4Z6IA

Crystal structure of brd9 bromodomain in complex with a substituted valerolactam quinolone ligand
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 9
publication title LP99: Discovery and Synthesis of the First Selective BRD7/9 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4z6iA00
5FFVA 5F25A 4LDFA 4XY9A 5TCMA 4NXJA 5DKDA 5C85A 3UVYA 4NR6A 5D3JA 4CUTA 4IORA 5HRXA 4NR5A 5ENIA 5ETBA 4ZQLA 5FE2A 5HRWA 5AD3A 5FH7A 3DWYA 4TU6A 2RNXA 4YBMA 5HFRA 2KTBB 5E3DA 4UYGA 3U5NA 5G4SA 5DLXA 3QZVA 5C89A 5ETDA 4UIXA 5EU1A 5FE6A 5A5RA 2RI7A 5H1VA 5KTUA 5LKXA 5II1A 4A9HA 4C67A 5DYUA 5LJ0A 5CZGA 5DKCA 5LKTA 4ZC9A 4ZW1A 5L8TA 5L97A 4QB3A 4J1PA 5KHMA 4UYHA 5CUGA 2OO1A 2WP2A 3QZSA 4X2IA 3MB4A 5F63A 4QSTA 5CQ5A 4HXSA 5ENJA 5FG5A 5COIA 5ACYA 3GG3A 5EPBA 5HCLA 3ONIA 2YEKA 5DLZA 4TU4A 5A5NA 5CUEA 5D26A 4QSPA 4IOOA 5LJ1A 4LZ2A 4HBWA 4QSVA 4O7FA 5K29A 5EQ1A 5CRZA 4UITA 4MR4A 3IU5A 4A9LA 5FH8A 5EP7A 5FFYA 5I89A 3U5PA 5CUDA 5E73A 4CFLA 5CQ8A 4O71A 5EM3A 3U5OA 5LKZA 5D3LA 3U5KA 2RS9B 3O37A 2MJVB 5JI8A 5IGLA 4J0RA 5ENCA 5E74A 5I7XA 5CPEA 5D3SA 2I8NA 4YABA 4WHUA 2OUOA 4YYMA 5D24A 5CRMA 3Q2EA 5D3RA 3HMEA 4QSXA 5TB6A 3UV4A 4ALHA 3UW9A 2DVSA 5FB0A 3LXJA 2R10A 4LYIA 5E9KA 3U5MA 4QC1A 5LVQA 2RFJA 5I40A 5EK9A 5EV9A 2LSPB 4NUEA 5CU8A 4PCEA 3MXFA 4Z1QA 4XYAA 4WIVA 4A9EA 4QY4A 4F3IA 5DY7A 5FH6A 2L5EA 5L96A 5FE4A 2FSAA 2YYNA 5CUBA 3TLPA 5E9YA 4BW3A 4QSRA 4IOQA 5D3HA 4QSSA 1JM4B 4YC9A 5F5ZA 5JWMA 4YH3A 5HQ7A 4QSQA 5IBNA 4OUFA 5EWWA 4LZSA 4QC3A 1N72A 4A9JA 4HBVA 5ENFA 3Q2FA 4NRAA 4NR7A 5EA1A 4QR4A 4CFKA 4QSWA 4Q0NA 5CQ4A 4BW4A 5ENGA 4MR6A 4NRBA 3DAIA 4N3WA 5HENA 3P1EA 4OGJA 4YYKA 5KO4A 4YK0A 3FKMX 5I80A 3LJWA 2N9GA 4O76A 5IGKA 3U5LA 2NXBA 4QYLA 5A85A 5H1TA 4NQNA 3G0LA 4LR6A 4MEQA 4IR6A 4NS5A 4PKLA 3U5JA 5E9VA 5DX4A 4DONA 5CQTA 5EI4A 3JVLA 4LZRA 2DVRA 4O7EA 5IGNA 4O7AA 5FE8A 3QZTA 1F68A 5DYCA 5F61A 4QR5A 3P5OA 3SVHA 2GRCA 4IR5A 4A9FA 5AMFA 2YW5A 5F36A 4OGIA 5F62A 4A9MA 5EISA 5A5PA 3SVFA 4HXOA 4PY6A 5BT3A 5D25A 4MEPA 3HMHA 4HXLA 4LRGA 5H85A 2D9EA 5KTXA 3UV2A 4J0SA 5ENHA 4XY8A 4UIZA 3LQHA 5EWHA 5L99A 4QEVA 4NYWA 1WUMA 4CUUA 4QSUA 3ZYUA 5FE1A 4CUQA 5CQ7A 5G4RA 3O36A 4O7BA 5EICA 3NXBA 4O77A 3JVKA 5AMEA 3UV5A 4PTBA 4A9KA 5FG6A 2H60A 4HXNA 4YAXA 5IG6A 2R0YA 4UIUA 4TT2A 5FDZA 5D3NA 4BW2A 4N4FA 3S91A 4TT6A 4O7CA 5F60A 4YY4A 4Y03A 4YYJA 3O35A 4Q0OA 5CUAA 5HRVA 2R0VA 3P1CA 5LUUA 2E7OA 5II2A 1EQFA 4CLBA 1WUGA 4KV4A 5AD2A 4NUCA 4TZ8A 4CL9A 4O72A 4O74A 4YBSA 1X0JA 2E3KA 4HXRA 4QUUA 4TZ2A 4MR5A 4MR3A 5HQ5A 4QZSA 5CGPA 5EWCA 4O75A 4CUSA 2WP1A 5EWDA 5CTLA 5I7YA 4BJXA 3K2JA 4LYSA 3G0JA 4YY6A 4UYEA 2YELA 4YYNA 4IR4A 5EPRA 5HFQA 2YEMA 5A83A 5BT4A 3P1DA 4YH4A 5L98A 1JSPB 4LYWA 5FG4A 4YADA 5A82A 4RVRA 5DFBA 2DWWA 4CURA 5H1UA 2L84A 2OSSA 4Z93A 4E96A 5F2PA 5FE5A 5L8UA 4QYDA 2I7KA 4NRCA 2RNWA 4A9OA 4BW1A 5C87A 3MULA 2R0SA 4HXKA 5A5QA 4HBYA 4NUDA 5E9MA 4HXMA 3SVGA 4YBTA 5HLSA 4UIVA 5I88A 4XUAA 5FE7A 5EPSA 5I86A 4NR8A 5F3AA 5HELA 5D3PA 5EVAA 5CQ3A 2L85A 4BHWA 5LJ2A 4A9IA 5A5OA 4UYFA 5E3GA 3O33A 4YYHA 5CQAA 4PCIA 4YATA 5DKHA 4NQMA 5IGMA 1E6IA 4QBMA 4N4GA 4KV1A 3LQJA 4TS8A 5ENBA 4AKNA 4YYDA 4UYFB 5F1LA 2DVVA 5A81A 4N4HA 4C66A 4UIWA 2YQDA 3UVXA 4GPJA 4CUPA 5C8GA 4A9NA 3AADA 2D82A 3AQAA 4Z6IA 4QUTA 5FE9A 5DBMA 5IIDA 5CFWA 4NYVA 4Z1SA 