5CRZA

Crystal structure of the first bromodomain of human brd4 in complex with benzo[cd]indol-2(1h)-one ligand
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
133
structure length
133
Chain Sequence
HHHHHLVPRGSNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/inhibitor
molecule keywords Bromodomain-containing protein 4
publication title Discovery of Benzo[cd]indol-2(1H)-ones as Potent and Specific BET Bromodomain Inhibitors: Structure-Based Virtual Screening, Optimization, and Biological Evaluation
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5crzA01
4O78A 5KTWA 3SVHA 4N4GA 4Z1SA 3JVLA 4CUSA 5CQ8A 5D3NA 5CQTA 3Q2EA 5HJCA 2WP2A 4QEVA 4TS8A 4CUTA 5AD3A 5I40A 4TT6A 5A5OA 3QZVA 5EWDA 3UW9A 4HBWA 4IORA 5CQ5A 4QSVA 5EI4A 5KTXA 5LKZA 5FE4A 5CRZA 2RFJA 4QZSA 5CPEA 4MEOA 2R10A 5DYAA 4UIZA 4N3WA 4NR5A 4MENA 5F61A 4BW3A 5CS8A 5FE7A 4YBSA 5BT3A 4KV1A 4O7AA 3O34A 3O33A 4QYDA 4NR8A 5L99A 5H85A 5EPBA 2E3KA 2YYNA 4HBXA 4O7CA 5FE6A 5F63A 5C85A 4LR6A 3LQIA 5ENJA 5ACYA 5CUGA 5FFWA 5LVQA 3LQHA 5I7YA 4YYJA 4MEQA 3HMFA 5FE1A 4ZQLA 4O7BA 4A9IA 5CQAA 5ENHA 5FE2A 3HMEA 5COIA 5TCMA 3NXBA 2E7OA 5IIDA 5K29A 4RVRA 5A81A 3JVKA 4DONA 4QSTA 4YH3A 5CGPA 5A7CA 5D3RA 5FE0A 5EGUA 5FE3A 4YYNA 5DKHA 4OGJA 4WHWA 1JSPB 5F1HA 4LYSA 5KO4A 4NQNA 5F1LA 4QSQA 5E9VA 4BHWA 4YADA 5F3AA 3O36A 5FB0A 4TU4A 4UIWA 5I83A 5A5RA 4UYEA 2DVSA 3UVXA 2YEKA 4ZW1A 4Z93A 3JVMA 3MQMA 2R0YA 4PCIA 4HXKA 5A5SA 4WIVA 3P1DA 4N4FA 4YYDA 5CY9A 5C8GA 3MB3A 2GRCA 5HFRA 5FBXA 3MB4A 4YYIA 4TTEA 2RNXA 5F36A 3MXFA 5L98A 3P1CA 4C66A 5DY7A 4CUPA 1ZS5A 5F2PA 5CU8A 4NRCA 2RS9B 4WHUA 5CUCA 2NXBA 5D25A 4O7FA 5HRXA 4QR4A 4J0RA 5EM3A 4QSSA 2OUOA 4CL9A 5CUAA 5AD2A 2DATA 2YELA 4QNSA 4OUFA 5E9YA 5EP7A 5IGLA 3GG3A 4HBVA 5IGNA 4BJXA 5E9IA 5EQ1A 5CQ3A 5LKUA 4MR5A 4N4IA 5E9MA 4HXRA 5HQ5A 5C4QA 5HCLA 2YDWA 5AMEA 4AKNA 4BW2A 5C87A 5D3LA 4UITA 4CFKA 4HXOA 2WP1A 4NUCA 2DKWA 5E9KA 2YW5A 4A9HA 2OO1A 4O71A 5DYUA 5FG6A 3MULA 4QC3A 4QEUA 5D3JA 2OSSA 5FE8A 5EICA 5ETDA 5E7DA 5I29A 4Y03A 5CQ6A 4PCEA 3HMHA 4LZSA 4MR6A 4UYDA 5EVAA 4TYLA 5D3TA 4YAXA 3QZTA 3MUKA 4CURA 5D3HA 5FFYA 4TT2A 4IOOA 2YQDA 4Q0OA 4QB3A 4LC2A 2DVQA 4PKLA 3UVYA 2YEMA 3UV4A 4Z6IA 3LJWA 4PY6A 3D7CA 5DLXA 4TT4A 4HBYA 3ONIA 4PS5A 5F60A 4IR6A 5D7XA 4MR3A 5H1VA 3LXJA 1N72A 5D3SA 5DX4A 5DKDA 4TZ2A 5DFCA 4NR9A 5E3DA 5DW1A 4XYAA 3U5KA 3UVDA 2H60A 4MR4A 5C7NA 4HXLA 5ENIA 4YYGA 4C67A 5CUBA 2KTBB 5LKTA 3AQAA 3IU6A 4UIVA 5FDZA 3RCWA 5F25A 4UYFA 4LDFA 5L8UA 5ENBA 4HXNA 5DYXA 4A9LA 4F3IA 5EWWA 3U5NA 5CUEA 5CP5A 4YH4A 4IR4A 4QR5A 3SVGA 4A9EA 4LZRA 2L85A 3O37A 4TZ8A 5LKXA 5I88A 5JI8A 5DW2A 4IR3A 5II2A 4FLPA 5IG6A 4QC1A 4QSRA 5HQ7A 5H1TA 3U5MA 5KU3A 5HENA 4ALGA 2FSAA 4HXSA 2DWWA 5DYCA 3UV5A 4YC9A 4QYLA 4YY4A 3AADA 3U5OA 4A9OA 5CFWA 5LJ1A 4A9NA 4XY8A 4OGIA 5A82A 5BT4A 4NUDA 5A5PA 4A9JA 5FH8A 4E96A 5EPSA 5EPRA 4NQMA 4CUQA 4J0SA 5ENGA 5HRWA 5I80A 4YBTA 2E7NA 4A9FA 5CQ4A 3IU5A 4LRGA 5E74A 3TLPA 2D9EA 3O35A 4NRBA 5D24A 4ALHA 4QUUA 4KV4A 2I8NA 3FKMX 3G0LA 5FB1A 4NXJA 2RO1A 2LSPB 4UIXA 4BW4A 4BW1A 4YBMA 5CTLA 5F5ZA 5HQ6A 5G4SA 5IGKA 4A9KA 4A9MA 2L84A 4YYMA 5E73A 5LUUA 4Z6HA 5I1QA 5JWMA 5DFBA 3U5PA 4LZ2A 1JM4B 4Z1QA 4LYWA 4QSPA 4J1PA 5HFQA 5ENCA 1X0JA 5F62A 5DBMA 3ZYUA 2MJVB 4YK0A 5EWVA 1WUGA 5A85A 4HXPA 2L5EA 5EU1A 5A5QA 3P1FA 5LVRA 2N9GA 3UV2A 4O75A 1E6IA 2F6JA 4O76A 4QR3A 2RI7A 5L8TA 5AMFA 4ZC9A 5KHMA 5H1UA 3JVJA 5II1A 4N4HA 4QSUA 5DKCA 5FH6A 4CUUA 4YABA 3K2JA 4MEPA 4QEWA 5HRVA 3S92A 4O7EA 4O72A 4QY4A 4UYHA 4NYWA 3DWYA 4YY6A 4NR7A 5ENEA 5FFVA 