2DVSA

Crystal structure analysis of the n-terminal bromodomain of human brd2 complexed with acetylated histone h4 peptide
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
GRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords bromodomain-containing protein 2
publication title Structural Basis for Acetylated Histone H4 Recognition by the Human BRD2 Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2dvsA00
4PCIA 4UYDA 4GPJA 2YEKA 4HXRA 5AMEA 4N3WA 5CS8A 4A9HA 5D3SA 5C89A 5F62A 4J0SA 3MQMA 2R0VA 5EV9A 5HFRA 5BT5A 5HLSA 5EP7A 4YY6A 4LR6A 2F6NA 4YBTA 4QR4A 5I83A 4NUDA 5IG6A 5AD3A 4UYHA 5HCLA 5CQAA 4O75A 3SVGA 4A9IA 2RNXA 5A5RA 4TYLA 3U5MA 3G0LA 5A81A 4CFLA 5KU3A 3AQAA 3U5LA 3S92A 2FSAA 5F63A 2DVRA 5E9VA 3UVXA 5AD2A 5G4SA 4Z6HA 5I7YA 5LJ2A 5L8UA 2L84A 5CQ7A 4NYWA 4UYEA 3QZVA 5DYAA 5ENFA 2DWWA 5D0CA 4XY9A 3DAIA 5FFWA 3O35A 5IGMA 1JM4B 2OSSA 5D3JA 2WP1A 3O37A 3SVFA 3I3JA 5ENHA 5ETDA 3UW9A 5A5NA 3HMFA 5ENJA 3TLPA 5BT4A 4O76A 5L8TA 4YYJA 2R0SA 2D9EA 5A82A 5G4RA 4NQNA 5DKHA 4HXPA 5CUCA 5KO4A 3HMEA 5I80A 3UVWA 5CU8A 4MEQA 3IU6A 4NS5A 4BW1A 5A85A 3LQJA 3MXFA 3DWYA 5CP5A 3K2JA 4XY8A 5DYCA 4YATA 5EPRA 2I8NA 5I40A 4YH3A 4Y03A 5FG6A 3QZSA 5LVRA 4NRBA 5A5PA 4NR4A 4QY4A 5E74A 1JSPB 4QSVA 2NXBA 5CQ3A 4QSPA 4TQNA 5E9YA 5IIDA 5HRXA 3IU5A 4QC3A 2RFJA 5ENIA 4YK0A 3GG3A 4O74A 4TZ8A 5CUBA 5COIA 4PCEA 4O7EA 3LXJA 5FE0A 4QSWA 4Q0NA 2G4AA 5FH8A 4QYLA 2R0YA 4NYVA 4IR5A 5LKZA 4TT2A 2YEMA 4KCXA 4QSRA 2I7KA 2H60A 5CFWA 3UV4A 4OUFA 2YDWA 3AADA 4UIXA 5ENEA 5F2PA 1EQFA 5IGKA 2R10A 4QBMA 4HBVA 5EVAA 2N9GA 5FB1A 5L96A 1WUGA 5D3LA 4WHWA 2WP2A 4QUUA 4UIVA 5E9KA 5EQ1A 4HBXA 4PY6A 5DKDA 4NYXA 4QSUA 3HMHA 5D3RA 4MEOA 4OGJA 4IR6A 5DLXA 4Z93A 5F1LA 1E6IA 5FE7A 5EPBA 4XYAA 5E9IA 4A9OA 5HEMA 3P1EA 4Q0OA 5ACYA 5CGPA 5C8GA 4UYGA 5HM0A 1X0JA 5EWWA 5DLZA 5F60A 5D3HA 5EWCA 4N4GA 3JVKA 5HRWA 2RNWA 4YYKA 4A9FA 4QYDA 5AMFA 2RO1A 4HXOA 2YELA 4HXLA 5EWHA 5EI4A 4A9LA 4IR4A 4A9KA 3U5OA 2L85A 4MENA 5LUUA 4LC2A 5KTXA 5E73A 4UIWA 5E7DA 3U5PA 5E0RA 5KTUA 4QEWA 2E7NA 4Z1SA 5DFDA 5F36A 5E9LA 5H1UA 5ETBA 5H85A 5HELA 3O33A 4O71A 5FBXA 5C7NA 5CUGA 5CQ8A 4CURA 5JWMA 3Q2FA 4J3IA 5EPSA 5I89A 4LZ2A 4N4IA 4KV1A 4UIZA 5E3DA 4IOOA 4HXSA 4TTEA 4UITA 5DFCA 5LKUA 2GRCA 3G0JA 4MEPA 4MR6A 4LZSA 5EA1A 5FG5A 4NR5A 5LJ0A 4NR8A 3MULA 4NQMA 5I7XA 2KTBB 4QSTA 2YQDA 5A5QA 4C66A 4UYFA 3FKMX 5CUDA 4YBSA 5I1QA 4FLPA 5FFYA 5F61A 4HBYA 5DBMA 3QZTA 4NXJA 4IORA 3D7CA 5FH6A 4HXMA 3O36A 5CRZA 4UYFB 5CQ5A 3MUKA 4MR3A 4TT4A 5C85A 5F25A 5FDZA 4A9MA 5CQTA 5HQ5A 4IOQA 4NUEA 2OUOA 3U5KA 4C67A 5D24A 4CUQA 4CLBA 4QZSA 5HJCA 4NR6A 4NRAA 3ONIA 2DVVA 4QEUA 5D7XA 4BW3A 2DVSA 4LYSA 4ZC9A 5EWVA 5CZGA 4PTBA 4YYMA 5LKTA 5DFBA 2F6JA 4LZRA 4CUPA 3JVMA 5EM3A 5J0DA 4YADA 3UV5A 5H1TA 5LVQA 4O72A 4QSQA 2DATA 4O7CA 5LKXA 5HQ7A 4PKLA 5DYXA 5L98A 1ZS5A 1WUMA 4TZ2A 4NUCA 5D3NA 5HRVA 5E9MA 5EWDA 2YYNA 5II2A 5BT3A 2OO1A 4CUTA 4X2IA 4TU6A 5A5OA 5CQ4A 5FE9A 4MR5A 5KHMA 4A9JA 4F3IA 5CRMA 5DW2A 3JVLA 4CL9A 4YYIA 3LQIA 4N4HA 3P5OA 4QR3A 4WIVA 3JVJA 5FFVA 2D82A 4J0RA 4YH4A 5II1A 5E3GA 4Z1QA 3U5NA 4BHWA 4OGIA 4YYNA 2YW5A 5DX4A 5CTLA 2RNYA 4ZQLA 3RCWA 4YBMA 4HXNA 5CUAA 5FE8A 4HXKA 3U5JA 5A5SA 5JI8A 5F1HA 4TS8A 1N72A 3UV2A 4O78A 2RI7A 4YC9A 4BJXA 4MR4A 4UIUA 2RS9B 4CUUA 5FE5A 4YABA 4N4FA 4YYDA 5CPEA 5F5ZA 5LJ1A 5DYUA 3O34A 4QB3A 5D3TA 3UVYA 5EU1A 4QNSA 4YAXA 5I29A 4DONA 4O77A 3Q2EA 5CUEA 3P1FA 4ALGA 4O7AA 4Z6IA 5FE4A 5FH7A 4YY4A 5HENA 4QC1A 5I88A 1F68A 2DKWA 4LYIA 4E96A 4PS5A 5L97A 4ZW1A 4ALHA 2E7OA 5FG4A 