superfamily
2YW5A 4ALGA 4UIXA 4LYWA 4YH4A 4A9OA 4LR6A 2I8NA 3JVKA 2F6NA 5LKTA 5BT3A 1EQFA 3QZTA 4DONA 5FB0A 4YY4A 5L8UA 4QSUA 3K2JA 5DFDA 5CTLA 5EI4A 4UIWA 3GG3A 5EA1A 4UIYA 5EV9A 5FH8A 3UV5A 5FE7A 5FE8A 4O77A 2RS9B 5CRZA 3IU6A 5F61A 5EQ1A 4QB3A 5CUCA 4LRGA 5KO4A 3IU5A 3FKMX 4J3IA 4QC1A 4N3WA 3U5MA 5E9KA 4LYSA 4UIVA 4QSXA 4QYLA 4TYLA 2E3KA 5G4SA 3RCWA 5TCMA 5ENBA 4YYIA 5F60A 4WIVA 5D0CA 4O75A 4HXMA 3AADA 3DWYA 2OUOA 2KTBB 2R0SA 3G0LA 5DW2A 3AQAA 3U5LA 4N4FA 1F68A 5CUDA 2D9EA 2YDWA 5D3RA 4PKLA 2N9GA 5C85A 1JSPB 5ENHA 5AMFA 2OO1A 5ENIA 3P1EA 5CQ8A 5DY7A 4HXPA 5DYXA 4C67A 4UYDA 5H1TA 4UYFA 4QZSA 5CQ5A 5ENCA 4QY4A 4IOOA 5HQ7A 4HXLA 5LJ2A 4YK0A 5CS8A 4Y03A 4YH3A 4LC2A 5D3NA 5E73A 4XUAA 4AKNA 5EPSA 5A5PA 4MR5A 4N4HA 4Q0NA 4QEVA 3VKHA 4QUUA 4YATA 4CFLA 4KV4A 5LVRA 5FH6A 2YELA 4BHWA 4ZC9A 3UV2A 5C87A 4YC9A 3LJWA 4QUTA 5EWHA 4PS5A 4NR5A 5HEMA 4YAXA 4NQMA 4HBVA 3MB3A 5ETDA 5F1HA 4QC3A 5HFQA 4OGIA 2WP1A 5AD2A 5EK9A 4HBWA 4NRAA 5COIA 3U5OA 4ZW1A 5DBMA 4PCEA 5CP5A 3MXFA 5CFWA 5FE3A 3P5OA 5E9IA 5FE2A 2YEMA 5A85A 4QR4A 2YQDA 4PCIA 5EPBA 5KTWA 3LQIA 5FG6A 3Q2FA 4HXSA 5KU3A 4NR4A 4TTEA 5DYUA 5DFBA 5IGLA 2DVSA 4CUPA 5FE4A 5ENJA 3UVWA 5CRMA 2DWWA 4XY8A 3S92A 3JVJA 3U5JA 4NUCA 5BT4A 4BW4A 3U5PA 2H60A 4KCXA 3UW9A 4CUUA 4CUQA 4YYKA 5C89A 5A5NA 2YYNA 2RNWA 3UVYA 5F3AA 2DKWA 3G0JA 3MQMA 4MENA 4QEWA 2RNXA 5II2A 4YBMA 4X2IA 5D3HA 4QSQA 5CQAA 5KTXA 4LYIA 3SVFA 5H1UA 5D3SA 4TU6A 5ENEA 4UYHA 4CURA 2LSPB 4QSVA 2EJNA 5I7YA 5IGKA 5HJCA 5EPRA 4A9LA 5C7NA 5EVAA 5I40A 5FG4A 5F62A 3O36A 4YYDA 4O70A 4Z6IA 4PY6A 4UYEA 3D1DA 4HXRA 5E7DA 2L84A 4HXOA 4J0RA 5F5ZA 5H1VA 4LZRA 5FE5A 4N4IA 5CQ4A 4MR6A 5CUBA 2FSAA 5FE1A 4Z1QA 4ALHA 4MR4A 4CL9A 4QSRA 3ERRA 3JVMA 5DYAA 5IGNA 5CQ6A 5FDZA 1ZKRA 4GPJA 4TS8A 4O71A 3ZYUA 5EP7A 5K29A 5L99A 3U5NA 3I3JA 3MB4A 4J1PA 4O76A 4YADA 4CUTA 3HMEA 4AKHA 2DATA 4YBTA 5E9LA 4LZ2A 4O7CA 5F63A 5FE9A 3S91A 5LJ0A 3HMFA 4KV1A 4O7FA 5ENGA 3SVHA 3D1BA 4OGJA 5E9VA 5HCLA 4QYDA 5A5OA 4HXNA 2L5EA 5E0RA 5FFYA 4UYGA 3P1FA 5I7XA 5I83A 5A83A 5CY9A 5D24A 5DW1A 5EICA 5DLXA 5I29A 1N72A 1E6IA 2RI7A 4NR6A 4TT2A 5LKXA 4CUSA 4A9FA 3VKGA 4MR3A 5I1QA 4Z1SA 3LXJA 3O35A 4YYGA 5CQ3A 5E9YA 3O37A 3ONIA 5EWCA 5EGUA 4HXKA 3O34A 4QSSA 5KHMA 4IOQA 5FFVA 4UITA 5E3GA 5HQ5A 5CPEA 5LJ1A 4QNSA 4Q0OA 5CZGA 3P1CA 5I86A 4PTBA 4CLBA 2DVVA 5CQ7A 4NXJA 5HRWA 5H85A 1PUOA 2I7KA 5FE0A 4BW1A 5HM0A 5DKDA 4XY9A 5C8GA 5IBNA 4O74A 4Z6HA 3QZSA 5ETBA 5F2PA 4OUFA 4YYJA 5JWMA 2GRCA 5DKCA 3O33A 5ENFA 5DLZA 2NXBA 4WHUA 5FH7A 4BJXA 4BW3A 5LKUA 5EM3A 5HRXA 4AKIA 1JM4B 4QSWA 4IR6A 4YYMA 3UVDA 4NRBA 5IG6A 4A9HA 5EWDA 5LVQA 2RO1A 5FE6A 2E7OA 5IIDA 4NR9A 5FB1A 5BT5A 4Z93A 2OSSA 5D3PA 1WUGA 4FLPA 4O78A 4YY6A 3UV4A 4YBSA 5CUAA 4NQNA 4XYAA 5D25A 5DKHA 4A9IA 4NRCA 5AD3A 2R0VA 4LDFA 5I89A 5DFCA 4NYXA 4QEUA 3P1DA 5HENA 4F3IA 4A9NA 4NYVA 3MUKA 3QZVA 2MJVB 2DVQA 2DVRA 4NUDA 4YYNA 3JVLA 1X0JA 2L85A 5L98A 4IR4A 4IR3A 5F25A 3NXBA 5II1A 4BW2A 3U5KA 5EWVA 3LQHA 5E74A 5CU8A 4N4GA 5D26A 2RNYA 5E9MA 3LQJA 