4TQNA 5I83A 3D7CA 4FLPA 4QR3A 4HXPA 3O34A 5I1QA 5FB1A 4UYDA 5BT5A 5E7DA 4LC2A 5FBXA 4J3IA 3IU6A 5D3TA 2E7NA 5HM0A 4QEUA 5F1HA 3UVDA 5LVRA 5KU3A 4TTEA 5DFDA 2RNYA 2DKWA 3I3JA 4NR9A 5D7XA 2F6JA 4UIYA 5DW2A 4QNSA 5CP5A 5A7CA 2DATA 3MB3A 5EGUA 4IR3A 5A5SA 5HEMA 4O78A 3MUKA 5DYAA 3HMFA 2DVQA 4NR4A 3MQMA 5FE3A 3RCWA 1ZS5A 4MEOA 4YYGA 3P1FA 5E9IA 4O70A 5HQ6A 2G4AA 5CQ6A 5E0RA 4HBXA 3JVMA 2RO1A 4KCXA 5E9LA 4TYLA 5DYXA 5D0CA 4N4IA 5DFCA 4TT4A 5CY9A 4PS5A 5C4QA 3LQIA 5FFWA 4Z6HA 5I29A 2YDWA 4QEWA 3JVJA 4WHWA 5C7NA 5LKUA 5FE0A 3UVWA 2F6NA 4XUBA 4ALGA 5CUCA 3S92A 5J0DA 5HJCA 4YYIA 4NYXA 5DW1A 5CS8A 5EWVA 4MENA 5KTWA 5ENEA
chains in the Genus database with same CATH superfamily
5FFVA 5F25A 4LDFA 4XY9A 5TCMA 4NXJA 5DKDA 5C85A 3UVYA 4NR6A 5D3JA 4CUTA 4IORA 5HRXA 4NR5A 5ENIA 5ETBA 4ZQLA 5FE2A 5HRWA 3VKGA 5AD3A 5FH7A 3DWYA 4TU6A 2RNXA 4YBMA 5HFRA 2KTBB 5E3DA 4UYGA 3U5NA 5G4SA 5DLXA 3QZVA 5C89A 1PUOA 5ETDA 4UIXA 5EU1A 5FE6A 5A5RA 2RI7A 5H1VA 5KTUA 5LKXA 5II1A 4A9HA 4C67A 5DYUA 5LJ0A 5CZGA 5DKCA 5LKTA 4ZC9A 4ZW1A 5L8TA 5L97A 4QB3A 4J1PA 5KHMA 4UYHA 5CUGA 2OO1A 2WP2A 3D1DA 3QZSA 4X2IA 3MB4A 5F63A 4QSTA 5CQ5A 4HXSA 5ENJA 5FG5A 5COIA 5ACYA 3GG3A 5EPBA 5HCLA 3ONIA 2YEKA 5DLZA 4TU4A 5A5NA 5CUEA 5D26A 4QSPA 4IOOA 5LJ1A 4LZ2A 4HBWA 4QSVA 4O7FA 5K29A 5EQ1A 5CRZA 4UITA 4MR4A 3IU5A 4A9LA 4AKHA 5FH8A 5EP7A 5FFYA 4AKIA 5I89A 3U5PA 5CUDA 5E73A 4CFLA 5CQ8A 4O71A 5EM3A 3U5OA 5LKZA 5D3LA 3U5KA 2RS9B 3O37A 2MJVB 5JI8A 5IGLA 4J0RA 5ENCA 5E74A 5I7XA 5CPEA 5D3SA 2I8NA 4YABA 4WHUA 2OUOA 4YYMA 5D24A 5CRMA 3Q2EA 5D3RA 3HMEA 4QSXA 5TB6A 3UV4A 4ALHA 3UW9A 2DVSA 5FB0A 2EJNA 3LXJA 2R10A 4LYIA 5E9KA 3U5MA 4QC1A 5LVQA 2RFJA 5I40A 5EK9A 5EV9A 2LSPB 4NUEA 5CU8A 4PCEA 3MXFA 4Z1QA 4XYAA 4WIVA 4A9EA 4QY4A 4F3IA 5DY7A 5FH6A 2L5EA 5L96A 5FE4A 2FSAA 2YYNA 5CUBA 3TLPA 5E9YA 4BW3A 4QSRA 4IOQA 5D3HA 3VKHA 4QSSA 1JM4B 4AKGA 4YC9A 5F5ZA 5JWMA 4YH3A 5HQ7A 4QSQA 5IBNA 4OUFA 5EWWA 4LZSA 4QC3A 1N72A 1ZKRA 4A9JA 4HBVA 5ENFA 3Q2FA 4NRAA 4NR7A 5EA1A 4QR4A 4CFKA 4QSWA 4Q0NA 5CQ4A 4BW4A 5ENGA 4MR6A 4NRBA 3DAIA 4N3WA 5HENA 3P1EA 4OGJA 4YYKA 5KO4A 4YK0A 3FKMX 5I80A 3LJWA 2N9GA 4O76A 5IGKA 3U5LA 2NXBA 4QYLA 5A85A 5H1TA 4NQNA 3G0LA 4LR6A 4MEQA 3ERRA 4IR6A 4NS5A 4PKLA 3U5JA 5E9VA 5DX4A 4DONA 5CQTA 5EI4A 3JVLA 4LZRA 2DVRA 4O7EA 5IGNA 4O7AA 5FE8A 3QZTA 1F68A 5DYCA 5F61A 4QR5A 3P5OA 3SVHA 2GRCA 4IR5A 4A9FA 5AMFA 2YW5A 5F36A 4OGIA 5F62A 4A9MA 5EISA 5A5PA 3SVFA 4HXOA 4PY6A 5BT3A 5D25A 4MEPA 3HMHA 4HXLA 4LRGA 5H85A 2D9EA 5KTXA 3UV2A 4J0SA 5ENHA 4XY8A 4UIZA 3LQHA 5EWHA 5L99A 4QEVA 4NYWA 1WUMA 4CUUA 4QSUA 3ZYUA 5FE1A 4CUQA 5CQ7A 5G4RA 3O36A 4O7BA 5EICA 3NXBA 4O77A 3JVKA 5AMEA 3UV5A 4PTBA 4A9KA 5FG6A 2H60A 4HXNA 4YAXA 5IG6A 2R0YA 4UIUA 4TT2A 5FDZA 5D3NA 4BW2A 4N4FA 3S91A 4TT6A 4O7CA 5F60A 4YY4A 4Y03A 4YYJA 3O35A 4Q0OA 5CUAA 5HRVA 2R0VA 3P1CA 5LUUA 2E7OA 5II2A 1EQFA 4CLBA 1WUGA 4KV4A 5AD2A 4NUCA 4TZ8A 4CL9A 4O72A 4O74A 4YBSA 1X0JA 2E3KA 4HXRA 4QUUA 4TZ2A 4MR5A 4MR3A 5HQ5A 4QZSA 5CGPA 5EWCA 4O75A 4CUSA 2WP1A 5EWDA 5CTLA 5I7YA 4BJXA 3K2JA 4LYSA 4AI6A 3G0JA 4YY6A 4UYEA 2YELA 4YYNA 3D1BA 4IR4A 5EPRA 5HFQA 2YEMA 5A83A 5BT4A 3P1DA 4YH4A 5L98A 1JSPB 4LYWA 5FG4A 4YADA 5A82A 4RVRA 5DFBA 2DWWA 4CURA 5H1UA 2L84A 2OSSA 4Z93A 4E96A 5F2PA 5FE5A 5L8UA 4QYDA 2I7KA 4NRCA 2RNWA 