3P1DA 4AKNA 5F3AA 4QSXA 4CFKA 4BW2A 5IGNA 5HQ6A 5C87A 2LSPB 4TT6A 5ENGA 5DY7A 5TCMA 2L5EA 4XUAA 5A7CA 5DW1A 5H1VA 5TB6A 3MB4A 5L99A 3LJWA 4A9EA 5FE3A 5DKCA 4LRGA 3UVDA 4QUTA 4A9NA 5IGLA 4QEVA 4J1PA 4YYHA 4IR3A 3SVHA 5HFQA 5FE6A 4NR9A 2E3KA 3P1CA 4RVRA 3ZYUA 4KV4A 4TU4A 4XUBA 5EICA 5EGUA 5FE2A 5CQ6A 5D25A 3NXBA 4O70A 4YYGA 4UIYA 5ENBA 5KTWA 4NRCA 4QR5A 5EISA 5FB0A 5C4QA 3MB3A 4QSSA 2DVQA 5IBNA 4LYWA 5K29A 3LQHA 5ENCA 4NR7A 4LDFA 5I86A 4CUSA 5FE1A 4HBWA 4BW4A 4WHUA 4O7FA 2MJVB 5EK9A 5CY9A 5A83A 4O7BA 3S91A 5D3PA 5D26A
chains in the Genus database with same CATH superfamily
4PCIA 4UYDA 4GPJA 2YEKA 4HXRA 5AMEA 4N3WA 5CS8A 4A9HA 5D3SA 5C89A 5F62A 4J0SA 3MQMA 2R0VA 5EV9A 5HFRA 5BT5A 5HLSA 5EP7A 4YY6A 4LR6A 2F6NA 4YBTA 4QR4A 5I83A 4NUDA 5IG6A 5AD3A 4UYHA 5HCLA 5CQAA 4O75A 3SVGA 4A9IA 2RNXA 5A5RA 4TYLA 3U5MA 3G0LA 5A81A 4CFLA 5KU3A 4AKHA 3AQAA 3U5LA 3S92A 2FSAA 5F63A 2DVRA 5E9VA 3UVXA 5AD2A 5G4SA 4Z6HA 5I7YA 5LJ2A 5L8UA 2L84A 5CQ7A 4NYWA 4UYEA 3QZVA 5DYAA 5ENFA 2DWWA 5D0CA 4XY9A 3DAIA 5FFWA 3O35A 5IGMA 1JM4B 2OSSA 5D3JA 2WP1A 3O37A 3SVFA 3I3JA 5ENHA 5ETDA 3UW9A 5A5NA 1ZKRA 3HMFA 5ENJA 3TLPA 5BT4A 4O76A 5L8TA 4YYJA 2R0SA 2D9EA 5A82A 5G4RA 4NQNA 5DKHA 4HXPA 5CUCA 5KO4A 3HMEA 5I80A 3UVWA 5CU8A 4MEQA 3IU6A 4NS5A 4BW1A 5A85A 3LQJA 3MXFA 3DWYA 5CP5A 3K2JA 4XY8A 5DYCA 4YATA 5EPRA 2I8NA 5I40A 4YH3A 4Y03A 5FG6A 3QZSA 5LVRA 4NRBA 5A5PA 4NR4A 4QY4A 5E74A 1JSPB 4QSVA 2NXBA 5CQ3A 4QSPA 4TQNA 5E9YA 5IIDA 5HRXA 3IU5A 4QC3A 2RFJA 5ENIA 4YK0A 3GG3A 4O74A 4TZ8A 5CUBA 5COIA 4PCEA 1PUOA 4O7EA 3LXJA 5FE0A 4QSWA 4Q0NA 2G4AA 5FH8A 4QYLA 2R0YA 4NYVA 4IR5A 5LKZA 4TT2A 2YEMA 4KCXA 4QSRA 2I7KA 2H60A 5CFWA 3UV4A 4OUFA 2YDWA 3AADA 4UIXA 5ENEA 5F2PA 1EQFA 5IGKA 2R10A 4QBMA 4HBVA 5EVAA 2N9GA 5FB1A 5L96A 1WUGA 5D3LA 3VKGA 4WHWA 2WP2A 4QUUA 4UIVA 5E9KA 5EQ1A 4HBXA 4PY6A 5DKDA 4NYXA 4QSUA 3HMHA 5D3RA 4MEOA 4OGJA 4IR6A 5DLXA 4Z93A 5F1LA 1E6IA 5FE7A 5EPBA 4XYAA 5E9IA 4A9OA 5HEMA 3P1EA 4Q0OA 5ACYA 5CGPA 5C8GA 4UYGA 5HM0A 1X0JA 5EWWA 5DLZA 5F60A 5D3HA 5EWCA 4N4GA 3JVKA 5HRWA 2RNWA 4YYKA 4A9FA 4QYDA 5AMFA 2RO1A 4HXOA 2YELA 4HXLA 5EWHA 4AKIA 5EI4A 4A9LA 4IR4A 4A9KA 3U5OA 2L85A 4MENA 5LUUA 4LC2A 5KTXA 5E73A 4UIWA 5E7DA 3U5PA 3D1BA 5E0RA 5KTUA 4QEWA 2E7NA 4Z1SA 5DFDA 5F36A 5E9LA 5H1UA 5ETBA 5H85A 5HELA 3O33A 4O71A 5FBXA 5C7NA 5CUGA 5CQ8A 4CURA 5JWMA 3Q2FA 4J3IA 5EPSA 5I89A 4LZ2A 4N4IA 4KV1A 4UIZA 5E3DA 4IOOA 4HXSA 4TTEA 4UITA 5DFCA 5LKUA 2GRCA 3G0JA 4MEPA 4MR6A 4LZSA 5EA1A 5FG5A 4NR5A 5LJ0A 4NR8A 3MULA 4NQMA 5I7XA 2KTBB 4QSTA 2YQDA 5A5QA 4C66A 4UYFA 3FKMX 5CUDA 4YBSA 5I1QA 4FLPA 5FFYA 5F61A 4HBYA 5DBMA 3QZTA 4NXJA 4IORA 3D7CA 5FH6A 4HXMA 3O36A 5CRZA 4UYFB 5CQ5A 3MUKA 4MR3A 4TT4A 5C85A 5F25A 5FDZA 4A9MA 5CQTA 5HQ5A 4IOQA 4NUEA 2OUOA 3U5KA 4C67A 5D24A 4CUQA 4CLBA 4QZSA 5HJCA 4NR6A 4NRAA 3ONIA 2DVVA 4QEUA 5D7XA 3ERRA 4BW3A 2DVSA 4LYSA 2EJNA 4ZC9A 4AKGA 5EWVA 5CZGA 4PTBA 4YYMA 5LKTA 5DFBA 2F6JA 4LZRA 4CUPA 3JVMA 5EM3A 5J0DA 4YADA 3UV5A 5H1TA 5LVQA 4O72A 4QSQA 2DATA 4O7CA 5LKXA 5HQ7A 4PKLA 5DYXA 5L98A 1ZS5A 1WUMA 4TZ2A 4NUCA 5D3NA 5HRVA 5E9MA 5EWDA 2YYNA 5II2A 5BT3A 2OO1A 3VKHA 4CUTA 4X2IA 4TU6A 5A5OA 5CQ4A 5FE9A 4MR5A 5KHMA 4A9JA 4F3IA 5CRMA 5DW2A 3JVLA 4CL9A 4YYIA 3LQIA 4N4HA 3P5OA 4QR3A 4WIVA 3JVJA 3D1DA 5FFVA 2D82A 4J0RA 4YH4A 5II1A 4AI6A 5E3GA 4Z1QA 3U5NA 4BHWA 4OGIA 4YYNA 2YW5A 5DX4A 5CTLA 2RNYA 4ZQLA 3RCWA 4YBMA 4HXNA 5CUAA 5FE8A 4HXKA 3U5JA 5A5SA 5JI8A 5F1HA 4TS8A 1N72A 3UV2A 4O78A 2RI7A 4YC9A 4BJXA 4MR4A 4UIUA 2RS9B 4CUUA 5FE5A 4YABA 