4QR3A 4CFKA 4TQNA 4YYHA 5LKZA 5A82A 5AMEA 4A9MA 2YEKA 5EU1A 4WHWA 2F6JA 5KTUA 2R0YA 4MEQA 3TLPA 5D7XA 3HMHA 4ZQLA 4NR7A 5DYCA 1WUMA 5EISA 1ZS5A 4HBXA 5E3DA 4IORA 4UIUA 4NS5A 4YABA 4QSPA 5CUEA 5I80A 4J0SA 4HBYA 4QBMA 5D3JA 4A9JA 4NR8A 4MEPA 4O7EA 4TT6A 4TU4A 2RFJA 4E96A 4RVRA 4MEOA 5A5QA 4TZ8A 4XUBA 5HQ6A 5FBXA 5D3LA 5HELA 5JI8A 4TT4A 5L96A 4O72A 4O7AA 4C66A 5A5SA 5A7CA 4TZ2A 5FFWA 3UVXA 4QSTA 2D82A 3D7CA 4IR5A 5DX4A 4QR5A 4O7BA 5HRVA 3DAIA 2E7NA 2WP2A 4LZSA 5CUGA 5A81A 5TB6A 5A5RA 5ACYA 5LUUA 4UIZA 5CGPA 5J0DA 4AKGA 3SVGA 5F36A 5HLSA 4UYFB 3Q2EA 5FG5A 5G4RA 2R10A 4NUEA 4A9KA 3MULA 5C4QA 5I88A 5L97A 5HFRA 5L8TA 4NYWA 5IGMA 5F1LA 5EWWA 5CQTA 4A9EA 4AI6A 5D3TA 2G4AA
chains in the Genus database with same CATH topology
2YW5A 4ALGA 4UIXA 4LYWA 4YH4A 4A9OA 4LR6A 2I8NA 3JVKA 2F6NA 5LKTA 5BT3A 1EQFA 3QZTA 4DONA 5FB0A 4YY4A 5L8UA 4QSUA 3K2JA 5DFDA 5CTLA 5EI4A 4UIWA 3GG3A 5EA1A 4UIYA 5EV9A 5FH8A 3UV5A 5FE7A 5FE8A 4O77A 2RS9B 5CRZA 3IU6A 5F61A 5EQ1A 4QB3A 5CUCA 4LRGA 5KO4A 3IU5A 3FKMX 4J3IA 4QC1A 4N3WA 3U5MA 5E9KA 4LYSA 4UIVA 4QSXA 4QYLA 4TYLA 2E3KA 5G4SA 3RCWA 5TCMA 5ENBA 4YYIA 5F60A 4WIVA 5D0CA 4O75A 4HXMA 3AADA 3DWYA 2OUOA 2KTBB 2R0SA 3G0LA 5DW2A 3AQAA 3U5LA 4N4FA 1F68A 5CUDA 2D9EA 2YDWA 5D3RA 4PKLA 2N9GA 5C85A 1JSPB 5ENHA 5AMFA 2OO1A 5ENIA 3P1EA 5CQ8A 5DY7A 4HXPA 5DYXA 4C67A 4UYDA 5H1TA 4UYFA 4QZSA 5CQ5A 5ENCA 4QY4A 4IOOA 5HQ7A 4HXLA 5LJ2A 4YK0A 5CS8A 4Y03A 4YH3A 4LC2A 5D3NA 5E73A 4XUAA 4AKNA 5EPSA 5A5PA 4MR5A 4N4HA 4Q0NA 4QEVA 4QUUA 4YATA 4CFLA 4KV4A 5LVRA 5FH6A 2YELA 4BHWA 4ZC9A 3UV2A 5C87A 4YC9A 3LJWA 4QUTA 5EWHA 4PS5A 4NR5A 5HEMA 4YAXA 4NQMA 4HBVA 3MB3A 5ETDA 5F1HA 4QC3A 5HFQA 4OGIA 2WP1A 5AD2A 5EK9A 4HBWA 4NRAA 5COIA 3U5OA 4ZW1A 5DBMA 4PCEA 5CP5A 3MXFA 5CFWA 5FE3A 3P5OA 5E9IA 5FE2A 2YEMA 5A85A 4QR4A 2YQDA 4PCIA 5EPBA 5KTWA 3LQIA 5FG6A 3Q2FA 4HXSA 5KU3A 4NR4A 4TTEA 5DYUA 5DFBA 5IGLA 2DVSA 4CUPA 5FE4A 5ENJA 3UVWA 5CRMA 2DWWA 4XY8A 3S92A 3JVJA 3U5JA 4NUCA 5BT4A 4BW4A 3U5PA 2H60A 4KCXA 3UW9A 4CUUA 4CUQA 4YYKA 5C89A 5A5NA 2YYNA 2RNWA 3UVYA 5F3AA 2DKWA 3G0JA 3MQMA 4MENA 4QEWA 2RNXA 5II2A 4YBMA 4X2IA 5D3HA 4QSQA 5CQAA 5KTXA 4LYIA 3SVFA 5H1UA 5D3SA 4TU6A 5ENEA 4UYHA 4CURA 2LSPB 4QSVA 5I7YA 5IGKA 5HJCA 5EPRA 4A9LA 5C7NA 5EVAA 5I40A 5FG4A 5F62A 3O36A 4YYDA 4O70A 4Z6IA 4PY6A 4UYEA 4HXRA 5E7DA 2L84A 4HXOA 4J0RA 5F5ZA 5H1VA 4LZRA 5FE5A 4N4IA 5CQ4A 4MR6A 5CUBA 2FSAA 5FE1A 4Z1QA 4ALHA 4MR4A 4CL9A 4QSRA 3JVMA 5DYAA 5IGNA 5CQ6A 5FDZA 4GPJA 4TS8A 4O71A 3ZYUA 5EP7A 5K29A 5L99A 3U5NA 3I3JA 3MB4A 4J1PA 4O76A 4YADA 4CUTA 3HMEA 2DATA 4YBTA 5E9LA 4LZ2A 4O7CA 5F63A 5FE9A 3S91A 5LJ0A 3HMFA 4KV1A 4O7FA 5ENGA 3SVHA 4OGJA 5E9VA 5HCLA 4QYDA 5A5OA 4HXNA 2L5EA 5E0RA 5FFYA 4UYGA 3P1FA 5I7XA 5I83A 5A83A 5CY9A 5D24A 5DW1A 5EICA 5DLXA 5I29A 1N72A 1E6IA 2RI7A 4NR6A 4TT2A 5LKXA 4CUSA 4A9FA 4MR3A 5I1QA 4Z1SA 3LXJA 3O35A 4YYGA 5CQ3A 5E9YA 3O37A 3ONIA 5EWCA 5EGUA 4HXKA 3O34A 4QSSA 5KHMA 4IOQA 5FFVA 4UITA 5E3GA 5HQ5A 5CPEA 5LJ1A 4QNSA 4Q0OA 5CZGA 