1F68A 5HLSA 5E9LA 5G4RA 4O77A 4HXMA 4NYXA 2G4AA 5EWCA 5IBNA 4NS5A 5D3PA 4XY9A 5L96A 5TB6A 5C89A 2I7KA 4IR5A 5HELA 5CRMA 4NR4A 2R0VA 4TQNA 4YATA 4YYKA 2RNWA 5ENFA 3I3JA 4TU6A 5BT5A 3P1EA 2R0SA 5J0DA 5CQ7A 4UYGA 5DFDA 5EK9A 2DVVA 4NYVA 4J3IA 5EISA 4QBMA 4IOQA 5D26A 5LJ0A 5HEMA 4X2IA 3QZSA 5DLZA 5FG4A 5I7XA 2D82A 5L97A 3S91A 2RNYA 1WUMA 5A5NA 5ETBA 3DAIA 3P5OA 5I86A 5I89A 4NUEA 5FE9A 4UYFB 3U5LA 4LYIA 5D0CA 5EV9A 4UIUA 4YYHA 5KTUA 3SVFA 4NR6A 4KCXA 4CFLA 4GPJA 2DVRA 4XUAA 3U5JA 4UIYA 5FE5A 3Q2FA 4O74A 4QSXA 5EA1A 5EWHA 4QUTA 5E0RA 4NRAA 5CZGA 4PTBA 5A83A 2F6NA 5E3GA 5CUDA 1EQFA 4Q0NA 3G0JA 5FG5A 4QSWA 5FH7A 3LQJA 4CLBA 5HM0A 3UVWA 5IGMA 4XUBA 5LJ2A 4O70A
chains in the Genus database with same CATH superfamily
4O78A 5KTWA 3SVHA 4N4GA 4Z1SA 3JVLA 4CUSA 5CQ8A 5D3NA 5CQTA 3Q2EA 5HJCA 2WP2A 4QEVA 4TS8A 4CUTA 5AD3A 5I40A 4TT6A 5A5OA 3QZVA 5EWDA 3UW9A 4HBWA 4IORA 5CQ5A 4QSVA 5EI4A 5KTXA 5LKZA 5FE4A 5CRZA 3D1BA 2RFJA 4QZSA 5CPEA 4MEOA 4AI6A 2R10A 5DYAA 4UIZA 4N3WA 4NR5A 4MENA 5F61A 4BW3A 5CS8A 5FE7A 4YBSA 5BT3A 4KV1A 4O7AA 3O34A 3O33A 4QYDA 4NR8A 5L99A 5H85A 5EPBA 2E3KA 2YYNA 4HBXA 4O7CA 5FE6A 5F63A 5C85A 4LR6A 3LQIA 5ENJA 5ACYA 5CUGA 5FFWA 5LVQA 3VKHA 3LQHA 5I7YA 4YYJA 4MEQA 3HMFA 5FE1A 4ZQLA 4O7BA 4A9IA 5CQAA 5ENHA 5FE2A 3HMEA 5COIA 5TCMA 3NXBA 2E7OA 5IIDA 5K29A 4RVRA 5A81A 3JVKA 4DONA 4QSTA 4YH3A 5CGPA 5A7CA 5D3RA 5FE0A 5EGUA 5FE3A 4YYNA 5DKHA 4OGJA 4WHWA 1JSPB 5F1HA 4LYSA 5KO4A 4NQNA 5F1LA 4QSQA 5E9VA 4BHWA 4YADA 5F3AA 3O36A 5FB0A 4TU4A 4UIWA 5I83A 5A5RA 4UYEA 2DVSA 3UVXA 2YEKA 4ZW1A 4Z93A 3JVMA 3MQMA 2R0YA 4PCIA 4HXKA 5A5SA 4WIVA 3P1DA 4N4FA 4YYDA 5CY9A 5C8GA 3MB3A 2GRCA 5HFRA 5FBXA 3MB4A 4YYIA 4TTEA 2RNXA 5F36A 3MXFA 5L98A 3P1CA 4C66A 5DY7A 4CUPA 1ZS5A 5F2PA 5CU8A 4NRCA 2RS9B 4WHUA 5CUCA 2NXBA 5D25A 4O7FA 5HRXA 4QR4A 4J0RA 5EM3A 4QSSA 2OUOA 4CL9A 5CUAA 5AD2A 2DATA 2YELA 4QNSA 4OUFA 5E9YA 5EP7A 5IGLA 3GG3A 4HBVA 5IGNA 4BJXA 5E9IA 5EQ1A 5CQ3A 5LKUA 4MR5A 4N4IA 5E9MA 4HXRA 5HQ5A 5C4QA 5HCLA 2YDWA 5AMEA 4AKNA 4BW2A 5C87A 5D3LA 4UITA 4CFKA 4HXOA 2WP1A 4NUCA 2DKWA 5E9KA 2YW5A 3ERRA 2OO1A 4A9HA 4O71A 5DYUA 5FG6A 3MULA 4QC3A 4QEUA 5D3JA 2OSSA 5FE8A 5EICA 5ETDA 5E7DA 5I29A 4Y03A 5CQ6A 4PCEA 3HMHA 3VKGA 4LZSA 4MR6A 4UYDA 5EVAA 4TYLA 5D3TA 4YAXA 3QZTA 3MUKA 4CURA 5D3HA 5FFYA 4TT2A 4IOOA 2YQDA 4Q0OA 4QB3A 4AKGA 4LC2A 2DVQA 4PKLA 3UVYA 2YEMA 3UV4A 4Z6IA 3LJWA 4PY6A 4AKHA 3D7CA 5DLXA 4TT4A 4HBYA 3ONIA 4PS5A 5F60A 4IR6A 5D7XA 4MR3A 5H1VA 3LXJA 1N72A 5D3SA 5DX4A 5DKDA 4TZ2A 5DFCA 4NR9A 5E3DA 5DW1A 4XYAA 3U5KA 3UVDA 2H60A 4MR4A 5C7NA 4HXLA 5ENIA 4YYGA 4C67A 5CUBA 2KTBB 5LKTA 3AQAA 3IU6A 4UIVA 5FDZA 3RCWA 5F25A 4UYFA 4LDFA 5L8UA 5ENBA 4HXNA 5DYXA 4A9LA 4F3IA 5EWWA 3U5NA 5CUEA 5CP5A 4YH4A 4IR4A 4QR5A 3SVGA 4A9EA 4LZRA 2L85A 3O37A 4TZ8A 5LKXA 5I88A 5JI8A 5DW2A 4IR3A 5II2A 4FLPA 5IG6A 4QC1A 4QSRA 5HQ7A 5H1TA 3U5MA 5KU3A 5HENA 4ALGA 2FSAA 4HXSA 2DWWA 5DYCA 3UV5A 4YC9A 4QYLA 4YY4A 3AADA 3U5OA 4A9OA 5CFWA 5LJ1A 4A9NA 4XY8A 4OGIA 5A82A 5BT4A 4NUDA 1ZKRA 5A5PA 4A9JA 5FH8A 4E96A 5EPSA 5EPRA 4NQMA 4CUQA 4J0SA 5ENGA 5HRWA 5I80A 2EJNA 4YBTA 2E7NA 4A9FA 5CQ4A 3IU5A 4LRGA 5E74A 3TLPA 2D9EA 3O35A 4NRBA 5D24A 4ALHA 4QUUA 4KV4A 2I8NA 3FKMX 3G0LA 5FB1A 4NXJA 2RO1A 2LSPB 4UIXA 4BW4A 4BW1A 4YBMA 5CTLA 5F5ZA 5HQ6A 5G4SA 5IGKA 4A9KA 4A9MA 2L84A 4YYMA 5E73A 5LUUA 4Z6HA 5I1QA 5JWMA 5DFBA 3U5PA 4LZ2A 1JM4B 4Z1QA 4LYWA 4QSPA 4J1PA 5HFQA 5ENCA 1X0JA 5F62A 5DBMA 3ZYUA 2MJVB 4YK0A 5EWVA 1WUGA 5A85A 4HXPA 2L5EA 5EU1A 5A5QA 3P1FA 5LVRA 2N9GA 3UV2A 4O75A 1E6IA 