4N4FA 4YYDA 5CPEA 5F5ZA 5LJ1A 5DYUA 3O34A 4QB3A 5D3TA 3UVYA 5EU1A 4QNSA 4YAXA 5I29A 4DONA 4O77A 3Q2EA 5CUEA 3P1FA 4ALGA 4O7AA 4Z6IA 5FE4A 5FH7A 4YY4A 5HENA 4QC1A 5I88A 1F68A 2DKWA 4LYIA 4E96A 4PS5A 5L97A 4ZW1A 4ALHA 2E7OA 5FG4A 3P1DA 4AKNA 5F3AA 4QSXA 4CFKA 4BW2A 5IGNA 5HQ6A 5C87A 2LSPB 4TT6A 5ENGA 5DY7A 5TCMA 2L5EA 4XUAA 5A7CA 5DW1A 5H1VA 5TB6A 3MB4A 5L99A 3LJWA 4A9EA 5FE3A 5DKCA 4LRGA 3UVDA 4QUTA 4A9NA 5IGLA 4QEVA 4J1PA 4YYHA 4IR3A 3SVHA 5HFQA 5FE6A 4NR9A 2E3KA 3P1CA 4RVRA 3ZYUA 4KV4A 4TU4A 4XUBA 5EICA 5EGUA 5FE2A 5CQ6A 5D25A 3NXBA 4O70A 4YYGA 4UIYA 5ENBA 5KTWA 4NRCA 4QR5A 5EISA 5FB0A 5C4QA 3MB3A 4QSSA 2DVQA 5IBNA 4LYWA 5K29A 3LQHA 5ENCA 4NR7A 4LDFA 5I86A 4CUSA 5FE1A 4HBWA 4BW4A 4WHUA 4O7FA 2MJVB 5EK9A 5CY9A 5A83A 4O7BA 3S91A 5D3PA 5D26A
chains in the Genus database with same CATH topology
4PCIA 4UYDA 4GPJA 2YEKA 4HXRA 5AMEA 4N3WA 5CS8A 4A9HA 5D3SA 5C89A 5F62A 4J0SA 3MQMA 2R0VA 5EV9A 5HFRA 5BT5A 5HLSA 5EP7A 4YY6A 4LR6A 2F6NA 4YBTA 4QR4A 5I83A 4NUDA 5IG6A 5AD3A 4UYHA 5HCLA 5CQAA 4O75A 3SVGA 4A9IA 2RNXA 5A5RA 4TYLA 3U5MA 3G0LA 5A81A 4CFLA 5KU3A 3AQAA 3U5LA 3S92A 2FSAA 5F63A 2DVRA 5E9VA 3UVXA 5AD2A 5G4SA 4Z6HA 5I7YA 5LJ2A 5L8UA 2L84A 5CQ7A 4NYWA 4UYEA 3QZVA 5DYAA 5ENFA 2DWWA 5D0CA 4XY9A 3DAIA 5FFWA 3O35A 5IGMA 1JM4B 2OSSA 5D3JA 2WP1A 3O37A 3SVFA 3I3JA 5ENHA 5ETDA 3UW9A 5A5NA 3HMFA 5ENJA 3TLPA 5BT4A 4O76A 5L8TA 4YYJA 2R0SA 2D9EA 5A82A 5G4RA 4NQNA 5DKHA 4HXPA 5CUCA 5KO4A 3HMEA 5I80A 3UVWA 5CU8A 4MEQA 3IU6A 4NS5A 4BW1A 5A85A 3LQJA 3MXFA 3DWYA 5CP5A 3K2JA 4XY8A 5DYCA 4YATA 5EPRA 2I8NA 5I40A 4YH3A 4Y03A 5FG6A 3QZSA 5LVRA 4NRBA 5A5PA 4NR4A 4QY4A 5E74A 1JSPB 4QSVA 2NXBA 5CQ3A 4QSPA 4TQNA 5E9YA 5IIDA 5HRXA 3IU5A 4QC3A 2RFJA 5ENIA 4YK0A 3GG3A 4O74A 4TZ8A 5CUBA 5COIA 4PCEA 4O7EA 3LXJA 5FE0A 4QSWA 4Q0NA 2G4AA 5FH8A 4QYLA 2R0YA 4NYVA 4IR5A 5LKZA 4TT2A 2YEMA 4KCXA 4QSRA 2I7KA 2H60A 5CFWA 3UV4A 4OUFA 2YDWA 3AADA 4UIXA 5ENEA 5F2PA 1EQFA 5IGKA 2R10A 4QBMA 4HBVA 5EVAA 2N9GA 5FB1A 5L96A 1WUGA 5D3LA 4WHWA 2WP2A 4QUUA 4UIVA 5E9KA 5EQ1A 4HBXA 4PY6A 5DKDA 4NYXA 4QSUA 3HMHA 5D3RA 4MEOA 4OGJA 4IR6A 5DLXA 4Z93A 5F1LA 1E6IA 5FE7A 5EPBA 4XYAA 5E9IA 4A9OA 5HEMA 3P1EA 4Q0OA 5ACYA 5CGPA 5C8GA 4UYGA 5HM0A 1X0JA 5EWWA 5DLZA 5F60A 5D3HA 5EWCA 4N4GA 3JVKA 5HRWA 2RNWA 4YYKA 4A9FA 4QYDA 5AMFA 2RO1A 4HXOA 2YELA 4HXLA 5EWHA 5EI4A 4A9LA 4IR4A 4A9KA 3U5OA 2L85A 4MENA 5LUUA 4LC2A 5KTXA 5E73A 4UIWA 5E7DA 3U5PA 5E0RA 5KTUA 4QEWA 2E7NA 4Z1SA 5DFDA 5F36A 5E9LA 5H1UA 5ETBA 5H85A 5HELA 3O33A 4O71A 5FBXA 5C7NA 5CUGA 5CQ8A 4CURA 5JWMA 3Q2FA 4J3IA 5EPSA 5I89A 4LZ2A 4N4IA 4KV1A 4UIZA 5E3DA 4IOOA 4HXSA 4TTEA 4UITA 5DFCA 5LKUA 2GRCA 3G0JA 4MEPA 4MR6A 4LZSA 5EA1A 5FG5A 4NR5A 5LJ0A 4NR8A 3MULA 4NQMA 5I7XA 2KTBB 4QSTA 2YQDA 5A5QA 4C66A 4UYFA 3FKMX 5CUDA 4YBSA 5I1QA 4FLPA 5FFYA 5F61A 4HBYA 5DBMA 3QZTA 4NXJA 4IORA 3D7CA 5FH6A 4HXMA 3O36A 5CRZA 4UYFB 5CQ5A 3MUKA 4MR3A 4TT4A 5C85A 5F25A 5FDZA 4A9MA 5CQTA 5HQ5A 4IOQA 4NUEA 2OUOA 3U5KA 4C67A 5D24A 4CUQA 4CLBA 4QZSA 5HJCA 4NR6A 4NRAA 3ONIA 2DVVA 4QEUA 5D7XA 4BW3A 2DVSA 4LYSA 4ZC9A 5EWVA 5CZGA 4PTBA 4YYMA 5LKTA 5DFBA 2F6JA 4LZRA 4CUPA 3JVMA 5EM3A 5J0DA 4YADA 3UV5A 5H1TA 5LVQA 4O72A 4QSQA 2DATA 4O7CA 5LKXA 5HQ7A 4PKLA 5DYXA 5L98A 1ZS5A 1WUMA 4TZ2A 4NUCA 5D3NA 5HRVA 5E9MA 5EWDA 2YYNA 5II2A 5BT3A 2OO1A 4CUTA 4X2IA 4TU6A 5A5OA 5CQ4A 5FE9A 4MR5A 5KHMA 4A9JA 4F3IA 5CRMA 5DW2A 3JVLA 4CL9A 4YYIA 3LQIA 4N4HA 3P5OA 4QR3A 4WIVA 3JVJA 5FFVA 2D82A 4J0RA 4YH4A 5II1A 5E3GA 4Z1QA 3U5NA 4BHWA 4OGIA 4YYNA 2YW5A 5DX4A 