4A9OA 4BW1A 5C87A 3MULA 2R0SA 4HXKA 5A5QA 4HBYA 4NUDA 5E9MA 4HXMA 3SVGA 4YBTA 5HLSA 4UIVA 5I88A 4XUAA 5FE7A 5EPSA 5I86A 4NR8A 5F3AA 5HELA 5D3PA 5EVAA 5CQ3A 2L85A 4BHWA 5LJ2A 4A9IA 5A5OA 4UYFA 5E3GA 3O33A 4YYHA 5CQAA 4PCIA 4YATA 5DKHA 4NQMA 5IGMA 1E6IA 4QBMA 4N4GA 4KV1A 3LQJA 4TS8A 5ENBA 4AKNA 4YYDA 4UYFB 5F1LA 2DVVA 5A81A 4N4HA 4C66A 4UIWA 2YQDA 3UVXA 4GPJA 4CUPA 5C8GA 4A9NA 3AADA 2D82A 3AQAA 4Z6IA 4QUTA 5FE9A 5DBMA 5IIDA 5CFWA 4NYVA 4Z1SA 4TQNA 5I83A 3D7CA 4FLPA 4QR3A 4HXPA 3O34A 5I1QA 5FB1A 4UYDA 5BT5A 5E7DA 4LC2A 5FBXA 4J3IA 3IU6A 5D3TA 2E7NA 5HM0A 4QEUA 5F1HA 3UVDA 5LVRA 5KU3A 4TTEA 5DFDA 2RNYA 2DKWA 3I3JA 4NR9A 5D7XA 2F6JA 4UIYA 5DW2A 4QNSA 5CP5A 5A7CA 2DATA 3MB3A 5EGUA 4IR3A 5A5SA 5HEMA 4O78A 3MUKA 5DYAA 3HMFA 2DVQA 4NR4A 3MQMA 5FE3A 3RCWA 1ZS5A 4MEOA 4YYGA 3P1FA 5E9IA 4O70A 5HQ6A 2G4AA 5CQ6A 5E0RA 4HBXA 3JVMA 2RO1A 4KCXA 5E9LA 4TYLA 5DYXA 5D0CA 4N4IA 5DFCA 4TT4A 5CY9A 4PS5A 5C4QA 3LQIA 5FFWA 4Z6HA 5I29A 2YDWA 4QEWA 3JVJA 4WHWA 5C7NA 5LKUA 5FE0A 3UVWA 2F6NA 4XUBA 4ALGA 5CUCA 3S92A 5J0DA 5HJCA 4YYIA 4NYXA 5DW1A 5CS8A 5EWVA 4MENA 5KTWA 5ENEA
chains in the Genus database with same CATH topology
5FFVA 5F25A 4LDFA 4XY9A 5TCMA 4NXJA 5DKDA 5C85A 3UVYA 4NR6A 5D3JA 4CUTA 4IORA 5HRXA 4NR5A 5ENIA 5ETBA 4ZQLA 5FE2A 5HRWA 5AD3A 5FH7A 3DWYA 4TU6A 2RNXA 4YBMA 5HFRA 2KTBB 5E3DA 4UYGA 3U5NA 5G4SA 5DLXA 3QZVA 5C89A 5ETDA 4UIXA 5EU1A 5FE6A 5A5RA 2RI7A 5H1VA 5KTUA 5LKXA 5II1A 4A9HA 4C67A 5DYUA 5LJ0A 5CZGA 5DKCA 5LKTA 4ZC9A 4ZW1A 5L8TA 5L97A 4QB3A 4J1PA 5KHMA 4UYHA 5CUGA 2OO1A 2WP2A 3QZSA 4X2IA 3MB4A 5F63A 4QSTA 5CQ5A 4HXSA 5ENJA 5FG5A 5COIA 5ACYA 3GG3A 5EPBA 5HCLA 3ONIA 2YEKA 5DLZA 4TU4A 5A5NA 5CUEA 5D26A 4QSPA 4IOOA 5LJ1A 4LZ2A 4HBWA 4QSVA 4O7FA 5K29A 5EQ1A 5CRZA 4UITA 4MR4A 3IU5A 4A9LA 5FH8A 5EP7A 5FFYA 5I89A 3U5PA 5CUDA 5E73A 4CFLA 5CQ8A 4O71A 5EM3A 3U5OA 5LKZA 5D3LA 3U5KA 2RS9B 3O37A 2MJVB 5JI8A 5IGLA 4J0RA 5ENCA 5E74A 5I7XA 5CPEA 5D3SA 2I8NA 4YABA 4WHUA 2OUOA 4YYMA 5D24A 5CRMA 3Q2EA 5D3RA 3HMEA 4QSXA 5TB6A 3UV4A 4ALHA 3UW9A 2DVSA 5FB0A 3LXJA 2R10A 4LYIA 5E9KA 3U5MA 4QC1A 5LVQA 2RFJA 5I40A 5EK9A 5EV9A 2LSPB 4NUEA 5CU8A 4PCEA 3MXFA 4Z1QA 4XYAA 4WIVA 4A9EA 4QY4A 4F3IA 5DY7A 5FH6A 2L5EA 5L96A 5FE4A 2FSAA 2YYNA 5CUBA 3TLPA 5E9YA 4BW3A 4QSRA 4IOQA 5D3HA 4QSSA 1JM4B 4YC9A 5F5ZA 5JWMA 4YH3A 5HQ7A 4QSQA 5IBNA 4OUFA 5EWWA 4LZSA 4QC3A 1N72A 4A9JA 4HBVA 5ENFA 3Q2FA 4NRAA 4NR7A 5EA1A 4QR4A 4CFKA 4QSWA 4Q0NA 5CQ4A 4BW4A 5ENGA 4MR6A 4NRBA 3DAIA 4N3WA 5HENA 3P1EA 4OGJA 4YYKA 5KO4A 4YK0A 3FKMX 5I80A 3LJWA 2N9GA 4O76A 5IGKA 3U5LA 2NXBA 4QYLA 5A85A 5H1TA 4NQNA 3G0LA 4LR6A 4MEQA 4IR6A 4NS5A 4PKLA 3U5JA 5E9VA 5DX4A 4DONA 5CQTA 5EI4A 3JVLA 4LZRA 2DVRA 4O7EA 5IGNA 4O7AA 5FE8A 3QZTA 1F68A 5DYCA 5F61A 4QR5A 3P5OA 3SVHA 2GRCA 4IR5A 4A9FA 5AMFA 2YW5A 5F36A 4OGIA 5F62A 4A9MA 5EISA 5A5PA 3SVFA 4HXOA 4PY6A 5BT3A 5D25A 4MEPA 3HMHA 4HXLA 4LRGA 5H85A 2D9EA 5KTXA 3UV2A 4J0SA 5ENHA 4XY8A 4UIZA 3LQHA 5EWHA 5L99A 4QEVA 4NYWA 1WUMA 4CUUA 4QSUA 3ZYUA 5FE1A 4CUQA 5CQ7A 5G4RA 3O36A 4O7BA 5EICA 3NXBA 4O77A 3JVKA 5AMEA 3UV5A 4PTBA 4A9KA 5FG6A 2H60A 4HXNA 4YAXA 5IG6A 2R0YA 4UIUA 4TT2A 5FDZA 5D3NA 4BW2A 4N4FA 3S91A 4TT6A 4O7CA 5F60A 4YY4A 4Y03A 4YYJA 3O35A 4Q0OA 5CUAA 5HRVA 2R0VA 3P1CA 5LUUA 2E7OA 5II2A 1EQFA 4CLBA 1WUGA 4KV4A 