2F6JA 4O76A 4QR3A 2RI7A 5L8TA 5AMFA 4ZC9A 5KHMA 5H1UA 3JVJA 5II1A 4N4HA 4QSUA 5DKCA 5FH6A 4CUUA 4YABA 3K2JA 4MEPA 4QEWA 5HRVA 3S92A 4O7EA 4O72A 4QY4A 4UYHA 4NYWA 3DWYA 4YY6A 4NR7A 5ENEA 5FFVA 1F68A 5HLSA 5E9LA 5G4RA 4O77A 4HXMA 4NYXA 2G4AA 5EWCA 5IBNA 4NS5A 5D3PA 4XY9A 5L96A 5TB6A 5C89A 2I7KA 4IR5A 5HELA 5CRMA 4NR4A 2R0VA 4TQNA 4YATA 4YYKA 2RNWA 5ENFA 3I3JA 4TU6A 5BT5A 3P1EA 2R0SA 5J0DA 5CQ7A 4UYGA 5DFDA 5EK9A 2DVVA 4NYVA 4J3IA 5EISA 4QBMA 4IOQA 5D26A 5LJ0A 5HEMA 4X2IA 3QZSA 5DLZA 5FG4A 5I7XA 2D82A 5L97A 3S91A 2RNYA 1WUMA 5A5NA 5ETBA 3DAIA 3P5OA 5I86A 5I89A 4NUEA 1PUOA 5FE9A 4UYFB 3U5LA 4LYIA 5D0CA 5EV9A 4UIUA 4YYHA 5KTUA 3SVFA 4NR6A 4KCXA 4CFLA 4GPJA 2DVRA 4XUAA 3U5JA 4UIYA 5FE5A 3Q2FA 4O74A 4QSXA 5EA1A 5EWHA 3D1DA 4QUTA 5E0RA 4NRAA 5CZGA 4PTBA 4AKIA 5A83A 2F6NA 5E3GA 5CUDA 1EQFA 4Q0NA 3G0JA 5FG5A 4QSWA 5FH7A 3LQJA 4CLBA 5HM0A 3UVWA 5IGMA 4XUBA 5LJ2A 4O70A
chains in the Genus database with same CATH topology
4O78A 5KTWA 3SVHA 4N4GA 4Z1SA 3JVLA 4CUSA 5CQ8A 5D3NA 5CQTA 3Q2EA 5HJCA 2WP2A 4QEVA 4TS8A 4CUTA 5AD3A 5I40A 4TT6A 5A5OA 3QZVA 5EWDA 3UW9A 4HBWA 4IORA 5CQ5A 4QSVA 5EI4A 5KTXA 5LKZA 5FE4A 5CRZA 2RFJA 4QZSA 5CPEA 4MEOA 2R10A 5DYAA 4UIZA 4N3WA 4NR5A 4MENA 5F61A 4BW3A 5CS8A 5FE7A 4YBSA 5BT3A 4KV1A 4O7AA 3O34A 3O33A 4QYDA 4NR8A 5L99A 5H85A 5EPBA 2E3KA 2YYNA 4HBXA 4O7CA 5FE6A 5F63A 5C85A 4LR6A 3LQIA 5ENJA 5ACYA 5CUGA 5FFWA 5LVQA 3LQHA 5I7YA 4YYJA 4MEQA 3HMFA 5FE1A 4ZQLA 4O7BA 4A9IA 5CQAA 5ENHA 5FE2A 3HMEA 5COIA 5TCMA 3NXBA 2E7OA 5IIDA 5K29A 4RVRA 5A81A 3JVKA 4DONA 4QSTA 4YH3A 5CGPA 5A7CA 5D3RA 5FE0A 5EGUA 5FE3A 4YYNA 5DKHA 4OGJA 4WHWA 1JSPB 5F1HA 4LYSA 5KO4A 4NQNA 5F1LA 4QSQA 5E9VA 4BHWA 4YADA 5F3AA 3O36A 5FB0A 4TU4A 4UIWA 5I83A 5A5RA 4UYEA 2DVSA 3UVXA 2YEKA 4ZW1A 4Z93A 3JVMA 3MQMA 2R0YA 4PCIA 4HXKA 5A5SA 4WIVA 3P1DA 4N4FA 4YYDA 5CY9A 5C8GA 3MB3A 2GRCA 5HFRA 5FBXA 3MB4A 4YYIA 4TTEA 2RNXA 5F36A 3MXFA 5L98A 3P1CA 4C66A 5DY7A 4CUPA 1ZS5A 5F2PA 5CU8A 4NRCA 2RS9B 4WHUA 5CUCA 2NXBA 5D25A 4O7FA 5HRXA 4QR4A 4J0RA 5EM3A 4QSSA 2OUOA 4CL9A 5CUAA 5AD2A 2DATA 2YELA 4QNSA 4OUFA 5E9YA 5EP7A 5IGLA 3GG3A 4HBVA 5IGNA 4BJXA 5E9IA 5EQ1A 5CQ3A 5LKUA 4MR5A 4N4IA 5E9MA 4HXRA 5HQ5A 5C4QA 5HCLA 2YDWA 5AMEA 4AKNA 4BW2A 5C87A 5D3LA 4UITA 4CFKA 4HXOA 2WP1A 4NUCA 2DKWA 5E9KA 2YW5A 4A9HA 2OO1A 4O71A 5DYUA 5FG6A 3MULA 4QC3A 4QEUA 5D3JA 2OSSA 5FE8A 5EICA 5ETDA 5E7DA 5I29A 4Y03A 5CQ6A 4PCEA 3HMHA 4LZSA 4MR6A 4UYDA 5EVAA 4TYLA 5D3TA 4YAXA 3QZTA 3MUKA 4CURA 5D3HA 5FFYA 4TT2A 4IOOA 2YQDA 4Q0OA 4QB3A 4LC2A 2DVQA 4PKLA 3UVYA 2YEMA 3UV4A 4Z6IA 3LJWA 4PY6A 3D7CA 5DLXA 4TT4A 4HBYA 3ONIA 4PS5A 5F60A 4IR6A 5D7XA 4MR3A 5H1VA 3LXJA 1N72A 5D3SA 5DX4A 5DKDA 4TZ2A 5DFCA 4NR9A 5E3DA 5DW1A 4XYAA 3U5KA 3UVDA 2H60A 4MR4A 5C7NA 4HXLA 5ENIA 4YYGA 4C67A 5CUBA 2KTBB 5LKTA 3AQAA 3IU6A 4UIVA 5FDZA 3RCWA 5F25A 4UYFA 4LDFA 5L8UA 5ENBA 4HXNA 5DYXA 4A9LA 4F3IA 5EWWA 3U5NA 5CUEA 5CP5A 4YH4A 4IR4A 4QR5A 3SVGA 4A9EA 4LZRA 2L85A 3O37A 4TZ8A 5LKXA 5I88A 5JI8A 5DW2A 4IR3A 5II2A 4FLPA 5IG6A 4QC1A 4QSRA 5HQ7A 5H1TA 3U5MA 5KU3A 5HENA 4ALGA 2FSAA 4HXSA 2DWWA 5DYCA 3UV5A 4YC9A 4QYLA 4YY4A 3AADA 3U5OA 4A9OA 5CFWA 5LJ1A 4A9NA 4XY8A 4OGIA 5A82A 5BT4A 4NUDA 5A5PA 4A9JA 5FH8A 4E96A 5EPSA 5EPRA 4NQMA 4CUQA 4J0SA 5ENGA 5HRWA 5I80A 4YBTA 2E7NA 4A9FA 5CQ4A 3IU5A 4LRGA 5E74A 3TLPA 2D9EA 3O35A 4NRBA 5D24A 4ALHA 4QUUA 4KV4A 2I8NA 3FKMX 3G0LA 5FB1A 4NXJA 2RO1A 2LSPB 4UIXA 4BW4A 4BW1A 4YBMA 5CTLA 5F5ZA 5HQ6A 5G4SA 5IGKA 4A9KA 4A9MA 2L84A 4YYMA 5E73A 5LUUA 4Z6HA 5I1QA 5JWMA 5DFBA 3U5PA 4LZ2A 1JM4B 