5CTLA 2RNYA 4ZQLA 3RCWA 4YBMA 4HXNA 5CUAA 5FE8A 4HXKA 3U5JA 5A5SA 5JI8A 5F1HA 4TS8A 1N72A 3UV2A 4O78A 2RI7A 4YC9A 4BJXA 4MR4A 4UIUA 2RS9B 4CUUA 5FE5A 4YABA 4N4FA 4YYDA 5CPEA 5F5ZA 5LJ1A 5DYUA 3O34A 4QB3A 5D3TA 3UVYA 5EU1A 4QNSA 4YAXA 5I29A 4DONA 4O77A 3Q2EA 5CUEA 3P1FA 4ALGA 4O7AA 4Z6IA 5FE4A 5FH7A 4YY4A 5HENA 4QC1A 5I88A 1F68A 2DKWA 4LYIA 4E96A 4PS5A 5L97A 4ZW1A 4ALHA 2E7OA 5FG4A 3P1DA 4AKNA 5F3AA 4QSXA 4CFKA 4BW2A 5IGNA 5HQ6A 5C87A 2LSPB 4TT6A 5ENGA 5DY7A 5TCMA 2L5EA 4XUAA 5A7CA 5DW1A 5H1VA 5TB6A 3MB4A 5L99A 3LJWA 4A9EA 5FE3A 5DKCA 4LRGA 3UVDA 4QUTA 4A9NA 5IGLA 4QEVA 4J1PA 4YYHA 4IR3A 3SVHA 5HFQA 5FE6A 4NR9A 2E3KA 3P1CA 4RVRA 3ZYUA 4KV4A 4TU4A 4XUBA 5EICA 5EGUA 5FE2A 5CQ6A 5D25A 3NXBA 4O70A 4YYGA 4UIYA 5ENBA 5KTWA 4NRCA 4QR5A 5EISA 5FB0A 5C4QA 3MB3A 4QSSA 2DVQA 5IBNA 4LYWA 5K29A 3LQHA 5ENCA 4NR7A 4LDFA 5I86A 4CUSA 5FE1A 4HBWA 4BW4A 4WHUA 4O7FA 2MJVB 5EK9A 5CY9A 5A83A 4O7BA 3S91A 5D3PA 5D26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PCI A;  4UYD A;  4GPJ A;  2YEK A;  4HXR A;  5AME A;  4N3W A;  5CS8 A;  4A9H A;  5D3S A;  5C89 A;  5F62 A;  4J0S A;  3MQM A;  2R0V A;  5EV9 A;  5HFR A;  5BT5 A;  5HLS A;  5EP7 A;  4YY6 A;  4LR6 A;  2F6N A;  4YBT A;  4QR4 A;  5I83 A;  4NUD A;  5IG6 A;  5AD3 A;  4UYH A;  5HCL A;  5CQA A;  4O75 A;  3SVG A;  4A9I A;  2RNX A;  5A5R A;  4TYL A;  3U5M A;  3G0L A;  5A81 A;  4CFL A;  5KU3 A;  3AQA A;  3U5L A;  3S92 A;  2FSA A;  5F63 A;  2DVR A;  5E9V A;  3UVX A;  5AD2 A;  5G4S A;  4Z6H A;  5I7Y A;  5LJ2 A;  5L8U A;  2L84 A;  5CQ7 A;  4NYW A;  4UYE A;  3QZV A;  5DYA A;  5ENF A;  2DWW A;  5D0C A;  4XY9 A;  3DAI A;  5FFW A;  3O35 A;  5IGM A;  1JM4 B;  2OSS A;  5D3J A;  2WP1 A;  3O37 A;  3SVF A;  3I3J A;  5ENH A;  5ETD A;  3UW9 A;  5A5N A;  3HMF A;  5ENJ A;  3TLP A;  5BT4 A;  4O76 A;  5L8T A;  4YYJ A;  2R0S A;  2D9E A;  5A82 A;  5G4R A;  4NQN A;  5DKH A;  4HXP A;  5CUC A;  5KO4 A;  3HME A;  5I80 A;  3UVW A;  5CU8 A;  4MEQ A;  3IU6 A;  4NS5 A;  4BW1 A;  5A85 A;  3LQJ A;  3MXF A;  3DWY A;  5CP5 A;  3K2J A;  4XY8 A;  5DYC A;  4YAT A;  5EPR A;  2I8N A;  5I40 A;  4YH3 A;  4Y03 A;  5FG6 A;  3QZS A;  5LVR A;  4NRB A;  5A5P A;  4NR4 A;  4QY4 A;  5E74 A;  1JSP B;  4QSV A;  2NXB A;  5CQ3 A;  4QSP A;  4TQN A;  5E9Y A;  5IID A;  5HRX A;  3IU5 A;  4QC3 A;  2RFJ A;  5ENI A;  4YK0 A;  3GG3 A;  4O74 A;  4TZ8 A;  5CUB A;  5COI A;  4PCE A;  4O7E A;  3LXJ A;  5FE0 A;  4QSW A;  4Q0N A;  2G4A A;  5FH8 A;  4QYL A;  2R0Y A;  4NYV A;  4IR5 A;  5LKZ A;  4TT2 A;  2YEM A;  4KCX A;  4QSR A;  2I7K A;  2H60 A;  5CFW A;  3UV4 A;  4OUF A;  2YDW A;  3AAD A;  4UIX A;  5ENE A;  5F2P A;  1EQF A;  5IGK A;  2R10 A;  4QBM A;  4HBV A;  5EVA A;  2N9G A;  5FB1 A;  5L96 A;  1WUG A;  5D3L A;  4WHW A;  2WP2 A;  4QUU A;  4UIV A;  5E9K A;  5EQ1 A;  4HBX A;  4PY6 A;  5DKD A;  4NYX A;  4QSU A;  3HMH A;  5D3R A;  4MEO A;  4OGJ A;  4IR6 A;  5DLX A;  4Z93 A;  5F1L A;  1E6I A;  5FE7 A;  5EPB A;  4XYA A;  5E9I A;  4A9O A;  5HEM A;  3P1E A;  4Q0O A;  5ACY A;  5CGP A;  5C8G A;  4UYG A;  5HM0 A;  1X0J A;  5EWW A;  5DLZ A;  5F60 A;  5D3H A;  5EWC A;  4N4G A;  3JVK A;  5HRW A;  2RNW A;  4YYK A;  4A9F A;  4QYD A;  5AMF A;  2RO1 A;  4HXO A;  2YEL A;  4HXL A;  5EWH A;  5EI4 A;  4A9L A;  4IR4 A;  4A9K A;  3U5O A;  2L85 A;  4MEN A;  5LUU A;  4LC2 A;  5KTX A;  5E73 A;  4UIW A;  5E7D A;  3U5P A;  5E0R A;  5KTU A;  4QEW A;  2E7N A;  4Z1S A;  5DFD A;  5F36 A;  5E9L A;  5H1U A;  5ETB A;  5H85 A;  5HEL A;  3O33 A;  4O71 A;  5FBX A;  