5AD2A 4NUCA 4TZ8A 4CL9A 4O72A 4O74A 4YBSA 1X0JA 2E3KA 4HXRA 4QUUA 4TZ2A 4MR5A 4MR3A 5HQ5A 4QZSA 5CGPA 5EWCA 4O75A 4CUSA 2WP1A 5EWDA 5CTLA 5I7YA 4BJXA 3K2JA 4LYSA 3G0JA 4YY6A 4UYEA 2YELA 4YYNA 4IR4A 5EPRA 5HFQA 2YEMA 5A83A 5BT4A 3P1DA 4YH4A 5L98A 1JSPB 4LYWA 5FG4A 4YADA 5A82A 4RVRA 5DFBA 2DWWA 4CURA 5H1UA 2L84A 2OSSA 4Z93A 4E96A 5F2PA 5FE5A 5L8UA 4QYDA 2I7KA 4NRCA 2RNWA 4A9OA 4BW1A 5C87A 3MULA 2R0SA 4HXKA 5A5QA 4HBYA 4NUDA 5E9MA 4HXMA 3SVGA 4YBTA 5HLSA 4UIVA 5I88A 4XUAA 5FE7A 5EPSA 5I86A 4NR8A 5F3AA 5HELA 5D3PA 5EVAA 5CQ3A 2L85A 4BHWA 5LJ2A 4A9IA 5A5OA 4UYFA 5E3GA 3O33A 4YYHA 5CQAA 4PCIA 4YATA 5DKHA 4NQMA 5IGMA 1E6IA 4QBMA 4N4GA 4KV1A 3LQJA 4TS8A 5ENBA 4AKNA 4YYDA 4UYFB 5F1LA 2DVVA 5A81A 4N4HA 4C66A 4UIWA 2YQDA 3UVXA 4GPJA 4CUPA 5C8GA 4A9NA 3AADA 2D82A 3AQAA 4Z6IA 4QUTA 5FE9A 5DBMA 5IIDA 5CFWA 4NYVA 4Z1SA 4TQNA 5I83A 3D7CA 4FLPA 4QR3A 4HXPA 3O34A 5I1QA 5FB1A 4UYDA 5BT5A 5E7DA 4LC2A 5FBXA 4J3IA 3IU6A 5D3TA 2E7NA 5HM0A 4QEUA 5F1HA 3UVDA 5LVRA 5KU3A 4TTEA 5DFDA 2RNYA 2DKWA 3I3JA 4NR9A 5D7XA 2F6JA 4UIYA 5DW2A 4QNSA 5CP5A 5A7CA 2DATA 3MB3A 5EGUA 4IR3A 5A5SA 5HEMA 4O78A 3MUKA 5DYAA 3HMFA 2DVQA 4NR4A 3MQMA 5FE3A 3RCWA 1ZS5A 4MEOA 4YYGA 3P1FA 5E9IA 4O70A 5HQ6A 2G4AA 5CQ6A 5E0RA 4HBXA 3JVMA 2RO1A 4KCXA 5E9LA 4TYLA 5DYXA 5D0CA 4N4IA 5DFCA 4TT4A 5CY9A 4PS5A 5C4QA 3LQIA 5FFWA 4Z6HA 5I29A 2YDWA 4QEWA 3JVJA 4WHWA 5C7NA 5LKUA 5FE0A 3UVWA 2F6NA 4XUBA 4ALGA 5CUCA 3S92A 5J0DA 5HJCA 4YYIA 4NYXA 5DW1A 5CS8A 5EWVA 4MENA 5KTWA 5ENEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FFV A;  5F25 A;  4LDF A;  4XY9 A;  5TCM A;  4NXJ A;  5DKD A;  5C85 A;  3UVY A;  4NR6 A;  5D3J A;  4CUT A;  4IOR A;  5HRX A;  4NR5 A;  5ENI A;  5ETB A;  4ZQL A;  5FE2 A;  5HRW A;  5AD3 A;  5FH7 A;  3DWY A;  4TU6 A;  2RNX A;  4YBM A;  5HFR A;  2KTB B;  5E3D A;  4UYG A;  3U5N A;  5G4S A;  5DLX A;  3QZV A;  5C89 A;  5ETD A;  4UIX A;  5EU1 A;  5FE6 A;  5A5R A;  2RI7 A;  5H1V A;  5KTU A;  5LKX A;  5II1 A;  4A9H A;  4C67 A;  5DYU A;  5LJ0 A;  5CZG A;  5DKC A;  5LKT A;  4ZC9 A;  4ZW1 A;  5L8T A;  5L97 A;  4QB3 A;  4J1P A;  5KHM A;  4UYH A;  5CUG A;  2OO1 A;  2WP2 A;  3QZS A;  4X2I A;  3MB4 A;  5F63 A;  4QST A;  5CQ5 A;  4HXS A;  5ENJ A;  5FG5 A;  5COI A;  5ACY A;  3GG3 A;  5EPB A;  5HCL A;  3ONI A;  2YEK A;  5DLZ A;  4TU4 A;  5A5N A;  5CUE A;  5D26 A;  4QSP A;  4IOO A;  5LJ1 A;  4LZ2 A;  4HBW A;  4QSV A;  4O7F A;  5K29 A;  5EQ1 A;  5CRZ A;  4UIT A;  4MR4 A;  3IU5 A;  4A9L A;  5FH8 A;  5EP7 A;  5FFY A;  5I89 A;  3U5P A;  5CUD A;  5E73 A;  4CFL A;  5CQ8 A;  4O71 A;  5EM3 A;  3U5O A;  5LKZ A;  5D3L A;  3U5K A;  2RS9 B;  3O37 A;  2MJV B;  5JI8 A;  5IGL A;  4J0R A;  5ENC A;  5E74 A;  5I7X A;  5CPE A;  5D3S A;  2I8N A;  4YAB A;  4WHU A;  2OUO A;  4YYM A;  5D24 A;  5CRM A;  3Q2E A;  5D3R A;  3HME A;  4QSX A;  5TB6 A;  3UV4 A;  4ALH A;  3UW9 A;  2DVS A;  5FB0 A;  3LXJ A;  2R10 A;  4LYI A;  5E9K A;  3U5M A;  4QC1 A;  5LVQ A;  2RFJ A;  5I40 A;  5EK9 A;  5EV9 A;  2LSP B;  4NUE A;  5CU8 A;  4PCE A;  3MXF A;  4Z1Q A;  4XYA A;  4WIV A;  4A9E A;  4QY4 A;  4F3I A;  5DY7 A;  5FH6 A;  2L5E A;  5L96 A;  5FE4 A;  2FSA A;  2YYN A;  5CUB A;  3TLP A;  5E9Y A;  4BW3 A;  4QSR A;  4IOQ A;  5D3H A;  4QSS A;  1JM4 B;  4YC9 A;  5F5Z A;  5JWM A;  4YH3 A;  5HQ7 