3P1CA 5I86A 4PTBA 4CLBA 2DVVA 5CQ7A 4NXJA 5HRWA 5H85A 2I7KA 5FE0A 4BW1A 5HM0A 5DKDA 4XY9A 5C8GA 5IBNA 4O74A 4Z6HA 3QZSA 5ETBA 5F2PA 4OUFA 4YYJA 5JWMA 2GRCA 5DKCA 3O33A 5ENFA 5DLZA 2NXBA 4WHUA 5FH7A 4BJXA 4BW3A 5LKUA 5EM3A 5HRXA 1JM4B 4QSWA 4IR6A 4YYMA 3UVDA 4NRBA 5IG6A 4A9HA 5EWDA 5LVQA 2RO1A 5FE6A 2E7OA 5IIDA 4NR9A 5FB1A 5BT5A 4Z93A 2OSSA 5D3PA 1WUGA 4FLPA 4O78A 4YY6A 3UV4A 4YBSA 5CUAA 4NQNA 4XYAA 5D25A 5DKHA 4A9IA 4NRCA 5AD3A 2R0VA 4LDFA 5I89A 5DFCA 4NYXA 4QEUA 3P1DA 5HENA 4F3IA 4A9NA 4NYVA 3MUKA 3QZVA 2MJVB 2DVQA 2DVRA 4NUDA 4YYNA 3JVLA 1X0JA 2L85A 5L98A 4IR4A 4IR3A 5F25A 3NXBA 5II1A 4BW2A 3U5KA 5EWVA 3LQHA 5E74A 5CU8A 4N4GA 5D26A 2RNYA 5E9MA 3LQJA 4QR3A 4CFKA 4TQNA 4YYHA 5LKZA 5A82A 5AMEA 4A9MA 2YEKA 5EU1A 4WHWA 2F6JA 5KTUA 2R0YA 4MEQA 3TLPA 5D7XA 3HMHA 4ZQLA 4NR7A 5DYCA 1WUMA 5EISA 1ZS5A 4HBXA 5E3DA 4IORA 4UIUA 4NS5A 4YABA 4QSPA 5CUEA 5I80A 4J0SA 4HBYA 4QBMA 5D3JA 4A9JA 4NR8A 4MEPA 4O7EA 4TT6A 4TU4A 2RFJA 4E96A 4RVRA 4MEOA 5A5QA 4TZ8A 4XUBA 5HQ6A 5FBXA 5D3LA 5HELA 5JI8A 4TT4A 5L96A 4O72A 4O7AA 4C66A 5A5SA 5A7CA 4TZ2A 5FFWA 3UVXA 4QSTA 2D82A 3D7CA 4IR5A 5DX4A 4QR5A 4O7BA 5HRVA 3DAIA 2E7NA 2WP2A 4LZSA 5CUGA 5A81A 5TB6A 5A5RA 5ACYA 5LUUA 4UIZA 5CGPA 5J0DA 3SVGA 5F36A 5HLSA 4UYFB 3Q2EA 5FG5A 5G4RA 2R10A 4NUEA 4A9KA 3MULA 5C4QA 5I88A 5L97A 5HFRA 5L8TA 4NYWA 5IGMA 5F1LA 5EWWA 5CQTA 4A9EA 5D3TA 2G4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YW5 A;  4ALG A;  4UIX A;  4LYW A;  4YH4 A;  4A9O A;  4LR6 A;  2I8N A;  3JVK A;  2F6N A;  5LKT A;  5BT3 A;  1EQF A;  3QZT A;  4DON A;  5FB0 A;  4YY4 A;  5L8U A;  4QSU A;  3K2J A;  5DFD A;  5CTL A;  5EI4 A;  4UIW A;  3GG3 A;  5EA1 A;  4UIY A;  5EV9 A;  5FH8 A;  3UV5 A;  5FE7 A;  5FE8 A;  4O77 A;  2RS9 B;  5CRZ A;  3IU6 A;  5F61 A;  5EQ1 A;  4QB3 A;  5CUC A;  4LRG A;  5KO4 A;  3IU5 A;  3FKM X;  4J3I A;  4QC1 A;  4N3W A;  3U5M A;  5E9K A;  4LYS A;  4UIV A;  4QSX A;  4QYL A;  4TYL A;  2E3K A;  5G4S A;  3RCW A;  5TCM A;  5ENB A;  4YYI A;  5F60 A;  4WIV A;  5D0C A;  4O75 A;  4HXM A;  3AAD A;  3DWY A;  2OUO A;  2KTB B;  2R0S A;  3G0L A;  5DW2 A;  3AQA A;  3U5L A;  4N4F A;  1F68 A;  5CUD A;  2D9E A;  2YDW A;  5D3R A;  4PKL A;  2N9G A;  5C85 A;  1JSP B;  5ENH A;  5AMF A;  2OO1 A;  5ENI A;  3P1E A;  5CQ8 A;  5DY7 A;  4HXP A;  5DYX A;  4C67 A;  4UYD A;  5H1T A;  4UYF A;  4QZS A;  5CQ5 A;  5ENC A;  4QY4 A;  4IOO A;  5HQ7 A;  4HXL A;  5LJ2 A;  4YK0 A;  5CS8 A;  4Y03 A;  4YH3 A;  4LC2 A;  5D3N A;  5E73 A;  4XUA A;  4AKN A;  5EPS A;  5A5P A;  4MR5 A;  4N4H A;  4Q0N A;  4QEV A;  4QUU A;  4YAT A;  4CFL A;  4KV4 A;  5LVR A;  5FH6 A;  2YEL A;  4BHW A;  4ZC9 A;  3UV2 A;  5C87 A;  4YC9 A;  3LJW A;  4QUT A;  5EWH A;  4PS5 A;  4NR5 A;  5HEM A;  4YAX A;  4NQM A;  4HBV A;  3MB3 A;  5ETD A;  5F1H A;  4QC3 A;  5HFQ A;  4OGI A;  2WP1 A;  5AD2 A;  5EK9 A;  4HBW A;  4NRA A;  5COI A;  3U5O A;  4ZW1 A;  5DBM A;  4PCE A;  5CP5 A;  3MXF A;  5CFW A;  5FE3 A;  3P5O A;  5E9I A;  5FE2 A;  2YEM A;  5A85 A;  