4Z1QA 4LYWA 4QSPA 4J1PA 5HFQA 5ENCA 1X0JA 5F62A 5DBMA 3ZYUA 2MJVB 4YK0A 5EWVA 1WUGA 5A85A 4HXPA 2L5EA 5EU1A 5A5QA 3P1FA 5LVRA 2N9GA 3UV2A 4O75A 1E6IA 2F6JA 4O76A 4QR3A 2RI7A 5L8TA 5AMFA 4ZC9A 5KHMA 5H1UA 3JVJA 5II1A 4N4HA 4QSUA 5DKCA 5FH6A 4CUUA 4YABA 3K2JA 4MEPA 4QEWA 5HRVA 3S92A 4O7EA 4O72A 4QY4A 4UYHA 4NYWA 3DWYA 4YY6A 4NR7A 5ENEA 5FFVA 1F68A 5HLSA 5E9LA 5G4RA 4O77A 4HXMA 4NYXA 2G4AA 5EWCA 5IBNA 4NS5A 5D3PA 4XY9A 5L96A 5TB6A 5C89A 2I7KA 4IR5A 5HELA 5CRMA 4NR4A 2R0VA 4TQNA 4YATA 4YYKA 2RNWA 5ENFA 3I3JA 4TU6A 5BT5A 3P1EA 2R0SA 5J0DA 5CQ7A 4UYGA 5DFDA 5EK9A 2DVVA 4NYVA 4J3IA 5EISA 4QBMA 4IOQA 5D26A 5LJ0A 5HEMA 4X2IA 3QZSA 5DLZA 5FG4A 5I7XA 2D82A 5L97A 3S91A 2RNYA 1WUMA 5A5NA 5ETBA 3DAIA 3P5OA 5I86A 5I89A 4NUEA 5FE9A 4UYFB 3U5LA 4LYIA 5D0CA 5EV9A 4UIUA 4YYHA 5KTUA 3SVFA 4NR6A 4KCXA 4CFLA 4GPJA 2DVRA 4XUAA 3U5JA 4UIYA 5FE5A 3Q2FA 4O74A 4QSXA 5EA1A 5EWHA 4QUTA 5E0RA 4NRAA 5CZGA 4PTBA 5A83A 2F6NA 5E3GA 5CUDA 1EQFA 4Q0NA 3G0JA 5FG5A 4QSWA 5FH7A 3LQJA 4CLBA 5HM0A 3UVWA 5IGMA 4XUBA 5LJ2A 4O70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O78 A;  5KTW A;  3SVH A;  4N4G A;  4Z1S A;  3JVL A;  4CUS A;  5CQ8 A;  5D3N A;  5CQT A;  3Q2E A;  5HJC A;  2WP2 A;  4QEV A;  4TS8 A;  4CUT A;  5AD3 A;  5I40 A;  4TT6 A;  5A5O A;  3QZV A;  5EWD A;  3UW9 A;  4HBW A;  4IOR A;  5CQ5 A;  4QSV A;  5EI4 A;  5KTX A;  5LKZ A;  5FE4 A;  5CRZ A;  2RFJ A;  4QZS A;  5CPE A;  4MEO A;  2R10 A;  5DYA A;  4UIZ A;  4N3W A;  4NR5 A;  4MEN A;  5F61 A;  4BW3 A;  5CS8 A;  5FE7 A;  4YBS A;  5BT3 A;  4KV1 A;  4O7A A;  3O34 A;  3O33 A;  4QYD A;  4NR8 A;  5L99 A;  5H85 A;  5EPB A;  2E3K A;  2YYN A;  4HBX A;  4O7C A;  5FE6 A;  5F63 A;  5C85 A;  4LR6 A;  3LQI A;  5ENJ A;  5ACY A;  5CUG A;  5FFW A;  5LVQ A;  3LQH A;  5I7Y A;  4YYJ A;  4MEQ A;  3HMF A;  5FE1 A;  4ZQL A;  4O7B A;  4A9I A;  5CQA A;  5ENH A;  5FE2 A;  3HME A;  5COI A;  5TCM A;  3NXB A;  2E7O A;  5IID A;  5K29 A;  4RVR A;  5A81 A;  3JVK A;  4DON A;  4QST A;  4YH3 A;  5CGP A;  5A7C A;  5D3R A;  5FE0 A;  5EGU A;  5FE3 A;  4YYN A;  5DKH A;  4OGJ A;  4WHW A;  1JSP B;  5F1H A;  4LYS A;  5KO4 A;  4NQN A;  5F1L A;  4QSQ A;  5E9V A;  4BHW A;  4YAD A;  5F3A A;  3O36 A;  5FB0 A;  4TU4 A;  4UIW A;  5I83 A;  5A5R A;  4UYE A;  2DVS A;  3UVX A;  2YEK A;  4ZW1 A;  4Z93 A;  3JVM A;  3MQM A;  2R0Y A;  4PCI A;  4HXK A;  5A5S A;  4WIV A;  3P1D A;  4N4F A;  4YYD A;  5CY9 A;  5C8G A;  3MB3 A;  2GRC A;  5HFR A;  5FBX A;  3MB4 A;  4YYI A;  4TTE A;  2RNX A;  5F36 A;  3MXF A;  5L98 A;  3P1C A;  4C66 A;  5DY7 A;  4CUP A;  1ZS5 A;  5F2P A;  5CU8 A;  4NRC A;  2RS9 B;  4WHU A;  5CUC A;  2NXB A;  5D25 A;  4O7F A;  5HRX A;  4QR4 A;  4J0R A;  5EM3 A;  4QSS A;  2OUO A;  4CL9 A;  5CUA A;  5AD2 A;  2DAT A;  2YEL A;  4QNS A;  4OUF A;  5E9Y A;  5EP7 A;  5IGL A;  3GG3 A;  4HBV A;  5IGN A;  4BJX A;  5E9I A;  5EQ1 A;  5CQ3 A;  5LKU A;  4MR5 A;  4N4I A;  5E9M A;  4HXR A;  5HQ5 A;  5C4Q A;  5HCL A;  2YDW A;  5AME A;  4AKN A;  4BW2 A;  5C87 A;  5D3L A;  4UIT A;  4CFK A;  4HXO A;  2WP1 A;  4NUC A;  2DKW A;  5E9K A;  2YW5 A;  4A9H A;  2OO1 A;  4O71 A;  5DYU A;  5FG6 A;  3MUL A;  4QC3 A;  4QEU A;  5D3J A;  2OSS A;  5FE8 A;  5EIC A;  5ETD A;  5E7D A;  5I29 A;  4Y03 A;  5CQ6 A;  4PCE A;  3HMH A;  4LZS A;  4MR6 A;  4UYD A;  5EVA A;  4TYL A;  5D3T A;  4YAX A;  3QZT A;  3MUK A;  4CUR A;  5D3H A;  5FFY A;  4TT2 A;  4IOO A;  2YQD A;  4Q0O A;  4QB3 A;  4LC2 A;  2DVQ A;  4PKL A;  3UVY A;  2YEM A;  3UV4 A;  4Z6I A;  3LJW A;  4PY6 A;  3D7C A;  5DLX