A;  4QSQ A;  5IBN A;  4OUF A;  5EWW A;  4LZS A;  4QC3 A;  1N72 A;  4A9J A;  4HBV A;  5ENF A;  3Q2F A;  4NRA A;  4NR7 A;  5EA1 A;  4QR4 A;  4CFK A;  4QSW A;  4Q0N A;  5CQ4 A;  4BW4 A;  5ENG A;  4MR6 A;  4NRB A;  3DAI A;  4N3W A;  5HEN A;  3P1E A;  4OGJ A;  4YYK A;  5KO4 A;  4YK0 A;  3FKM X;  5I80 A;  3LJW A;  2N9G A;  4O76 A;  5IGK A;  3U5L A;  2NXB A;  4QYL A;  5A85 A;  5H1T A;  4NQN A;  3G0L A;  4LR6 A;  4MEQ A;  4IR6 A;  4NS5 A;  4PKL A;  3U5J A;  5E9V A;  5DX4 A;  4DON A;  5CQT A;  5EI4 A;  3JVL A;  4LZR A;  2DVR A;  4O7E A;  5IGN A;  4O7A A;  5FE8 A;  3QZT A;  1F68 A;  5DYC A;  5F61 A;  4QR5 A;  3P5O A;  3SVH A;  2GRC A;  4IR5 A;  4A9F A;  5AMF A;  2YW5 A;  5F36 A;  4OGI A;  5F62 A;  4A9M A;  5EIS A;  5A5P A;  3SVF A;  4HXO A;  4PY6 A;  5BT3 A;  5D25 A;  4MEP A;  3HMH A;  4HXL A;  4LRG A;  5H85 A;  2D9E A;  5KTX A;  3UV2 A;  4J0S A;  5ENH A;  4XY8 A;  4UIZ A;  3LQH A;  5EWH A;  5L99 A;  4QEV A;  4NYW A;  1WUM A;  4CUU A;  4QSU A;  3ZYU A;  5FE1 A;  4CUQ A;  5CQ7 A;  5G4R A;  3O36 A;  4O7B A;  5EIC A;  3NXB A;  4O77 A;  3JVK A;  5AME A;  3UV5 A;  4PTB A;  4A9K A;  5FG6 A;  2H60 A;  4HXN A;  4YAX A;  5IG6 A;  2R0Y A;  4UIU A;  4TT2 A;  5FDZ A;  5D3N A;  4BW2 A;  4N4F A;  3S91 A;  4TT6 A;  4O7C A;  5F60 A;  4YY4 A;  4Y03 A;  4YYJ A;  3O35 A;  4Q0O A;  5CUA A;  5HRV A;  2R0V A;  3P1C A;  5LUU A;  2E7O A;  5II2 A;  1EQF A;  4CLB A;  1WUG A;  4KV4 A;  5AD2 A;  4NUC A;  4TZ8 A;  4CL9 A;  4O72 A;  4O74 A;  4YBS A;  1X0J A;  2E3K A;  4HXR A;  4QUU A;  4TZ2 A;  4MR5 A;  4MR3 A;  5HQ5 A;  4QZS A;  5CGP A;  5EWC A;  4O75 A;  4CUS A;  2WP1 A;  5EWD A;  5CTL A;  5I7Y A;  4BJX A;  3K2J A;  4LYS A;  3G0J A;  4YY6 A;  4UYE A;  2YEL A;  4YYN A;  4IR4 A;  5EPR A;  5HFQ A;  2YEM A;  5A83 A;  5BT4 A;  3P1D A;  4YH4 A;  5L98 A;  1JSP B;  4LYW A;  5FG4 A;  4YAD A;  5A82 A;  4RVR A;  5DFB A;  2DWW A;  4CUR A;  5H1U A;  2L84 A;  2OSS A;  4Z93 A;  4E96 A;  5F2P A;  5FE5 A;  5L8U A;  4QYD A;  2I7K A;  4NRC A;  2RNW A;  4A9O A;  4BW1 A;  5C87 A;  3MUL A;  2R0S A;  4HXK A;  5A5Q A;  4HBY A;  4NUD A;  5E9M A;  4HXM A;  3SVG A;  4YBT A;  5HLS A;  4UIV A;  5I88 A;  4XUA A;  5FE7 A;  5EPS A;  5I86 A;  4NR8 A;  5F3A A;  5HEL A;  5D3P A;  5EVA A;  5CQ3 A;  2L85 A;  4BHW A;  5LJ2 A;  4A9I A;  5A5O A;  4UYF A;  5E3G A;  3O33 A;  4YYH A;  5CQA A;  4PCI A;  4YAT A;  5DKH A;  4NQM A;  5IGM A;  1E6I A;  4QBM A;  4N4G A;  4KV1 A;  3LQJ A;  4TS8 A;  5ENB A;  4AKN A;  4YYD A;  4UYF B;  5F1L A;  2DVV A;  5A81 A;  4N4H A;  4C66 A;  4UIW A;  2YQD A;  3UVX A;  4GPJ A;  4CUP A;  5C8G A;  4A9N A;  3AAD A;  2D82 A;  3AQA A;  4Z6I A;  4QUT A;  5FE9 A;  5DBM A;  5IID A;  5CFW A;  4NYV A;  4Z1S A;  4TQN A;  5I83 A;  3D7C A;  4FLP A;  4QR3 A;  4HXP A;  3O34 A;  5I1Q A;  5FB1 A;  4UYD A;  5BT5 A;  5E7D A;  4LC2 A;  5FBX A;  4J3I A;  3IU6 A;  5D3T A;  2E7N A;  5HM0 A;  4QEU A;  5F1H A;  3UVD A;  5LVR A;  5KU3 A;  4TTE A;  5DFD A;  2RNY A;  2DKW A;  3I3J A;  4NR9 A;  5D7X A;  2F6J A;  4UIY A;  5DW2 A;  4QNS A;  5CP5 A;  5A7C A;  2DAT A;  3MB3 A;  5EGU A;  4IR3 A;  5A5S A;  5HEM A;  4O78 A;  3MUK A;  5DYA A;  3HMF A;  2DVQ A;  4NR4 A;  3MQM A;  5FE3 A;  3RCW A;  1ZS5 A;  4MEO A;  4YYG A;  3P1F A;  5E9I A;  4O70 A;  5HQ6 A;  2G4A A;  5CQ6 A;  5E0R A;  4HBX A;  3JVM A;  2RO1 A;  4KCX A;  5E9L A;  4TYL A;  5DYX A;  5D0C A;  4N4I A;  5DFC A;  4TT4 A;  5CY9 A;  4PS5 A;  5C4Q A;  3LQI A;  5FFW A;  4Z6H A;  5I29 A;  2YDW A;  4QEW A;  3JVJ A;  4WHW A;  5C7N A;  5LKU A;  5FE0 A;  3UVW A;  2F6N A;  4XUB A;  4ALG A;  5CUC A;  3S92 A;  5J0D A;  5HJC A;  4YYI A;  4NYX A;  5DW1 A;  5CS8 A;  5EWV A;  4MEN A;  5KTW A;  5ENE A; 