4QR4 A;  2YQD A;  4PCI A;  5EPB A;  5KTW A;  3LQI A;  5FG6 A;  3Q2F A;  4HXS A;  5KU3 A;  4NR4 A;  4TTE A;  5DYU A;  5DFB A;  5IGL A;  2DVS A;  4CUP A;  5FE4 A;  5ENJ A;  3UVW A;  5CRM A;  2DWW A;  4XY8 A;  3S92 A;  3JVJ A;  3U5J A;  4NUC A;  5BT4 A;  4BW4 A;  3U5P A;  2H60 A;  4KCX A;  3UW9 A;  4CUU A;  4CUQ A;  4YYK A;  5C89 A;  5A5N A;  2YYN A;  2RNW A;  3UVY A;  5F3A A;  2DKW A;  3G0J A;  3MQM A;  4MEN A;  4QEW A;  2RNX A;  5II2 A;  4YBM A;  4X2I A;  5D3H A;  4QSQ A;  5CQA A;  5KTX A;  4LYI A;  3SVF A;  5H1U A;  5D3S A;  4TU6 A;  5ENE A;  4UYH A;  4CUR A;  2LSP B;  4QSV A;  5I7Y A;  5IGK A;  5HJC A;  5EPR A;  4A9L A;  5C7N A;  5EVA A;  5I40 A;  5FG4 A;  5F62 A;  3O36 A;  4YYD A;  4O70 A;  4Z6I A;  4PY6 A;  4UYE A;  4HXR A;  5E7D A;  2L84 A;  4HXO A;  4J0R A;  5F5Z A;  5H1V A;  4LZR A;  5FE5 A;  4N4I A;  5CQ4 A;  4MR6 A;  5CUB A;  2FSA A;  5FE1 A;  4Z1Q A;  4ALH A;  4MR4 A;  4CL9 A;  4QSR A;  3JVM A;  5DYA A;  5IGN A;  5CQ6 A;  5FDZ A;  4GPJ A;  4TS8 A;  4O71 A;  3ZYU A;  5EP7 A;  5K29 A;  5L99 A;  3U5N A;  3I3J A;  3MB4 A;  4J1P A;  4O76 A;  4YAD A;  4CUT A;  3HME A;  2DAT A;  4YBT A;  5E9L A;  4LZ2 A;  4O7C A;  5F63 A;  5FE9 A;  3S91 A;  5LJ0 A;  3HMF A;  4KV1 A;  4O7F A;  5ENG A;  3SVH A;  4OGJ A;  5E9V A;  5HCL A;  4QYD A;  5A5O A;  4HXN A;  2L5E A;  5E0R A;  5FFY A;  4UYG A;  3P1F A;  5I7X A;  5I83 A;  5A83 A;  5CY9 A;  5D24 A;  5DW1 A;  5EIC A;  5DLX A;  5I29 A;  1N72 A;  1E6I A;  2RI7 A;  4NR6 A;  4TT2 A;  5LKX A;  4CUS A;  4A9F A;  4MR3 A;  5I1Q A;  4Z1S A;  3LXJ A;  3O35 A;  4YYG A;  5CQ3 A;  5E9Y A;  3O37 A;  3ONI A;  5EWC A;  5EGU A;  4HXK A;  3O34 A;  4QSS A;  5KHM A;  4IOQ A;  5FFV A;  4UIT A;  5E3G A;  5HQ5 A;  5CPE A;  5LJ1 A;  4QNS A;  4Q0O A;  5CZG A;  3P1C A;  5I86 A;  4PTB A;  4CLB A;  2DVV A;  5CQ7 A;  4NXJ A;  5HRW A;  5H85 A;  2I7K A;  5FE0 A;  4BW1 A;  5HM0 A;  5DKD A;  4XY9 A;  5C8G A;  5IBN A;  4O74 A;  4Z6H A;  3QZS A;  5ETB A;  5F2P A;  4OUF A;  4YYJ A;  5JWM A;  2GRC A;  5DKC A;  3O33 A;  5ENF A;  5DLZ A;  2NXB A;  4WHU A;  5FH7 A;  4BJX A;  4BW3 A;  5LKU A;  5EM3 A;  5HRX A;  1JM4 B;  4QSW A;  4IR6 A;  4YYM A;  3UVD A;  4NRB A;  5IG6 A;  4A9H A;  5EWD A;  5LVQ A;  2RO1 A;  5FE6 A;  2E7O A;  5IID A;  4NR9 A;  5FB1 A;  5BT5 A;  4Z93 A;  2OSS A;  5D3P A;  1WUG A;  4FLP A;  4O78 A;  4YY6 A;  3UV4 A;  4YBS A;  5CUA A;  4NQN A;  4XYA A;  5D25 A;  5DKH A;  4A9I A;  4NRC A;  5AD3 A;  2R0V A;  4LDF A;  5I89 A;  5DFC A;  4NYX A;  4QEU A;  3P1D A;  5HEN A;  4F3I A;  4A9N A;  4NYV A;  3MUK A;  3QZV A;  2MJV B;  2DVQ A;  2DVR A;  4NUD A;  4YYN A;  3JVL A;  1X0J A;  2L85 A;  5L98 A;  4IR4 A;  4IR3 A;  5F25 A;  3NXB A;  5II1 A;  4BW2 A;  3U5K A;  5EWV A;  3LQH A;  5E74 A;  5CU8 A;  4N4G A;  5D26 A;  2RNY A;  5E9M A;  3LQJ A;  4QR3 A;  4CFK A;  4TQN A;  4YYH A;  5LKZ A;  5A82 A;  5AME A;  4A9M A;  2YEK A;  5EU1 A;  4WHW A;  2F6J A;  5KTU A;  2R0Y A;  4MEQ A;  3TLP A;  5D7X A;  3HMH A;  4ZQL