5C7N A;  5CUG A;  5CQ8 A;  4CUR A;  5JWM A;  3Q2F A;  4J3I A;  5EPS A;  5I89 A;  4LZ2 A;  4N4I A;  4KV1 A;  4UIZ A;  5E3D A;  4IOO A;  4HXS A;  4TTE A;  4UIT A;  5DFC A;  5LKU A;  2GRC A;  3G0J A;  4MEP A;  4MR6 A;  4LZS A;  5EA1 A;  5FG5 A;  4NR5 A;  5LJ0 A;  4NR8 A;  3MUL A;  4NQM A;  5I7X A;  2KTB B;  4QST A;  2YQD A;  5A5Q A;  4C66 A;  4UYF A;  3FKM X;  5CUD A;  4YBS A;  5I1Q A;  4FLP A;  5FFY A;  5F61 A;  4HBY A;  5DBM A;  3QZT A;  4NXJ A;  4IOR A;  3D7C A;  5FH6 A;  4HXM A;  3O36 A;  5CRZ A;  4UYF B;  5CQ5 A;  3MUK A;  4MR3 A;  4TT4 A;  5C85 A;  5F25 A;  5FDZ A;  4A9M A;  5CQT A;  5HQ5 A;  4IOQ A;  4NUE A;  2OUO A;  3U5K A;  4C67 A;  5D24 A;  4CUQ A;  4CLB A;  4QZS A;  5HJC A;  4NR6 A;  4NRA A;  3ONI A;  2DVV A;  4QEU A;  5D7X A;  4BW3 A;  2DVS A;  4LYS A;  4ZC9 A;  5EWV A;  5CZG A;  4PTB A;  4YYM A;  5LKT A;  5DFB A;  2F6J A;  4LZR A;  4CUP A;  3JVM A;  5EM3 A;  5J0D A;  4YAD A;  3UV5 A;  5H1T A;  5LVQ A;  4O72 A;  4QSQ A;  2DAT A;  4O7C A;  5LKX A;  5HQ7 A;  4PKL A;  5DYX A;  5L98 A;  1ZS5 A;  1WUM A;  4TZ2 A;  4NUC A;  5D3N A;  5HRV A;  5E9M A;  5EWD A;  2YYN A;  5II2 A;  5BT3 A;  2OO1 A;  4CUT A;  4X2I A;  4TU6 A;  5A5O A;  5CQ4 A;  5FE9 A;  4MR5 A;  5KHM A;  4A9J A;  4F3I A;  5CRM A;  5DW2 A;  3JVL A;  4CL9 A;  4YYI A;  3LQI A;  4N4H A;  3P5O A;  4QR3 A;  4WIV A;  3JVJ A;  5FFV A;  2D82 A;  4J0R A;  4YH4 A;  5II1 A;  5E3G A;  4Z1Q A;  3U5N A;  4BHW A;  4OGI A;  4YYN A;  2YW5 A;  5DX4 A;  5CTL A;  2RNY A;  4ZQL A;  3RCW A;  4YBM A;  4HXN A;  5CUA A;  5FE8 A;  4HXK A;  3U5J A;  5A5S A;  5JI8 A;  5F1H A;  4TS8 A;  1N72 A;  3UV2 A;  4O78 A;  2RI7 A;  4YC9 A;  4BJX A;  4MR4 A;  4UIU A;  2RS9 B;  4CUU A;  5FE5 A;  4YAB A;  4N4F A;  4YYD A;  5CPE A;  5F5Z A;  5LJ1 A;  5DYU A;  3O34 A;  4QB3 A;  5D3T A;  3UVY A;  5EU1 A;  4QNS A;  4YAX A;  5I29 A;  4DON A;  4O77 A;  3Q2E A;  5CUE A;  3P1F A;  4ALG A;  4O7A A;  4Z6I A;  5FE4 A;  5FH7 A;  4YY4 A;  5HEN A;  4QC1 A;  5I88 A;  1F68 A;  2DKW A;  4LYI A;  4E96 A;  4PS5 A;  5L97 A;  4ZW1 A;  4ALH A;  2E7O A;  5FG4 A;  3P1D A;  4AKN A;  5F3A A;  4QSX A;  4CFK A;  4BW2 A;  5IGN A;  5HQ6 A;  5C87 A;  2LSP B;  4TT6 A;  5ENG A;  5DY7 A;  5TCM A;  2L5E A;  4XUA A;  5A7C A;  5DW1 A;  5H1V A;  5TB6 A;  3MB4 A;  5L99 A;  3LJW A;  4A9E A;  5FE3 A;  5DKC A;  4LRG A;  3UVD A;  4QUT A;  4A9N A;  5IGL A;  4QEV A;  4J1P A;  4YYH A;  4IR3 A;  3SVH A;  5HFQ A;  5FE6 A;  4NR9 A;  2E3K A;  3P1C A;  4RVR A;  3ZYU A;  4KV4 A;  4TU4 A;  4XUB A;  5EIC A;  5EGU A;  5FE2 A;  5CQ6 A;  5D25 A;  3NXB A;  4O70 A;  4YYG A;  4UIY A;  5ENB A;  5KTW A;  4NRC A;  4QR5 A;  5EIS A;  5FB0 A;  5C4Q A;  3MB3 A;  4QSS A;  2DVQ A;  5IBN A;  4LYW A;  5K29 A;  3LQH A;  5ENC A;  4NR7 A;  4LDF A;  5I86 A;  4CUS A;  5FE1 A;  4HBW A;  4BW4 A;  4WHU A;  4O7F A;  2MJV B;  5EK9 A;  5CY9 A;  5A83 A;  4O7B A;  3S91 A;  5D3P A;  5D26 A; 
#chains in the Genus database with same CATH topology
 4PCI A;  4UYD A;  4GPJ A;  2YEK A;  4HXR A;  5AME A;  4N3W A;  5CS8 A;  4A9H A;  5D3S A;  5C89 A;  5F62 A;  4J0S A;  3MQM A;  2R0V A;  5EV9 A;  5HFR A;  5BT5 A;  5HLS A;  5EP7 A;  4YY6 A;  4LR6 A;  2F6N A;  4YBT A;  4QR4 A;  5I83 A;  4NUD A;  5IG6 A;  5AD3 A;  4UYH A;  5HCL A;  5CQA A;  4O75 A;  3SVG A;  4A9I A;  2RNX A;  5A5R A;  4TYL A;  3U5M A;  3G0L A;  5A81 A;  4CFL A;  5KU3 A;  4AKH A;  3AQA A;  3U5L A;  3S92 A;  2FSA A;  5F63 A;  2DVR A;  5E9V A;  3UVX A;  5AD2 A;  5G4S A;  4Z6H A;  5I7Y A;  5LJ2 A;  