A;  4TT4 A;  4HBY A;  3ONI A;  4PS5 A;  5F60 A;  4IR6 A;  5D7X A;  4MR3 A;  5H1V A;  3LXJ A;  1N72 A;  5D3S A;  5DX4 A;  5DKD A;  4TZ2 A;  5DFC A;  4NR9 A;  5E3D A;  5DW1 A;  4XYA A;  3U5K A;  3UVD A;  2H60 A;  4MR4 A;  5C7N A;  4HXL A;  5ENI A;  4YYG A;  4C67 A;  5CUB A;  2KTB B;  5LKT A;  3AQA A;  3IU6 A;  4UIV A;  5FDZ A;  3RCW A;  5F25 A;  4UYF A;  4LDF A;  5L8U A;  5ENB A;  4HXN A;  5DYX A;  4A9L A;  4F3I A;  5EWW A;  3U5N A;  5CUE A;  5CP5 A;  4YH4 A;  4IR4 A;  4QR5 A;  3SVG A;  4A9E A;  4LZR A;  2L85 A;  3O37 A;  4TZ8 A;  5LKX A;  5I88 A;  5JI8 A;  5DW2 A;  4IR3 A;  5II2 A;  4FLP A;  5IG6 A;  4QC1 A;  4QSR A;  5HQ7 A;  5H1T A;  3U5M A;  5KU3 A;  5HEN A;  4ALG A;  2FSA A;  4HXS A;  2DWW A;  5DYC A;  3UV5 A;  4YC9 A;  4QYL A;  4YY4 A;  3AAD A;  3U5O A;  4A9O A;  5CFW A;  5LJ1 A;  4A9N A;  4XY8 A;  4OGI A;  5A82 A;  5BT4 A;  4NUD A;  5A5P A;  4A9J A;  5FH8 A;  4E96 A;  5EPS A;  5EPR A;  4NQM A;  4CUQ A;  4J0S A;  5ENG A;  5HRW A;  5I80 A;  4YBT A;  2E7N A;  4A9F A;  5CQ4 A;  3IU5 A;  4LRG A;  5E74 A;  3TLP A;  2D9E A;  3O35 A;  4NRB A;  5D24 A;  4ALH A;  4QUU A;  4KV4 A;  2I8N A;  3FKM X;  3G0L A;  5FB1 A;  4NXJ A;  2RO1 A;  2LSP B;  4UIX A;  4BW4 A;  4BW1 A;  4YBM A;  5CTL A;  5F5Z A;  5HQ6 A;  5G4S A;  5IGK A;  4A9K A;  4A9M A;  2L84 A;  4YYM A;  5E73 A;  5LUU A;  4Z6H A;  5I1Q A;  5JWM A;  5DFB A;  3U5P A;  4LZ2 A;  1JM4 B;  4Z1Q A;  4LYW A;  4QSP A;  4J1P A;  5HFQ A;  5ENC A;  1X0J A;  5F62 A;  5DBM A;  3ZYU A;  2MJV B;  4YK0 A;  5EWV A;  1WUG A;  5A85 A;  4HXP A;  2L5E A;  5EU1 A;  5A5Q A;  3P1F A;  5LVR A;  2N9G A;  3UV2 A;  4O75 A;  1E6I A;  2F6J A;  4O76 A;  4QR3 A;  2RI7 A;  5L8T A;  5AMF A;  4ZC9 A;  5KHM A;  5H1U A;  3JVJ A;  5II1 A;  4N4H A;  4QSU A;  5DKC A;  5FH6 A;  4CUU A;  4YAB A;  3K2J A;  4MEP A;  4QEW A;  5HRV A;  3S92 A;  4O7E A;  4O72 A;  4QY4 A;  4UYH A;  4NYW A;  3DWY A;  4YY6 A;  4NR7 A;  5ENE A;  5FFV A;  1F68 A;  5HLS A;  5E9L A;  5G4R A;  4O77 A;  4HXM A;  4NYX A;  2G4A A;  5EWC A;  5IBN A;  4NS5 A;  5D3P A;  4XY9 A;  5L96 A;  5TB6 A;  5C89 A;  2I7K A;  4IR5 A;  5HEL A;  5CRM A;  4NR4 A;  2R0V A;  4TQN A;  4YAT A;  4YYK A;  2RNW A;  5ENF A;  3I3J A;  4TU6 A;  5BT5 A;  3P1E A;  2R0S A;  5J0D A;  5CQ7 A;  4UYG A;  5DFD A;  5EK9 A;  2DVV A;  4NYV A;  4J3I A;  5EIS A;  4QBM A;  4IOQ A;  5D26 A;  5LJ0 A;  5HEM A;  4X2I A;  3QZS A;  5DLZ A;  5FG4 A;  5I7X A;  2D82 A;  5L97 A;  3S91 A;  2RNY A;  1WUM A;  5A5N A;  5ETB A;  3DAI A;  3P5O A;  5I86 A;  5I89 A;  4NUE A;  5FE9 A;  4UYF B;  3U5L A;  4LYI A;  5D0C A;  5EV9 A;  4UIU A;  4YYH A;  5KTU A;  3SVF A;  4NR6 A;  4KCX A;  4CFL A;  4GPJ A;  2DVR A;  4XUA A;  3U5J A;  4UIY A;  5FE5 A;  3Q2F A;  4O74 A;  4QSX A;  5EA1 A;  5EWH A;  4QUT A;  5E0R A;  4NRA A;  5CZG A;  4PTB A;  5A83 A;  2F6N A;  5E3G A;  5CUD A;  1EQF A;  4Q0N A;  3G0J A;  5FG5 A;  4QSW A;  5FH7 A;  3LQJ A;  4CLB A;  5HM0 A;  3UVW A;  5IGM A;  4XUB A;  5LJ2 A;  4O70 A; 
#chains in the Genus database with same CATH topology