A;  4NR7 A;  5DYC A;  1WUM A;  5EIS A;  1ZS5 A;  4HBX A;  5E3D A;  4IOR A;  4UIU A;  4NS5 A;  4YAB A;  4QSP A;  5CUE A;  5I80 A;  4J0S A;  4HBY A;  4QBM A;  5D3J A;  4A9J A;  4NR8 A;  4MEP A;  4O7E A;  4TT6 A;  4TU4 A;  2RFJ A;  4E96 A;  4RVR A;  4MEO A;  5A5Q A;  4TZ8 A;  4XUB A;  5HQ6 A;  5FBX A;  5D3L A;  5HEL A;  5JI8 A;  4TT4 A;  5L96 A;  4O72 A;  4O7A A;  4C66 A;  5A5S A;  5A7C A;  4TZ2 A;  5FFW A;  3UVX A;  4QST A;  2D82 A;  3D7C A;  4IR5 A;  5DX4 A;  4QR5 A;  4O7B A;  5HRV A;  3DAI A;  2E7N A;  2WP2 A;  4LZS A;  5CUG A;  5A81 A;  5TB6 A;  5A5R A;  5ACY A;  5LUU A;  4UIZ A;  5CGP A;  5J0D A;  3SVG A;  5F36 A;  5HLS A;  4UYF B;  3Q2E A;  5FG5 A;  5G4R A;  2R10 A;  4NUE A;  4A9K A;  3MUL A;  5C4Q A;  5I88 A;  5L97 A;  5HFR A;  5L8T A;  4NYW A;  5IGM A;  5F1L A;  5EWW A;  5CQT A;  4A9E A;  5D3T A;  2G4A A; 
#chains in the Genus database with same CATH topology
 2YW5 A;  4ALG A;  4UIX A;  4LYW A;  4YH4 A;  4A9O A;  4LR6 A;  2I8N A;  3JVK A;  2F6N A;  5LKT A;  5BT3 A;  1EQF A;  3QZT A;  4DON A;  5FB0 A;  4YY4 A;  5L8U A;  4QSU A;  3K2J A;  5DFD A;  5CTL A;  5EI4 A;  4UIW A;  3GG3 A;  5EA1 A;  4UIY A;  5EV9 A;  5FH8 A;  3UV5 A;  5FE7 A;  5FE8 A;  4O77 A;  2RS9 B;  5CRZ A;  3IU6 A;  5F61 A;  5EQ1 A;  4QB3 A;  5CUC A;  4LRG A;  5KO4 A;  3IU5 A;  3FKM X;  4J3I A;  4QC1 A;  4N3W A;  3U5M A;  5E9K A;  4LYS A;  4UIV A;  4QSX A;  4QYL A;  4TYL A;  2E3K A;  5G4S A;  3RCW A;  5TCM A;  5ENB A;  4YYI A;  5F60 A;  4WIV A;  5D0C A;  4O75 A;  4HXM A;  3AAD A;  3DWY A;  2OUO A;  2KTB B;  2R0S A;  3G0L A;  5DW2 A;  3AQA A;  3U5L A;  4N4F A;  1F68 A;  5CUD A;  2D9E A;  2YDW A;  5D3R A;  4PKL A;  2N9G A;  5C85 A;  1JSP B;  5ENH A;  5AMF A;  2OO1 A;  5ENI A;  3P1E A;  5CQ8 A;  5DY7 A;  4HXP A;  5DYX A;  4C67 A;  4UYD A;  5H1T A;  4UYF A;  4QZS A;  5CQ5 A;  5ENC A;  4QY4 A;  4IOO A;  5HQ7 A;  4HXL A;  5LJ2 A;  4YK0 A;  5CS8 A;  4Y03 A;  4YH3 A;  4LC2 A;  5D3N A;  5E73 A;  4XUA A;  4AKN A;  5EPS A;  5A5P A;  4MR5 A;  4N4H A;  4Q0N A;  4QEV A;  3VKH A;  4QUU A;  4YAT A;  4CFL A;  4KV4 A;  5LVR A;  5FH6 A;  2YEL A;  4BHW A;  4ZC9 A;  3UV2 A;  5C87 A;  4YC9 A;  3LJW A;  4QUT A;  5EWH A;  4PS5 A;  4NR5 A;  5HEM A;  4YAX A;  4NQM A;  4HBV A;  3MB3 A;  5ETD A;  5F1H A;  4QC3 A;  5HFQ A;  4OGI A;  2WP1 A;  5AD2 A;  5EK9 A;  4HBW A;  4NRA A;  5COI A;  3U5O A;  4ZW1 A;  5DBM A;  4PCE A;  5CP5 A;  3MXF A;  5CFW A;  5FE3 A;  3P5O A;  5E9I A;  5FE2 A;  2YEM A;  5A85 A;  4QR4 A;  2YQD A;  4PCI A;  5EPB A;  5KTW A;  3LQI A;  5FG6 A;  3Q2F A;  4HXS A;  5KU3 A;  4NR4 A;  4TTE A;  5DYU A;  5DFB A;  5IGL A;  2DVS A;  4CUP A;  5FE4 A;  5ENJ A;  3UVW A;  5CRM A;  2DWW A;  4XY8 A;  3S92 A;  3JVJ A;  3U5J A;  4NUC A;  5BT4 A;  4BW4 A;  3U5P A;  2H60 A;  4KCX A;  3UW9 A;  4CUU A;  4CUQ A;  4YYK A;  5C89 A;  5A5N A;  2YYN A;  2RNW A;  3UVY A;  5F3A A;  2DKW A;  3G0J A;  3MQM A;  4MEN A;  4QEW A;  2RNX A;  5II2 A;  4YBM A;  4X2I A;  5D3H A;  4QSQ A;  5CQA