#chains in the Genus database with same CATH topology
 5FFV A;  5F25 A;  4LDF A;  4XY9 A;  5TCM A;  4NXJ A;  5DKD A;  5C85 A;  3UVY A;  4NR6 A;  5D3J A;  4CUT A;  4IOR A;  5HRX A;  4NR5 A;  5ENI A;  5ETB A;  4ZQL A;  5FE2 A;  5HRW A;  3VKG A;  5AD3 A;  5FH7 A;  3DWY A;  4TU6 A;  2RNX A;  4YBM A;  5HFR A;  2KTB B;  5E3D A;  4UYG A;  3U5N A;  5G4S A;  5DLX A;  3QZV A;  5C89 A;  1PUO A;  5ETD A;  4UIX A;  5EU1 A;  5FE6 A;  5A5R A;  2RI7 A;  5H1V A;  5KTU A;  5LKX A;  5II1 A;  4A9H A;  4C67 A;  5DYU A;  5LJ0 A;  5CZG A;  5DKC A;  5LKT A;  4ZC9 A;  4ZW1 A;  5L8T A;  5L97 A;  4QB3 A;  4J1P A;  5KHM A;  4UYH A;  5CUG A;  2OO1 A;  2WP2 A;  3D1D A;  3QZS A;  4X2I A;  3MB4 A;  5F63 A;  4QST A;  5CQ5 A;  4HXS A;  5ENJ A;  5FG5 A;  5COI A;  5ACY A;  3GG3 A;  5EPB A;  5HCL A;  3ONI A;  2YEK A;  5DLZ A;  4TU4 A;  5A5N A;  5CUE A;  5D26 A;  4QSP A;  4IOO A;  5LJ1 A;  4LZ2 A;  4HBW A;  4QSV A;  4O7F A;  5K29 A;  5EQ1 A;  5CRZ A;  4UIT A;  4MR4 A;  3IU5 A;  4A9L A;  4AKH A;  5FH8 A;  5EP7 A;  5FFY A;  4AKI A;  5I89 A;  3U5P A;  5CUD A;  5E73 A;  4CFL A;  5CQ8 A;  4O71 A;  5EM3 A;  3U5O A;  5LKZ A;  5D3L A;  3U5K A;  2RS9 B;  3O37 A;  2MJV B;  5JI8 A;  5IGL A;  4J0R A;  5ENC A;  5E74 A;  5I7X A;  5CPE A;  5D3S A;  2I8N A;  4YAB A;  4WHU A;  2OUO A;  4YYM A;  5D24 A;  5CRM A;  3Q2E A;  5D3R A;  3HME A;  4QSX A;  5TB6 A;  3UV4 A;  4ALH A;  3UW9 A;  2DVS A;  5FB0 A;  2EJN A;  3LXJ A;  2R10 A;  4LYI A;  5E9K A;  3U5M A;  4QC1 A;  5LVQ A;  2RFJ A;  5I40 A;  5EK9 A;  5EV9 A;  2LSP B;  4NUE A;  5CU8 A;  4PCE A;  3MXF A;  4Z1Q A;  4XYA A;  4WIV A;  4A9E A;  4QY4 A;  4F3I A;  5DY7 A;  5FH6 A;  2L5E A;  5L96 A;  5FE4 A;  2FSA A;  2YYN A;  5CUB A;  3TLP A;  5E9Y A;  4BW3 A;  4QSR A;  4IOQ A;  5D3H A;  3VKH A;  4QSS A;  1JM4 B;  4AKG A;  4YC9 A;  5F5Z A;  5JWM A;  4YH3 A;  5HQ7 A;  4QSQ A;  5IBN A;  4OUF A;  5EWW A;  4LZS A;  4QC3 A;  1N72 A;  1ZKR A;  4A9J A;  4HBV A;  5ENF A;  3Q2F A;  4NRA A;  4NR7 A;  5EA1 A;  4QR4 A;  4CFK A;  4QSW A;  4Q0N A;  5CQ4 A;  4BW4 A;  5ENG A;  4MR6 A;  4NRB A;  3DAI A;  4N3W A;  5HEN A;  3P1E A;  4OGJ A;  4YYK A;  5KO4 A;  4YK0 A;  3FKM X;  5I80 A;  3LJW A;  2N9G A;  4O76 A;  5IGK A;  3U5L A;  2NXB A;  4QYL A;  5A85 A;  5H1T A;  4NQN A;  3G0L A;  4LR6 A;  4MEQ A;  3ERR A;  4IR6 A;  4NS5 A;  4PKL A;  3U5J A;  5E9V A;  5DX4 A;  4DON A;  5CQT A;  5EI4 A;  3JVL A;  4LZR A;  2DVR A;  4O7E A;  5IGN A;  4O7A A;  5FE8 A;  3QZT A;  1F68 A;  5DYC A;  5F61 A;  4QR5 A;  3P5O A;  3SVH A;  2GRC A;  4IR5 A;  4A9F A;  5AMF A;  2YW5 A;  5F36 A;  4OGI A;  5F62 A;  4A9M A;  5EIS A;  5A5P A;  3SVF A;  4HXO A;  4PY6 A;  5BT3 A;  5D25 A;  4MEP A;  3HMH A;  4HXL A;  4LRG A;  5H85 A;  2D9E A;  5KTX A;  3UV2 A;  4J0S A;  5ENH A;  4XY8 A;  4UIZ A;  3LQH A;  5EWH A;  5L99 A;  4QEV A;  4NYW A;  1WUM A;  4CUU A;  4QSU