 4O78 A;  5KTW A;  3SVH A;  4N4G A;  4Z1S A;  3JVL A;  4CUS A;  5CQ8 A;  5D3N A;  5CQT A;  3Q2E A;  5HJC A;  2WP2 A;  4QEV A;  4TS8 A;  4CUT A;  5AD3 A;  5I40 A;  4TT6 A;  5A5O A;  3QZV A;  5EWD A;  3UW9 A;  4HBW A;  4IOR A;  5CQ5 A;  4QSV A;  5EI4 A;  5KTX A;  5LKZ A;  5FE4 A;  5CRZ A;  3D1B A;  2RFJ A;  4QZS A;  5CPE A;  4MEO A;  4AI6 A;  2R10 A;  5DYA A;  4UIZ A;  4N3W A;  4NR5 A;  4MEN A;  5F61 A;  4BW3 A;  5CS8 A;  5FE7 A;  4YBS A;  5BT3 A;  4KV1 A;  4O7A A;  3O34 A;  3O33 A;  4QYD A;  4NR8 A;  5L99 A;  5H85 A;  5EPB A;  2E3K A;  2YYN A;  4HBX A;  4O7C A;  5FE6 A;  5F63 A;  5C85 A;  4LR6 A;  3LQI A;  5ENJ A;  5ACY A;  5CUG A;  5FFW A;  5LVQ A;  3VKH A;  3LQH A;  5I7Y A;  4YYJ A;  4MEQ A;  3HMF A;  5FE1 A;  4ZQL A;  4O7B A;  4A9I A;  5CQA A;  5ENH A;  5FE2 A;  3HME A;  5COI A;  5TCM A;  3NXB A;  2E7O A;  5IID A;  5K29 A;  4RVR A;  5A81 A;  3JVK A;  4DON A;  4QST A;  4YH3 A;  5CGP A;  5A7C A;  5D3R A;  5FE0 A;  5EGU A;  5FE3 A;  4YYN A;  5DKH A;  4OGJ A;  4WHW A;  1JSP B;  5F1H A;  4LYS A;  5KO4 A;  4NQN A;  5F1L A;  4QSQ A;  5E9V A;  4BHW A;  4YAD A;  5F3A A;  3O36 A;  5FB0 A;  4TU4 A;  4UIW A;  5I83 A;  5A5R A;  4UYE A;  2DVS A;  3UVX A;  2YEK A;  4ZW1 A;  4Z93 A;  3JVM A;  3MQM A;  2R0Y A;  4PCI A;  4HXK A;  5A5S A;  4WIV A;  3P1D A;  4N4F A;  4YYD A;  5CY9 A;  5C8G A;  3MB3 A;  2GRC A;  5HFR A;  5FBX A;  3MB4 A;  4YYI A;  4TTE A;  2RNX A;  5F36 A;  3MXF A;  5L98 A;  3P1C A;  4C66 A;  5DY7 A;  4CUP A;  1ZS5 A;  5F2P A;  5CU8 A;  4NRC A;  2RS9 B;  4WHU A;  5CUC A;  2NXB A;  5D25 A;  4O7F A;  5HRX A;  4QR4 A;  4J0R A;  5EM3 A;  4QSS A;  2OUO A;  4CL9 A;  5CUA A;  5AD2 A;  2DAT A;  2YEL A;  4QNS A;  4OUF A;  5E9Y A;  5EP7 A;  5IGL A;  3GG3 A;  4HBV A;  5IGN A;  4BJX A;  5E9I A;  5EQ1 A;  5CQ3 A;  5LKU A;  4MR5 A;  4N4I A;  5E9M A;  4HXR A;  5HQ5 A;  5C4Q A;  5HCL A;  2YDW A;  5AME A;  4AKN A;  4BW2 A;  5C87 A;  5D3L A;  4UIT A;  4CFK A;  4HXO A;  2WP1 A;  4NUC A;  2DKW A;  5E9K A;  2YW5 A;  3ERR A;  2OO1 A;  4A9H A;  4O71 A;  5DYU A;  5FG6 A;  3MUL A;  4QC3 A;  4QEU A;  5D3J A;  2OSS A;  5FE8 A;  5EIC A;  5ETD A;  5E7D A;  5I29 A;  4Y03 A;  5CQ6 A;  4PCE A;  3HMH A;  3VKG A;  4LZS A;  4MR6 A;  4UYD A;  5EVA A;  4TYL A;  5D3T A;  4YAX A;  3QZT A;  3MUK A;  4CUR A;  5D3H A;  5FFY A;  4TT2 A;  4IOO A;  2YQD A;  4Q0O A;  4QB3 A;  4AKG A;  4LC2 A;  2DVQ A;  4PKL A;  3UVY A;  2YEM A;  3UV4 A;  4Z6I A;  3LJW A;  4PY6 A;  4AKH A;  3D7C A;  5DLX A;  4TT4 A;  4HBY A;  3ONI A;  4PS5 A;  5F60 A;  4IR6 A;  5D7X A;  4MR3 A;  5H1V A;  3LXJ A;  1N72 A;  5D3S A;  5DX4 A;  5DKD A;  4TZ2 A;  5DFC A;  4NR9 A;  5E3D A;  5DW1 A;  4XYA A;  3U5K A;  3UVD A;  2H60 A;  4MR4 A;  5C7N A;  4HXL A;  5ENI A;  4YYG A;  4C67 A;  5CUB A;  2KTB B;  5LKT A;  3AQA A;  3IU6 A;  4UIV A;  5FDZ A;  3RCW A;  5F25 A;  4UYF A;  4LDF A;  5L8U A;  5ENB A;  4HXN A;  5DYX A;  4A9L A;  4F3I A;  5EWW A;  3U5N A;  5CUE A;  5CP5 A;  4YH4 A;  4IR4 A;  4QR5 A;  3SVG A;  4A9E A;  4LZR A;  2L85 A;  3O37 A;  4TZ8 A;  5LKX A;  5I88 A;  5JI8 A;  5DW2 A;  4IR3 A;  5II2 A;  4FLP A;  5IG6 A;  4QC1 A;  4QSR A;  5HQ7 A;  5H1T A;  3U5M A;  5KU3 A;  5HEN A;  4ALG A;  2FSA A;  4HXS A;  2DWW A;  5DYC A;  3UV5 A;  4YC9 A;  4QYL A;  4YY4 A;  3AAD A;  3U5O A;  4A9O A;  5CFW A;  5LJ1 A;  4A9N A;  4XY8 A;  4OGI A;  5A82 A;  5BT4 A;  4NUD A;  1ZKR A;  5A5P A;  4A9J A;  5FH8 A;  4E96 A;  5EPS A;  5EPR A;  4NQM A;  4CUQ A;  4J0S A;  5ENG A;  5HRW A;  5I80 A;  2EJN A;  4YBT A;  2E7N A;  4A9F A;  5CQ4 A;  3IU5 A;  4LRG A;  5E74 A;  3TLP A;  2D9E A;  3O35 A;  4NRB A;  5D24 A;  4ALH A;  4QUU A;  4KV4 A;  2I8N A;  3FKM X;  3G0L A;  5FB1 A;  4NXJ A;  2RO1 A;  2LSP B;  4UIX A;  4BW4 A;  4BW1 A;  4YBM A;  5CTL A;  5F5Z A;  5HQ6 A;  5G4S A;  5IGK A;  4A9K A;  4A9M A;  2L84 A;  4YYM A;  5E73 A;  5LUU A;  4Z6H A;  5I1Q A;  5JWM A;  5DFB A;  3U5P A;  4LZ2 A;  1JM4 B;  4Z1Q A;  4LYW A;  4QSP A;  4J1P A;  5HFQ A;  5ENC A;  1X0J A;  5F62 A;  