A;  5KTX A;  4LYI A;  3SVF A;  5H1U A;  5D3S A;  4TU6 A;  5ENE A;  4UYH A;  4CUR A;  2LSP B;  4QSV A;  2EJN A;  5I7Y A;  5IGK A;  5HJC A;  5EPR A;  4A9L A;  5C7N A;  5EVA A;  5I40 A;  5FG4 A;  5F62 A;  3O36 A;  4YYD A;  4O70 A;  4Z6I A;  4PY6 A;  4UYE A;  3D1D A;  4HXR A;  5E7D A;  2L84 A;  4HXO A;  4J0R A;  5F5Z A;  5H1V A;  4LZR A;  5FE5 A;  4N4I A;  5CQ4 A;  4MR6 A;  5CUB A;  2FSA A;  5FE1 A;  4Z1Q A;  4ALH A;  4MR4 A;  4CL9 A;  4QSR A;  3ERR A;  3JVM A;  5DYA A;  5IGN A;  5CQ6 A;  5FDZ A;  1ZKR A;  4GPJ A;  4TS8 A;  4O71 A;  3ZYU A;  5EP7 A;  5K29 A;  5L99 A;  3U5N A;  3I3J A;  3MB4 A;  4J1P A;  4O76 A;  4YAD A;  4CUT A;  3HME A;  4AKH A;  2DAT A;  4YBT A;  5E9L A;  4LZ2 A;  4O7C A;  5F63 A;  5FE9 A;  3S91 A;  5LJ0 A;  3HMF A;  4KV1 A;  4O7F A;  5ENG A;  3SVH A;  3D1B A;  4OGJ A;  5E9V A;  5HCL A;  4QYD A;  5A5O A;  4HXN A;  2L5E A;  5E0R A;  5FFY A;  4UYG A;  3P1F A;  5I7X A;  5I83 A;  5A83 A;  5CY9 A;  5D24 A;  5DW1 A;  5EIC A;  5DLX A;  5I29 A;  1N72 A;  1E6I A;  2RI7 A;  4NR6 A;  4TT2 A;  5LKX A;  4CUS A;  4A9F A;  3VKG A;  4MR3 A;  5I1Q A;  4Z1S A;  3LXJ A;  3O35 A;  4YYG A;  5CQ3 A;  5E9Y A;  3O37 A;  3ONI A;  5EWC A;  5EGU A;  4HXK A;  3O34 A;  4QSS A;  5KHM A;  4IOQ A;  5FFV A;  4UIT A;  5E3G A;  5HQ5 A;  5CPE A;  5LJ1 A;  4QNS A;  4Q0O A;  5CZG A;  3P1C A;  5I86 A;  4PTB A;  4CLB A;  2DVV A;  5CQ7 A;  4NXJ A;  5HRW A;  5H85 A;  1PUO A;  2I7K A;  5FE0 A;  4BW1 A;  5HM0 A;  5DKD A;  4XY9 A;  5C8G A;  5IBN A;  4O74 A;  4Z6H A;  3QZS A;  5ETB A;  5F2P A;  4OUF A;  4YYJ A;  5JWM A;  2GRC A;  5DKC A;  3O33 A;  5ENF A;  5DLZ A;  2NXB A;  4WHU A;  5FH7 A;  4BJX A;  4BW3 A;  5LKU A;  5EM3 A;  5HRX A;  4AKI A;  1JM4 B;  4QSW A;  4IR6 A;  4YYM A;  3UVD A;  4NRB A;  5IG6 A;  4A9H A;  5EWD A;  5LVQ A;  2RO1 A;  5FE6 A;  2E7O A;  5IID A;  4NR9 A;  5FB1 A;  5BT5 A;  4Z93 A;  2OSS A;  5D3P A;  1WUG A;  4FLP A;  4O78 A;  4YY6 A;  3UV4 A;  4YBS A;  5CUA A;  4NQN A;  4XYA A;  5D25 A;  5DKH A;  4A9I A;  4NRC A;  5AD3 A;  2R0V A;  4LDF A;  5I89 A;  5DFC A;  4NYX A;  4QEU A;  3P1D A;  5HEN A;  4F3I A;  4A9N A;  4NYV A;  3MUK A;  3QZV A;  2MJV B;  2DVQ A;  2DVR A;  4NUD A;  4YYN A;  3JVL A;  1X0J A;  2L85 A;  5L98 A;  4IR4 A;  4IR3 A;  5F25 A;  3NXB A;  5II1 A;  4BW2 A;  3U5K A;  5EWV A;  3LQH A;  5E74 A;  5CU8 A;  4N4G A;  5D26 A;  2RNY A;  5E9M A;  3LQJ A;  4QR3 A;  4CFK A;  4TQN A;  4YYH A;  5LKZ A;  5A82 A;  5AME A;  4A9M A;  2YEK A;  5EU1 A;  4WHW A;  2F6J A;  5KTU A;  2R0Y A;  4MEQ A;  3TLP A;  5D7X A;  3HMH A;  4ZQL A;  4NR7 A;  5DYC A;  1WUM A;  5EIS A;  1ZS5 A;  4HBX A;  5E3D A;  4IOR A;  4UIU A;  4NS5 A;  4YAB A;  4QSP A;  5CUE A;  5I80 A;  4J0S A;  4HBY A;  4QBM A;  5D3J A;  4A9J A;  4NR8 A;  4MEP A;  4O7E A;  4TT6 A;  4TU4 A;  2RFJ A;  4E96 A;  4RVR A;  4MEO A;  5A5Q A;  4TZ8 A;  4XUB A;  5HQ6 A;  5FBX A;  5D3L A;  5HEL A;  5JI8 A;  4TT4 A;  5L96 A;  4O72 A;  4O7A A;  4C66 A;  5A5S A;  5A7C A;  4TZ2 A;  