5L8U A;  2L84 A;  5CQ7 A;  4NYW A;  4UYE A;  3QZV A;  5DYA A;  5ENF A;  2DWW A;  5D0C A;  4XY9 A;  3DAI A;  5FFW A;  3O35 A;  5IGM A;  1JM4 B;  2OSS A;  5D3J A;  2WP1 A;  3O37 A;  3SVF A;  3I3J A;  5ENH A;  5ETD A;  3UW9 A;  5A5N A;  1ZKR A;  3HMF A;  5ENJ A;  3TLP A;  5BT4 A;  4O76 A;  5L8T A;  4YYJ A;  2R0S A;  2D9E A;  5A82 A;  5G4R A;  4NQN A;  5DKH A;  4HXP A;  5CUC A;  5KO4 A;  3HME A;  5I80 A;  3UVW A;  5CU8 A;  4MEQ A;  3IU6 A;  4NS5 A;  4BW1 A;  5A85 A;  3LQJ A;  3MXF A;  3DWY A;  5CP5 A;  3K2J A;  4XY8 A;  5DYC A;  4YAT A;  5EPR A;  2I8N A;  5I40 A;  4YH3 A;  4Y03 A;  5FG6 A;  3QZS A;  5LVR A;  4NRB A;  5A5P A;  4NR4 A;  4QY4 A;  5E74 A;  1JSP B;  4QSV A;  2NXB A;  5CQ3 A;  4QSP A;  4TQN A;  5E9Y A;  5IID A;  5HRX A;  3IU5 A;  4QC3 A;  2RFJ A;  5ENI A;  4YK0 A;  3GG3 A;  4O74 A;  4TZ8 A;  5CUB A;  5COI A;  4PCE A;  1PUO A;  4O7E A;  3LXJ A;  5FE0 A;  4QSW A;  4Q0N A;  2G4A A;  5FH8 A;  4QYL A;  2R0Y A;  4NYV A;  4IR5 A;  5LKZ A;  4TT2 A;  2YEM A;  4KCX A;  4QSR A;  2I7K A;  2H60 A;  5CFW A;  3UV4 A;  4OUF A;  2YDW A;  3AAD A;  4UIX A;  5ENE A;  5F2P A;  1EQF A;  5IGK A;  2R10 A;  4QBM A;  4HBV A;  5EVA A;  2N9G A;  5FB1 A;  5L96 A;  1WUG A;  5D3L A;  3VKG A;  4WHW A;  2WP2 A;  4QUU A;  4UIV A;  5E9K A;  5EQ1 A;  4HBX A;  4PY6 A;  5DKD A;  4NYX A;  4QSU A;  3HMH A;  5D3R A;  4MEO A;  4OGJ A;  4IR6 A;  5DLX A;  4Z93 A;  5F1L A;  1E6I A;  5FE7 A;  5EPB A;  4XYA A;  5E9I A;  4A9O A;  5HEM A;  3P1E A;  4Q0O A;  5ACY A;  5CGP A;  5C8G A;  4UYG A;  5HM0 A;  1X0J A;  5EWW A;  5DLZ A;  5F60 A;  5D3H A;  5EWC A;  4N4G A;  3JVK A;  5HRW A;  2RNW A;  4YYK A;  4A9F A;  4QYD A;  5AMF A;  2RO1 A;  4HXO A;  2YEL A;  4HXL A;  5EWH A;  4AKI A;  5EI4 A;  4A9L A;  4IR4 A;  4A9K A;  3U5O A;  2L85 A;  4MEN A;  5LUU A;  4LC2 A;  5KTX A;  5E73 A;  4UIW A;  5E7D A;  3U5P A;  3D1B A;  5E0R A;  5KTU A;  4QEW A;  2E7N A;  4Z1S A;  5DFD A;  5F36 A;  5E9L A;  5H1U A;  5ETB A;  5H85 A;  5HEL A;  3O33 A;  4O71 A;  5FBX A;  5C7N A;  5CUG A;  5CQ8 A;  4CUR A;  5JWM A;  3Q2F A;  4J3I A;  5EPS A;  5I89 A;  4LZ2 A;  4N4I A;  4KV1 A;  4UIZ A;  5E3D A;  4IOO A;  4HXS A;  4TTE A;  4UIT A;  5DFC A;  5LKU A;  2GRC A;  3G0J A;  4MEP A;  4MR6 A;  4LZS A;  5EA1 A;  5FG5 A;  4NR5 A;  5LJ0 A;  4NR8 A;  3MUL A;  4NQM A;  5I7X A;  2KTB B;  4QST A;  2YQD A;  5A5Q A;  4C66 A;  4UYF A;  3FKM X;  5CUD A;  4YBS A;  5I1Q A;  4FLP A;  5FFY A;  5F61 A;  4HBY A;  5DBM A;  3QZT A;  4NXJ A;  4IOR A;  3D7C A;  5FH6 A;  4HXM A;  3O36 A;  5CRZ A;  4UYF B;  5CQ5 A;  3MUK A;  4MR3 A;  4TT4 A;  5C85 A;  5F25 A;  5FDZ A;  4A9M A;  5CQT A;  5HQ5 A;  4IOQ A;  4NUE A;  2OUO A;  3U5K A;  4C67 A;  5D24 A;  4CUQ A;  4CLB A;  4QZS A;  5HJC A;  4NR6 A;  4NRA A;  3ONI A;  2DVV A;  4QEU A;  5D7X A;  3ERR A;  4BW3 A;  2DVS A;  4LYS A;  2EJN A;  4ZC9 A;  4AKG A;  5EWV A;  5CZG A;  4PTB A;  4YYM A;  5LKT A;  5DFB A;  2F6J A;  4LZR A;  4CUP A;  3JVM A;  5EM3 A;  5J0D A;  4YAD A;  3UV5 A;  5H1T A;  5LVQ A;  4O72 A;  4QSQ A;  2DAT A;  4O7C A;  5LKX A;  5HQ7 A;  4PKL A;  5DYX A;  5L98 A;  1ZS5 A;  1WUM A;  4TZ2 A;  4NUC A;  5D3N A;  5HRV A;  5E9M A;  5EWD A;  2YYN A;  5II2 A;  5BT3 A;  2OO1 A;  3VKH A;  4CUT A;  4X2I A;  4TU6 A;  5A5O A;  5CQ4 A;  5FE9 A;  4MR5 A;  5KHM A;  4A9J A;  4F3I A;  5CRM A;  5DW2 A;  3JVL A;  4CL9 A;  4YYI A;  3LQI A;  4N4H A;  3P5O A;  4QR3 A;  4WIV A;  3JVJ A;  3D1D A;  5FFV A;  2D82 A;  4J0R A;  4YH4 A;  5II1 A;  4AI6 A;  5E3G A;  4Z1Q