5DBM A;  3ZYU A;  2MJV B;  4YK0 A;  5EWV A;  1WUG A;  5A85 A;  4HXP A;  2L5E A;  5EU1 A;  5A5Q A;  3P1F A;  5LVR A;  2N9G A;  3UV2 A;  4O75 A;  1E6I A;  2F6J A;  4O76 A;  4QR3 A;  2RI7 A;  5L8T A;  5AMF A;  4ZC9 A;  5KHM A;  5H1U A;  3JVJ A;  5II1 A;  4N4H A;  4QSU A;  5DKC A;  5FH6 A;  4CUU A;  4YAB A;  3K2J A;  4MEP A;  4QEW A;  5HRV A;  3S92 A;  4O7E A;  4O72 A;  4QY4 A;  4UYH A;  4NYW A;  3DWY A;  4YY6 A;  4NR7 A;  5ENE A;  5FFV A;  1F68 A;  5HLS A;  5E9L A;  5G4R A;  4O77 A;  4HXM A;  4NYX A;  2G4A A;  5EWC A;  5IBN A;  4NS5 A;  5D3P A;  4XY9 A;  5L96 A;  5TB6 A;  5C89 A;  2I7K A;  4IR5 A;  5HEL A;  5CRM A;  4NR4 A;  2R0V A;  4TQN A;  4YAT A;  4YYK A;  2RNW A;  5ENF A;  3I3J A;  4TU6 A;  5BT5 A;  3P1E A;  2R0S A;  5J0D A;  5CQ7 A;  4UYG A;  5DFD A;  5EK9 A;  2DVV A;  4NYV A;  4J3I A;  5EIS A;  4QBM A;  4IOQ A;  5D26 A;  5LJ0 A;  5HEM A;  4X2I A;  3QZS A;  5DLZ A;  5FG4 A;  5I7X A;  2D82 A;  5L97 A;  3S91 A;  2RNY A;  1WUM A;  5A5N A;  5ETB A;  3DAI A;  3P5O A;  5I86 A;  5I89 A;  4NUE A;  1PUO A;  5FE9 A;  4UYF B;  3U5L A;  4LYI A;  5D0C A;  5EV9 A;  4UIU A;  4YYH A;  5KTU A;  3SVF A;  4NR6 A;  4KCX A;  4CFL A;  4GPJ A;  2DVR A;  4XUA A;  3U5J A;  4UIY A;  5FE5 A;  3Q2F A;  4O74 A;  4QSX A;  5EA1 A;  5EWH A;  3D1D A;  4QUT A;  5E0R A;  4NRA A;  5CZG A;  4PTB A;  4AKI A;  5A83 A;  2F6N A;  5E3G A;  5CUD A;  1EQF A;  4Q0N A;  3G0J A;  5FG5 A;  4QSW A;  5FH7 A;  3LQJ A;  4CLB A;  5HM0 A;  3UVW A;  5IGM A;  4XUB A;  5LJ2 A;  4O70 A; 
#chains in the Genus database with same CATH homology
 4O78 A;  5KTW A;  3SVH A;  4N4G A;  4Z1S A;  3JVL A;  4CUS A;  5CQ8 A;  5D3N A;  5CQT A;  3Q2E A;  5HJC A;  2WP2 A;  4QEV A;  4TS8 A;  4CUT A;  5AD3 A;  5I40 A;  4TT6 A;  5A5O A;  3QZV A;  5EWD A;  3UW9 A;  4HBW A;  4IOR A;  5CQ5 A;  4QSV A;  5EI4 A;  5KTX A;  5LKZ A;  5FE4 A;  5CRZ A;  2RFJ A;  4QZS A;  5CPE A;  4MEO A;  2R10 A;  5DYA A;  4UIZ A;  4N3W A;  4NR5 A;  4MEN A;  5F61 A;  4BW3 A;  5CS8 A;  5FE7 A;  4YBS A;  5BT3 A;  4KV1 A;  4O7A A;  3O34 A;  3O33 A;  4QYD A;  4NR8 A;  5L99 A;  5H85 A;  5EPB A;  2E3K A;  2YYN A;  4HBX A;  4O7C A;  5FE6 A;  5F63 A;  5C85 A;  4LR6 A;  3LQI A;  5ENJ A;  5ACY A;  5CUG A;  5FFW A;  5LVQ A;  3LQH A;  5I7Y A;  4YYJ A;  4MEQ A;  3HMF A;  5FE1 A;  4ZQL A;  4O7B A;  4A9I A;  5CQA A;  5ENH A;  5FE2 A;  3HME A;  5COI A;  5TCM A;  3NXB A;  2E7O A;  5IID A;  5K29 A;  4RVR A;  5A81 A;  3JVK A;  4DON A;  4QST A;  4YH3 A;  5CGP A;  5A7C A;  5D3R A;  5FE0 A;  5EGU A;  5FE3 A;  4YYN A;  5DKH A;  4OGJ A;  4WHW A;  1JSP B;  5F1H A;  4LYS A;  5KO4 A;  4NQN A;  5F1L A;  4QSQ A;  5E9V A;  4BHW A;  4YAD A;  5F3A A;  3O36 A;  5FB0 A;  4TU4 A;  4UIW A;  5I83 A;  5A5R A;  4UYE A;  2DVS A;  3UVX A;  2YEK A;  4ZW1 A;  4Z93 A;  3JVM A;  3MQM A;  2R0Y A;  4PCI A;  4HXK A;  5A5S A;  4WIV A;  3P1D A;  4N4F A;  4YYD A;  5CY9 A;  5C8G A;  3MB3 A;  2GRC A;  5HFR A;  5FBX A;  3MB4 A;  4YYI A;  4TTE A;  2RNX A;  5F36 A;  3MXF A;  5L98 A;  3P1C A;  4C66 A;  5DY7 A;  4CUP A;  1ZS5 A;  5F2P A;  5CU8 A;  4NRC A;  2RS9 B;  4WHU A;  5CUC A;  2NXB A;  5D25 A;  4O7F A;  5HRX A;  4QR4 A;  4J0R A;  5EM3 A;  4QSS A;  2OUO A;  4CL9 A;  5CUA A;  5AD2 A;  2DAT A;  2YEL A;  4QNS A;  4OUF A;  5E9Y A;  5EP7 A;  5IGL A;  3GG3 A;  4HBV A;  5IGN A;  4BJX A;  5E9I A;  5EQ1 A;  5CQ3 A;  5LKU A;  4MR5 A;  4N4I A;  5E9M A;  4HXR A;  5HQ5 A;  5C4Q A;  5HCL A;  2YDW A;  5AME A;  4AKN A;  4BW2 A;  5C87 A;  5D3L A;  4UIT A;  4CFK A;  4HXO A;  2WP1 