5FFW A;  3UVX A;  4QST A;  2D82 A;  3D7C A;  4IR5 A;  5DX4 A;  4QR5 A;  4O7B A;  5HRV A;  3DAI A;  2E7N A;  2WP2 A;  4LZS A;  5CUG A;  5A81 A;  5TB6 A;  5A5R A;  5ACY A;  5LUU A;  4UIZ A;  5CGP A;  5J0D A;  4AKG A;  3SVG A;  5F36 A;  5HLS A;  4UYF B;  3Q2E A;  5FG5 A;  5G4R A;  2R10 A;  4NUE A;  4A9K A;  3MUL A;  5C4Q A;  5I88 A;  5L97 A;  5HFR A;  5L8T A;  4NYW A;  5IGM A;  5F1L A;  5EWW A;  5CQT A;  4A9E A;  4AI6 A;  5D3T A;  2G4A A; 
#chains in the Genus database with same CATH homology
 2YW5 A;  4ALG A;  4UIX A;  4LYW A;  4YH4 A;  4A9O A;  4LR6 A;  2I8N A;  3JVK A;  2F6N A;  5LKT A;  5BT3 A;  1EQF A;  3QZT A;  4DON A;  5FB0 A;  4YY4 A;  5L8U A;  4QSU A;  3K2J A;  5DFD A;  5CTL A;  5EI4 A;  4UIW A;  3GG3 A;  5EA1 A;  4UIY A;  5EV9 A;  5FH8 A;  3UV5 A;  5FE7 A;  5FE8 A;  4O77 A;  2RS9 B;  5CRZ A;  3IU6 A;  5F61 A;  5EQ1 A;  4QB3 A;  5CUC A;  4LRG A;  5KO4 A;  3IU5 A;  3FKM X;  4J3I A;  4QC1 A;  4N3W A;  3U5M A;  5E9K A;  4LYS A;  4UIV A;  4QSX A;  4QYL A;  4TYL A;  2E3K A;  5G4S A;  3RCW A;  5TCM A;  5ENB A;  4YYI A;  5F60 A;  4WIV A;  5D0C A;  4O75 A;  4HXM A;  3AAD A;  3DWY A;  2OUO A;  2KTB B;  2R0S A;  3G0L A;  5DW2 A;  3AQA A;  3U5L A;  4N4F A;  1F68 A;  5CUD A;  2D9E A;  2YDW A;  5D3R A;  4PKL A;  2N9G A;  5C85 A;  1JSP B;  5ENH A;  5AMF A;  2OO1 A;  5ENI A;  3P1E A;  5CQ8 A;  5DY7 A;  4HXP A;  5DYX A;  4C67 A;  4UYD A;  5H1T A;  4UYF A;  4QZS A;  5CQ5 A;  5ENC A;  4QY4 A;  4IOO A;  5HQ7 A;  4HXL A;  5LJ2 A;  4YK0 A;  5CS8 A;  4Y03 A;  4YH3 A;  4LC2 A;  5D3N A;  5E73 A;  4XUA A;  4AKN A;  5EPS A;  5A5P A;  4MR5 A;  4N4H A;  4Q0N A;  4QEV A;  4QUU A;  4YAT A;  4CFL A;  4KV4 A;  5LVR A;  5FH6 A;  2YEL A;  4BHW A;  4ZC9 A;  3UV2 A;  5C87 A;  4YC9 A;  3LJW A;  4QUT A;  5EWH A;  4PS5 A;  4NR5 A;  5HEM A;  4YAX A;  4NQM A;  4HBV A;  3MB3 A;  5ETD A;  5F1H A;  4QC3 A;  5HFQ A;  4OGI A;  2WP1 A;  5AD2 A;  5EK9 A;  4HBW A;  4NRA A;  5COI A;  3U5O A;  4ZW1 A;  5DBM A;  4PCE A;  5CP5 A;  3MXF A;  5CFW A;  5FE3 A;  3P5O A;  5E9I A;  5FE2 A;  2YEM A;  5A85 A;  4QR4 A;  2YQD A;  4PCI A;  5EPB A;  5KTW A;  3LQI A;  5FG6 A;  3Q2F A;  4HXS A;  5KU3 A;  4NR4 A;  4TTE A;  5DYU A;  5DFB A;  5IGL A;  2DVS A;  4CUP A;  5FE4 A;  5ENJ A;  3UVW A;  5CRM A;  2DWW A;  4XY8 A;  3S92 A;  3JVJ A;  3U5J A;  4NUC A;  5BT4 A;  4BW4 A;  3U5P A;  2H60 A;  4KCX A;  3UW9 A;  4CUU A;  4CUQ A;  4YYK A;  5C89 A;  5A5N A;  2YYN A;  2RNW A;  3UVY A;  5F3A A;  2DKW A;  3G0J A;  3MQM A;  4MEN A;  4QEW A;  2RNX A;  5II2 A;  4YBM A;  4X2I A;  5D3H A;  4QSQ A;  5CQA A;  5KTX A;  4LYI A;  3SVF A;  5H1U A;  5D3S A;  4TU6 A;  5ENE A;  4UYH A;  4CUR A;  2LSP B;  4QSV A;  5I7Y A;  5IGK A;  5HJC A;  5EPR A;  4A9L A;  5C7N A;  5EVA A;  5I40 A;  5FG4 A;  5F62 A;  3O36 A;  4YYD A;  4O70 A;  4Z6I A;  4PY6 A;  4UYE A;  4HXR A;  5E7D A;  2L84 A;  4HXO A;  4J0R A;  5F5Z A;  5H1V A;  4LZR A;  5FE5 A;  4N4I A;  5CQ4 A;  4MR6 A;  5CUB A;  2FSA A;  5FE1 A;  4Z1Q A;  