A;  3U5N A;  4BHW A;  4OGI A;  4YYN A;  2YW5 A;  5DX4 A;  5CTL A;  2RNY A;  4ZQL A;  3RCW A;  4YBM A;  4HXN A;  5CUA A;  5FE8 A;  4HXK A;  3U5J A;  5A5S A;  5JI8 A;  5F1H A;  4TS8 A;  1N72 A;  3UV2 A;  4O78 A;  2RI7 A;  4YC9 A;  4BJX A;  4MR4 A;  4UIU A;  2RS9 B;  4CUU A;  5FE5 A;  4YAB A;  4N4F A;  4YYD A;  5CPE A;  5F5Z A;  5LJ1 A;  5DYU A;  3O34 A;  4QB3 A;  5D3T A;  3UVY A;  5EU1 A;  4QNS A;  4YAX A;  5I29 A;  4DON A;  4O77 A;  3Q2E A;  5CUE A;  3P1F A;  4ALG A;  4O7A A;  4Z6I A;  5FE4 A;  5FH7 A;  4YY4 A;  5HEN A;  4QC1 A;  5I88 A;  1F68 A;  2DKW A;  4LYI A;  4E96 A;  4PS5 A;  5L97 A;  4ZW1 A;  4ALH A;  2E7O A;  5FG4 A;  3P1D A;  4AKN A;  5F3A A;  4QSX A;  4CFK A;  4BW2 A;  5IGN A;  5HQ6 A;  5C87 A;  2LSP B;  4TT6 A;  5ENG A;  5DY7 A;  5TCM A;  2L5E A;  4XUA A;  5A7C A;  5DW1 A;  5H1V A;  5TB6 A;  3MB4 A;  5L99 A;  3LJW A;  4A9E A;  5FE3 A;  5DKC A;  4LRG A;  3UVD A;  4QUT A;  4A9N A;  5IGL A;  4QEV A;  4J1P A;  4YYH A;  4IR3 A;  3SVH A;  5HFQ A;  5FE6 A;  4NR9 A;  2E3K A;  3P1C A;  4RVR A;  3ZYU A;  4KV4 A;  4TU4 A;  4XUB A;  5EIC A;  5EGU A;  5FE2 A;  5CQ6 A;  5D25 A;  3NXB A;  4O70 A;  4YYG A;  4UIY A;  5ENB A;  5KTW A;  4NRC A;  4QR5 A;  5EIS A;  5FB0 A;  5C4Q A;  3MB3 A;  4QSS A;  2DVQ A;  5IBN A;  4LYW A;  5K29 A;  3LQH A;  5ENC A;  4NR7 A;  4LDF A;  5I86 A;  4CUS A;  5FE1 A;  4HBW A;  4BW4 A;  4WHU A;  4O7F A;  2MJV B;  5EK9 A;  5CY9 A;  5A83 A;  4O7B A;  3S91 A;  5D3P A;  5D26 A; 
#chains in the Genus database with same CATH homology
 4PCI A;  4UYD A;  4GPJ A;  2YEK A;  4HXR A;  5AME A;  4N3W A;  5CS8 A;  4A9H A;  5D3S A;  5C89 A;  5F62 A;  4J0S A;  3MQM A;  2R0V A;  5EV9 A;  5HFR A;  5BT5 A;  5HLS A;  5EP7 A;  4YY6 A;  4LR6 A;  2F6N A;  4YBT A;  4QR4 A;  5I83 A;  4NUD A;  5IG6 A;  5AD3 A;  4UYH A;  5HCL A;  5CQA A;  4O75 A;  3SVG A;  4A9I A;  2RNX A;  5A5R A;  4TYL A;  3U5M A;  3G0L A;  5A81 A;  4CFL A;  5KU3 A;  3AQA A;  3U5L A;  3S92 A;  2FSA A;  5F63 A;  2DVR A;  5E9V A;  3UVX A;  5AD2 A;  5G4S A;  4Z6H A;  5I7Y A;  5LJ2 A;  5L8U A;  2L84 A;  5CQ7 A;  4NYW A;  4UYE A;  3QZV A;  5DYA A;  5ENF A;  2DWW A;  5D0C A;  4XY9 A;  3DAI A;  5FFW A;  3O35 A;  5IGM A;  1JM4 B;  2OSS A;  5D3J A;  2WP1 A;  3O37 A;  3SVF A;  3I3J A;  5ENH A;  5ETD A;  3UW9 A;  5A5N A;  3HMF A;  5ENJ A;  3TLP A;  5BT4 A;  4O76 A;  5L8T A;  4YYJ A;  2R0S A;  2D9E A;  5A82 A;  5G4R A;  4NQN A;  5DKH A;  4HXP A;  5CUC A;  5KO4 A;  3HME A;  5I80 A;  3UVW A;  5CU8 A;  4MEQ A;  3IU6 A;  4NS5 A;  4BW1 A;  5A85 A;  3LQJ A;  3MXF A;  3DWY A;  5CP5 A;  3K2J A;  4XY8 A;  5DYC A;  4YAT A;  5EPR A;  2I8N A;  5I40 A;  4YH3 A;  4Y03 A;  5FG6 A;  3QZS A;  5LVR A;  4NRB A;  5A5P A;  4NR4 A;  4QY4 A;  5E74 A;  1JSP B;  4QSV A;  2NXB A;  5CQ3 A;  4QSP A;  4TQN A;  5E9Y A;  5IID A;  5HRX A;  3IU5 A;  4QC3 A;  2RFJ A;  5ENI A;  4YK0 A;  3GG3 A;  4O74 A;  4TZ8 A;  5CUB A;  5COI A;  4PCE A;  4O7E A;  3LXJ A;  5FE0 A;  4QSW A;  4Q0N A;  2G4A A;  5FH8 A;  4QYL A;  2R0Y A;  4NYV A;  4IR5 A;  5LKZ A;  4TT2 A;  2YEM A;  4KCX A;  4QSR A;  2I7K A;  2H60 A;  5CFW A;  3UV4 A;  4OUF A;  2YDW A;  3AAD A;  4UIX A;  5ENE A;  5F2P A;  1EQF A;  5IGK A;  2R10 A;  4QBM A;  4HBV A;  5EVA A;  2N9G A;  5FB1 A;  5L96 A;  1WUG A;  5D3L A;  4WHW A;  2WP2 A;  4QUU A;  4UIV A;  5E9K A;  5EQ1 A;  4HBX A;  4PY6 A;  5DKD A;  4NYX A;  4QSU A;  3HMH A;  5D3R A;  4MEO A;  4OGJ A;  4IR6 A;  5DLX A;  4Z93 A;  5F1L A;  1E6I A;  5FE7 A;  5EPB A;  4XYA A;  5E9I