A;  3ZYU A;  5FE1 A;  4CUQ A;  5CQ7 A;  5G4R A;  3O36 A;  4O7B A;  5EIC A;  3NXB A;  4O77 A;  3JVK A;  5AME A;  3UV5 A;  4PTB A;  4A9K A;  5FG6 A;  2H60 A;  4HXN A;  4YAX A;  5IG6 A;  2R0Y A;  4UIU A;  4TT2 A;  5FDZ A;  5D3N A;  4BW2 A;  4N4F A;  3S91 A;  4TT6 A;  4O7C A;  5F60 A;  4YY4 A;  4Y03 A;  4YYJ A;  3O35 A;  4Q0O A;  5CUA A;  5HRV A;  2R0V A;  3P1C A;  5LUU A;  2E7O A;  5II2 A;  1EQF A;  4CLB A;  1WUG A;  4KV4 A;  5AD2 A;  4NUC A;  4TZ8 A;  4CL9 A;  4O72 A;  4O74 A;  4YBS A;  1X0J A;  2E3K A;  4HXR A;  4QUU A;  4TZ2 A;  4MR5 A;  4MR3 A;  5HQ5 A;  4QZS A;  5CGP A;  5EWC A;  4O75 A;  4CUS A;  2WP1 A;  5EWD A;  5CTL A;  5I7Y A;  4BJX A;  3K2J A;  4LYS A;  4AI6 A;  3G0J A;  4YY6 A;  4UYE A;  2YEL A;  4YYN A;  3D1B A;  4IR4 A;  5EPR A;  5HFQ A;  2YEM A;  5A83 A;  5BT4 A;  3P1D A;  4YH4 A;  5L98 A;  1JSP B;  4LYW A;  5FG4 A;  4YAD A;  5A82 A;  4RVR A;  5DFB A;  2DWW A;  4CUR A;  5H1U A;  2L84 A;  2OSS A;  4Z93 A;  4E96 A;  5F2P A;  5FE5 A;  5L8U A;  4QYD A;  2I7K A;  4NRC A;  2RNW A;  4A9O A;  4BW1 A;  5C87 A;  3MUL A;  2R0S A;  4HXK A;  5A5Q A;  4HBY A;  4NUD A;  5E9M A;  4HXM A;  3SVG A;  4YBT A;  5HLS A;  4UIV A;  5I88 A;  4XUA A;  5FE7 A;  5EPS A;  5I86 A;  4NR8 A;  5F3A A;  5HEL A;  5D3P A;  5EVA A;  5CQ3 A;  2L85 A;  4BHW A;  5LJ2 A;  4A9I A;  5A5O A;  4UYF A;  5E3G A;  3O33 A;  4YYH A;  5CQA A;  4PCI A;  4YAT A;  5DKH A;  4NQM A;  5IGM A;  1E6I A;  4QBM A;  4N4G A;  4KV1 A;  3LQJ A;  4TS8 A;  5ENB A;  4AKN A;  4YYD A;  4UYF B;  5F1L A;  2DVV A;  5A81 A;  4N4H A;  4C66 A;  4UIW A;  2YQD A;  3UVX A;  4GPJ A;  4CUP A;  5C8G A;  4A9N A;  3AAD A;  2D82 A;  3AQA A;  4Z6I A;  4QUT A;  5FE9 A;  5DBM A;  5IID A;  5CFW A;  4NYV A;  4Z1S A;  4TQN A;  5I83 A;  3D7C A;  4FLP A;  4QR3 A;  4HXP A;  3O34 A;  5I1Q A;  5FB1 A;  4UYD A;  5BT5 A;  5E7D A;  4LC2 A;  5FBX A;  4J3I A;  3IU6 A;  5D3T A;  2E7N A;  5HM0 A;  4QEU A;  5F1H A;  3UVD A;  5LVR A;  5KU3 A;  4TTE A;  5DFD A;  2RNY A;  2DKW A;  3I3J A;  4NR9 A;  5D7X A;  2F6J A;  4UIY A;  5DW2 A;  4QNS A;  5CP5 A;  5A7C A;  2DAT A;  3MB3 A;  5EGU A;  4IR3 A;  5A5S A;  5HEM A;  4O78 A;  3MUK A;  5DYA A;  3HMF A;  2DVQ A;  4NR4 A;  3MQM A;  5FE3 A;  3RCW A;  1ZS5 A;  4MEO A;  4YYG A;  3P1F A;  5E9I A;  4O70 A;  5HQ6 A;  2G4A A;  5CQ6 A;  5E0R A;  4HBX A;  3JVM A;  2RO1 A;  4KCX A;  5E9L A;  4TYL A;  5DYX A;  5D0C A;  4N4I A;  5DFC A;  4TT4 A;  5CY9 A;  4PS5 A;  5C4Q A;  3LQI A;  5FFW A;  4Z6H A;  5I29 A;  2YDW A;  4QEW A;  3JVJ A;  4WHW A;  5C7N A;  5LKU A;  5FE0 A;  3UVW A;  2F6N A;  4XUB A;  4ALG A;  5CUC A;  3S92 A;  5J0D A;  5HJC A;  4YYI A;  4NYX A;  5DW1 A;  5CS8 A;  5EWV A;  4MEN A;  5KTW A;  5ENE A; 
#chains in the Genus database with same CATH homology
 5FFV A;  5F25 A;  4LDF A;  4XY9 A;  5TCM A;  4NXJ A;  5DKD A;  5C85 A;  3UVY A;  4NR6 A;  5D3J A;  4CUT A;  4IOR A;  5HRX A;  4NR5 A;  5ENI A;  5ETB A;  4ZQL A;  5FE2 A;  5HRW A;  5AD3 A;  5FH7 A;  3DWY A;  4TU6 A;  2RNX A;  4YBM A;  5HFR A;  2KTB B;  5E3D A;  4UYG A;  3U5N A;  5G4S A;  5DLX A;  3QZV A;  5C89 A;  5ETD A;  4UIX A;  5EU1 A;  5FE6 A;  5A5R A;  2RI7 A;  5H1V A;  5KTU A;  5LKX A;  5II1 A;  4A9H A;  4C67 A;  5DYU A;  5LJ0 A;  5CZG A;  5DKC A;  5LKT A;  4ZC9 A;  4ZW1 