4ALH A;  4MR4 A;  4CL9 A;  4QSR A;  3JVM A;  5DYA A;  5IGN A;  5CQ6 A;  5FDZ A;  4GPJ A;  4TS8 A;  4O71 A;  3ZYU A;  5EP7 A;  5K29 A;  5L99 A;  3U5N A;  3I3J A;  3MB4 A;  4J1P A;  4O76 A;  4YAD A;  4CUT A;  3HME A;  2DAT A;  4YBT A;  5E9L A;  4LZ2 A;  4O7C A;  5F63 A;  5FE9 A;  3S91 A;  5LJ0 A;  3HMF A;  4KV1 A;  4O7F A;  5ENG A;  3SVH A;  4OGJ A;  5E9V A;  5HCL A;  4QYD A;  5A5O A;  4HXN A;  2L5E A;  5E0R A;  5FFY A;  4UYG A;  3P1F A;  5I7X A;  5I83 A;  5A83 A;  5CY9 A;  5D24 A;  5DW1 A;  5EIC A;  5DLX A;  5I29 A;  1N72 A;  1E6I A;  2RI7 A;  4NR6 A;  4TT2 A;  5LKX A;  4CUS A;  4A9F A;  4MR3 A;  5I1Q A;  4Z1S A;  3LXJ A;  3O35 A;  4YYG A;  5CQ3 A;  5E9Y A;  3O37 A;  3ONI A;  5EWC A;  5EGU A;  4HXK A;  3O34 A;  4QSS A;  5KHM A;  4IOQ A;  5FFV A;  4UIT A;  5E3G A;  5HQ5 A;  5CPE A;  5LJ1 A;  4QNS A;  4Q0O A;  5CZG A;  3P1C A;  5I86 A;  4PTB A;  4CLB A;  2DVV A;  5CQ7 A;  4NXJ A;  5HRW A;  5H85 A;  2I7K A;  5FE0 A;  4BW1 A;  5HM0 A;  5DKD A;  4XY9 A;  5C8G A;  5IBN A;  4O74 A;  4Z6H A;  3QZS A;  5ETB A;  5F2P A;  4OUF A;  4YYJ A;  5JWM A;  2GRC A;  5DKC A;  3O33 A;  5ENF A;  5DLZ A;  2NXB A;  4WHU A;  5FH7 A;  4BJX A;  4BW3 A;  5LKU A;  5EM3 A;  5HRX A;  1JM4 B;  4QSW A;  4IR6 A;  4YYM A;  3UVD A;  4NRB A;  5IG6 A;  4A9H A;  5EWD A;  5LVQ A;  2RO1 A;  5FE6 A;  2E7O A;  5IID A;  4NR9 A;  5FB1 A;  5BT5 A;  4Z93 A;  2OSS A;  5D3P A;  1WUG A;  4FLP A;  4O78 A;  4YY6 A;  3UV4 A;  4YBS A;  5CUA A;  4NQN A;  4XYA A;  5D25 A;  5DKH A;  4A9I A;  4NRC A;  5AD3 A;  2R0V A;  4LDF A;  5I89 A;  5DFC A;  4NYX A;  4QEU A;  3P1D A;  5HEN A;  4F3I A;  4A9N A;  4NYV A;  3MUK A;  3QZV A;  2MJV B;  2DVQ A;  2DVR A;  4NUD A;  4YYN A;  3JVL A;  1X0J A;  2L85 A;  5L98 A;  4IR4 A;  4IR3 A;  5F25 A;  3NXB A;  5II1 A;  4BW2 A;  3U5K A;  5EWV A;  3LQH A;  5E74 A;  5CU8 A;  4N4G A;  5D26 A;  2RNY A;  5E9M A;  3LQJ A;  4QR3 A;  4CFK A;  4TQN A;  4YYH A;  5LKZ A;  5A82 A;  5AME A;  4A9M A;  2YEK A;  5EU1 A;  4WHW A;  2F6J A;  5KTU A;  2R0Y A;  4MEQ A;  3TLP A;  5D7X A;  3HMH A;  4ZQL A;  4NR7 A;  5DYC A;  1WUM A;  5EIS A;  1ZS5 A;  4HBX A;  5E3D A;  4IOR A;  4UIU A;  4NS5 A;  4YAB A;  4QSP A;  5CUE A;  5I80 A;  4J0S A;  4HBY A;  4QBM A;  5D3J A;  4A9J A;  4NR8 A;  4MEP A;  4O7E A;  4TT6 A;  4TU4 A;  2RFJ A;  4E96 A;  4RVR A;  4MEO A;  5A5Q A;  4TZ8 A;  4XUB A;  5HQ6 A;  5FBX A;  5D3L A;  5HEL A;  5JI8 A;  4TT4 A;  5L96 A;  4O72 A;  4O7A A;  4C66 A;  5A5S A;  5A7C A;  4TZ2 A;  5FFW A;  3UVX A;  4QST A;  2D82 A;  3D7C A;  4IR5 A;  5DX4 A;  4QR5 A;  4O7B A;  5HRV A;  3DAI A;  2E7N A;  2WP2 A;  4LZS A;  5CUG A;  5A81 A;  5TB6 A;  5A5R A;  5ACY A;  5LUU A;  4UIZ A;  5CGP A;  5J0D A;  3SVG A;  5F36 A;  5HLS A;  4UYF B;  3Q2E A;  5FG5 A;  5G4R A;  2R10 A;  4NUE A;  4A9K A;  3MUL A;  5C4Q A;  5I88 A;  5L97 A;  5HFR A;  5L8T A;  4NYW A;  5IGM A;  5F1L A;  5EWW A;  5CQT A;  4A9E A;  5D3T A;  2G4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...