A;  4A9O A;  5HEM A;  3P1E A;  4Q0O A;  5ACY A;  5CGP A;  5C8G A;  4UYG A;  5HM0 A;  1X0J A;  5EWW A;  5DLZ A;  5F60 A;  5D3H A;  5EWC A;  4N4G A;  3JVK A;  5HRW A;  2RNW A;  4YYK A;  4A9F A;  4QYD A;  5AMF A;  2RO1 A;  4HXO A;  2YEL A;  4HXL A;  5EWH A;  5EI4 A;  4A9L A;  4IR4 A;  4A9K A;  3U5O A;  2L85 A;  4MEN A;  5LUU A;  4LC2 A;  5KTX A;  5E73 A;  4UIW A;  5E7D A;  3U5P A;  5E0R A;  5KTU A;  4QEW A;  2E7N A;  4Z1S A;  5DFD A;  5F36 A;  5E9L A;  5H1U A;  5ETB A;  5H85 A;  5HEL A;  3O33 A;  4O71 A;  5FBX A;  5C7N A;  5CUG A;  5CQ8 A;  4CUR A;  5JWM A;  3Q2F A;  4J3I A;  5EPS A;  5I89 A;  4LZ2 A;  4N4I A;  4KV1 A;  4UIZ A;  5E3D A;  4IOO A;  4HXS A;  4TTE A;  4UIT A;  5DFC A;  5LKU A;  2GRC A;  3G0J A;  4MEP A;  4MR6 A;  4LZS A;  5EA1 A;  5FG5 A;  4NR5 A;  5LJ0 A;  4NR8 A;  3MUL A;  4NQM A;  5I7X A;  2KTB B;  4QST A;  2YQD A;  5A5Q A;  4C66 A;  4UYF A;  3FKM X;  5CUD A;  4YBS A;  5I1Q A;  4FLP A;  5FFY A;  5F61 A;  4HBY A;  5DBM A;  3QZT A;  4NXJ A;  4IOR A;  3D7C A;  5FH6 A;  4HXM A;  3O36 A;  5CRZ A;  4UYF B;  5CQ5 A;  3MUK A;  4MR3 A;  4TT4 A;  5C85 A;  5F25 A;  5FDZ A;  4A9M A;  5CQT A;  5HQ5 A;  4IOQ A;  4NUE A;  2OUO A;  3U5K A;  4C67 A;  5D24 A;  4CUQ A;  4CLB A;  4QZS A;  5HJC A;  4NR6 A;  4NRA A;  3ONI A;  2DVV A;  4QEU A;  5D7X A;  4BW3 A;  2DVS A;  4LYS A;  4ZC9 A;  5EWV A;  5CZG A;  4PTB A;  4YYM A;  5LKT A;  5DFB A;  2F6J A;  4LZR A;  4CUP A;  3JVM A;  5EM3 A;  5J0D A;  4YAD A;  3UV5 A;  5H1T A;  5LVQ A;  4O72 A;  4QSQ A;  2DAT A;  4O7C A;  5LKX A;  5HQ7 A;  4PKL A;  5DYX A;  5L98 A;  1ZS5 A;  1WUM A;  4TZ2 A;  4NUC A;  5D3N A;  5HRV A;  5E9M A;  5EWD A;  2YYN A;  5II2 A;  5BT3 A;  2OO1 A;  4CUT A;  4X2I A;  4TU6 A;  5A5O A;  5CQ4 A;  5FE9 A;  4MR5 A;  5KHM A;  4A9J A;  4F3I A;  5CRM A;  5DW2 A;  3JVL A;  4CL9 A;  4YYI A;  3LQI A;  4N4H A;  3P5O A;  4QR3 A;  4WIV A;  3JVJ A;  5FFV A;  2D82 A;  4J0R A;  4YH4 A;  5II1 A;  5E3G A;  4Z1Q A;  3U5N A;  4BHW A;  4OGI A;  4YYN A;  2YW5 A;  5DX4 A;  5CTL A;  2RNY A;  4ZQL A;  3RCW A;  4YBM A;  4HXN A;  5CUA A;  5FE8 A;  4HXK A;  3U5J A;  5A5S A;  5JI8 A;  5F1H A;  4TS8 A;  1N72 A;  3UV2 A;  4O78 A;  2RI7 A;  4YC9 A;  4BJX A;  4MR4 A;  4UIU A;  2RS9 B;  4CUU A;  5FE5 A;  4YAB A;  4N4F A;  4YYD A;  5CPE A;  5F5Z A;  5LJ1 A;  5DYU A;  3O34 A;  4QB3 A;  5D3T A;  3UVY A;  5EU1 A;  4QNS A;  4YAX A;  5I29 A;  4DON A;  4O77 A;  3Q2E A;  5CUE A;  3P1F A;  4ALG A;  4O7A A;  4Z6I A;  5FE4 A;  5FH7 A;  4YY4 A;  5HEN A;  4QC1 A;  5I88 A;  1F68 A;  2DKW A;  4LYI A;  4E96 A;  4PS5 A;  5L97 A;  4ZW1 A;  4ALH A;  2E7O A;  5FG4 A;  3P1D A;  4AKN A;  5F3A A;  4QSX A;  4CFK A;  4BW2 A;  5IGN A;  5HQ6 A;  5C87 A;  2LSP B;  4TT6 A;  5ENG A;  5DY7 A;  5TCM A;  2L5E A;  4XUA A;  5A7C A;  5DW1 A;  5H1V A;  5TB6 A;  3MB4 A;  5L99 A;  3LJW A;  4A9E A;  5FE3 A;  5DKC A;  4LRG A;  3UVD A;  4QUT A;  4A9N A;  5IGL A;  4QEV A;  4J1P A;  4YYH A;  4IR3 A;  3SVH A;  5HFQ A;  5FE6 A;  4NR9 A;  2E3K A;  3P1C A;  4RVR A;  3ZYU A;  4KV4 A;  4TU4 A;  4XUB A;  5EIC A;  5EGU A;  5FE2 A;  5CQ6 A;  5D25 A;  3NXB A;  4O70 A;  4YYG A;  4UIY A;  5ENB A;  5KTW A;  4NRC A;  4QR5 A;  5EIS A;  5FB0 A;  5C4Q A;  3MB3 A;  4QSS A;  2DVQ A;  5IBN A;  4LYW A;  5K29 A;  3LQH A;  5ENC A;  4NR7 A;  4LDF A;  5I86 A;  4CUS A;  5FE1 A;  4HBW A;  4BW4 A;  4WHU A;  4O7F A;  2MJV B;  5EK9 A;  5CY9 A;  5A83 A;  4O7B A;  3S91 A;  5D3P A;  5D26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...