A;  4NUC A;  2DKW A;  5E9K A;  2YW5 A;  4A9H A;  2OO1 A;  4O71 A;  5DYU A;  5FG6 A;  3MUL A;  4QC3 A;  4QEU A;  5D3J A;  2OSS A;  5FE8 A;  5EIC A;  5ETD A;  5E7D A;  5I29 A;  4Y03 A;  5CQ6 A;  4PCE A;  3HMH A;  4LZS A;  4MR6 A;  4UYD A;  5EVA A;  4TYL A;  5D3T A;  4YAX A;  3QZT A;  3MUK A;  4CUR A;  5D3H A;  5FFY A;  4TT2 A;  4IOO A;  2YQD A;  4Q0O A;  4QB3 A;  4LC2 A;  2DVQ A;  4PKL A;  3UVY A;  2YEM A;  3UV4 A;  4Z6I A;  3LJW A;  4PY6 A;  3D7C A;  5DLX A;  4TT4 A;  4HBY A;  3ONI A;  4PS5 A;  5F60 A;  4IR6 A;  5D7X A;  4MR3 A;  5H1V A;  3LXJ A;  1N72 A;  5D3S A;  5DX4 A;  5DKD A;  4TZ2 A;  5DFC A;  4NR9 A;  5E3D A;  5DW1 A;  4XYA A;  3U5K A;  3UVD A;  2H60 A;  4MR4 A;  5C7N A;  4HXL A;  5ENI A;  4YYG A;  4C67 A;  5CUB A;  2KTB B;  5LKT A;  3AQA A;  3IU6 A;  4UIV A;  5FDZ A;  3RCW A;  5F25 A;  4UYF A;  4LDF A;  5L8U A;  5ENB A;  4HXN A;  5DYX A;  4A9L A;  4F3I A;  5EWW A;  3U5N A;  5CUE A;  5CP5 A;  4YH4 A;  4IR4 A;  4QR5 A;  3SVG A;  4A9E A;  4LZR A;  2L85 A;  3O37 A;  4TZ8 A;  5LKX A;  5I88 A;  5JI8 A;  5DW2 A;  4IR3 A;  5II2 A;  4FLP A;  5IG6 A;  4QC1 A;  4QSR A;  5HQ7 A;  5H1T A;  3U5M A;  5KU3 A;  5HEN A;  4ALG A;  2FSA A;  4HXS A;  2DWW A;  5DYC A;  3UV5 A;  4YC9 A;  4QYL A;  4YY4 A;  3AAD A;  3U5O A;  4A9O A;  5CFW A;  5LJ1 A;  4A9N A;  4XY8 A;  4OGI A;  5A82 A;  5BT4 A;  4NUD A;  5A5P A;  4A9J A;  5FH8 A;  4E96 A;  5EPS A;  5EPR A;  4NQM A;  4CUQ A;  4J0S A;  5ENG A;  5HRW A;  5I80 A;  4YBT A;  2E7N A;  4A9F A;  5CQ4 A;  3IU5 A;  4LRG A;  5E74 A;  3TLP A;  2D9E A;  3O35 A;  4NRB A;  5D24 A;  4ALH A;  4QUU A;  4KV4 A;  2I8N A;  3FKM X;  3G0L A;  5FB1 A;  4NXJ A;  2RO1 A;  2LSP B;  4UIX A;  4BW4 A;  4BW1 A;  4YBM A;  5CTL A;  5F5Z A;  5HQ6 A;  5G4S A;  5IGK A;  4A9K A;  4A9M A;  2L84 A;  4YYM A;  5E73 A;  5LUU A;  4Z6H A;  5I1Q A;  5JWM A;  5DFB A;  3U5P A;  4LZ2 A;  1JM4 B;  4Z1Q A;  4LYW A;  4QSP A;  4J1P A;  5HFQ A;  5ENC A;  1X0J A;  5F62 A;  5DBM A;  3ZYU A;  2MJV B;  4YK0 A;  5EWV A;  1WUG A;  5A85 A;  4HXP A;  2L5E A;  5EU1 A;  5A5Q A;  3P1F A;  5LVR A;  2N9G A;  3UV2 A;  4O75 A;  1E6I A;  2F6J A;  4O76 A;  4QR3 A;  2RI7 A;  5L8T A;  5AMF A;  4ZC9 A;  5KHM A;  5H1U A;  3JVJ A;  5II1 A;  4N4H A;  4QSU A;  5DKC A;  5FH6 A;  4CUU A;  4YAB A;  3K2J A;  4MEP A;  4QEW A;  5HRV A;  3S92 A;  4O7E A;  4O72 A;  4QY4 A;  4UYH A;  4NYW A;  3DWY A;  4YY6 A;  4NR7 A;  5ENE A;  5FFV A;  1F68 A;  5HLS A;  5E9L A;  5G4R A;  4O77 A;  4HXM A;  4NYX A;  2G4A A;  5EWC A;  5IBN A;  4NS5 A;  5D3P A;  4XY9 A;  5L96 A;  5TB6 A;  5C89 A;  2I7K A;  4IR5 A;  5HEL A;  5CRM A;  4NR4 A;  2R0V A;  4TQN A;  4YAT A;  4YYK A;  2RNW A;  5ENF A;  3I3J A;  4TU6 A;  5BT5 A;  3P1E A;  2R0S A;  5J0D A;  5CQ7 A;  4UYG A;  5DFD A;  5EK9 A;  2DVV A;  4NYV A;  4J3I A;  5EIS A;  4QBM A;  4IOQ A;  5D26 A;  5LJ0 A;  5HEM A;  4X2I A;  3QZS A;  5DLZ A;  5FG4 A;  5I7X A;  2D82 A;  5L97 A;  3S91 A;  2RNY A;  1WUM A;  5A5N A;  5ETB A;  3DAI A;  3P5O A;  5I86 A;  5I89 A;  4NUE A;  5FE9 A;  4UYF B;  3U5L A;  4LYI A;  5D0C A;  5EV9 A;  4UIU A;  4YYH A;  5KTU A;  3SVF A;  4NR6 A;  4KCX A;  4CFL A;  4GPJ A;  2DVR A;  4XUA A;  3U5J A;  4UIY A;  5FE5 A;  3Q2F A;  4O74 A;  4QSX A;  5EA1 A;  5EWH A;  4QUT A;  5E0R A;  4NRA A;  5CZG A;  4PTB A;  5A83 A;  2F6N A;  5E3G A;  5CUD A;  1EQF A;  4Q0N A;  3G0J A;  5FG5 A;  4QSW A;  5FH7 A;  3LQJ A;  4CLB A;  5HM0 A;  3UVW A;  5IGM A;  4XUB A;  5LJ2 A;  4O70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...