A;  5L8T A;  5L97 A;  4QB3 A;  4J1P A;  5KHM A;  4UYH A;  5CUG A;  2OO1 A;  2WP2 A;  3QZS A;  4X2I A;  3MB4 A;  5F63 A;  4QST A;  5CQ5 A;  4HXS A;  5ENJ A;  5FG5 A;  5COI A;  5ACY A;  3GG3 A;  5EPB A;  5HCL A;  3ONI A;  2YEK A;  5DLZ A;  4TU4 A;  5A5N A;  5CUE A;  5D26 A;  4QSP A;  4IOO A;  5LJ1 A;  4LZ2 A;  4HBW A;  4QSV A;  4O7F A;  5K29 A;  5EQ1 A;  5CRZ A;  4UIT A;  4MR4 A;  3IU5 A;  4A9L A;  5FH8 A;  5EP7 A;  5FFY A;  5I89 A;  3U5P A;  5CUD A;  5E73 A;  4CFL A;  5CQ8 A;  4O71 A;  5EM3 A;  3U5O A;  5LKZ A;  5D3L A;  3U5K A;  2RS9 B;  3O37 A;  2MJV B;  5JI8 A;  5IGL A;  4J0R A;  5ENC A;  5E74 A;  5I7X A;  5CPE A;  5D3S A;  2I8N A;  4YAB A;  4WHU A;  2OUO A;  4YYM A;  5D24 A;  5CRM A;  3Q2E A;  5D3R A;  3HME A;  4QSX A;  5TB6 A;  3UV4 A;  4ALH A;  3UW9 A;  2DVS A;  5FB0 A;  3LXJ A;  2R10 A;  4LYI A;  5E9K A;  3U5M A;  4QC1 A;  5LVQ A;  2RFJ A;  5I40 A;  5EK9 A;  5EV9 A;  2LSP B;  4NUE A;  5CU8 A;  4PCE A;  3MXF A;  4Z1Q A;  4XYA A;  4WIV A;  4A9E A;  4QY4 A;  4F3I A;  5DY7 A;  5FH6 A;  2L5E A;  5L96 A;  5FE4 A;  2FSA A;  2YYN A;  5CUB A;  3TLP A;  5E9Y A;  4BW3 A;  4QSR A;  4IOQ A;  5D3H A;  4QSS A;  1JM4 B;  4YC9 A;  5F5Z A;  5JWM A;  4YH3 A;  5HQ7 A;  4QSQ A;  5IBN A;  4OUF A;  5EWW A;  4LZS A;  4QC3 A;  1N72 A;  4A9J A;  4HBV A;  5ENF A;  3Q2F A;  4NRA A;  4NR7 A;  5EA1 A;  4QR4 A;  4CFK A;  4QSW A;  4Q0N A;  5CQ4 A;  4BW4 A;  5ENG A;  4MR6 A;  4NRB A;  3DAI A;  4N3W A;  5HEN A;  3P1E A;  4OGJ A;  4YYK A;  5KO4 A;  4YK0 A;  3FKM X;  5I80 A;  3LJW A;  2N9G A;  4O76 A;  5IGK A;  3U5L A;  2NXB A;  4QYL A;  5A85 A;  5H1T A;  4NQN A;  3G0L A;  4LR6 A;  4MEQ A;  4IR6 A;  4NS5 A;  4PKL A;  3U5J A;  5E9V A;  5DX4 A;  4DON A;  5CQT A;  5EI4 A;  3JVL A;  4LZR A;  2DVR A;  4O7E A;  5IGN A;  4O7A A;  5FE8 A;  3QZT A;  1F68 A;  5DYC A;  5F61 A;  4QR5 A;  3P5O A;  3SVH A;  2GRC A;  4IR5 A;  4A9F A;  5AMF A;  2YW5 A;  5F36 A;  4OGI A;  5F62 A;  4A9M A;  5EIS A;  5A5P A;  3SVF A;  4HXO A;  4PY6 A;  5BT3 A;  5D25 A;  4MEP A;  3HMH A;  4HXL A;  4LRG A;  5H85 A;  2D9E A;  5KTX A;  3UV2 A;  4J0S A;  5ENH A;  4XY8 A;  4UIZ A;  3LQH A;  5EWH A;  5L99 A;  4QEV A;  4NYW A;  1WUM A;  4CUU A;  4QSU A;  3ZYU A;  5FE1 A;  4CUQ A;  5CQ7 A;  5G4R A;  3O36 A;  4O7B A;  5EIC A;  3NXB A;  4O77 A;  3JVK A;  5AME A;  3UV5 A;  4PTB A;  4A9K A;  5FG6 A;  2H60 A;  4HXN A;  4YAX A;  5IG6 A;  2R0Y A;  4UIU A;  4TT2 A;  5FDZ A;  5D3N A;  4BW2 A;  4N4F A;  3S91 A;  4TT6 A;  4O7C A;  5F60 A;  4YY4 A;  4Y03 A;  4YYJ A;  3O35 A;  4Q0O A;  5CUA A;  5HRV A;  2R0V A;  3P1C A;  5LUU A;  2E7O A;  5II2 A;  1EQF A;  4CLB A;  1WUG A;  4KV4 A;  5AD2 A;  4NUC A;  4TZ8 A;  4CL9 A;  4O72 A;  4O74 A;  4YBS A;  1X0J A;  2E3K A;  4HXR A;  4QUU A;  4TZ2 A;  4MR5 A;  4MR3 A;  5HQ5 A;  4QZS A;  5CGP A;  5EWC A;  4O75 A;  4CUS A;  2WP1 A;  5EWD A;  5CTL A;  5I7Y A;  4BJX A;  3K2J A;  4LYS A;  3G0J A;  4YY6 A;  4UYE A;  2YEL A;  4YYN A;  4IR4 A;  5EPR A;  5HFQ A;  2YEM A;  5A83 A;  5BT4 A;  3P1D A;  4YH4 A;  5L98 A;  1JSP B;  4LYW A;  5FG4 A;  4YAD A;  5A82 A;  4RVR A;  5DFB A;  2DWW A;  4CUR A;  5H1U A;  2L84 A;  2OSS A;  4Z93 A;  4E96 A;  5F2P A;  5FE5 A;  5L8U A;  4QYD A;  2I7K A;  4NRC A;  2RNW A;  4A9O A;  4BW1 A;  5C87 A;  3MUL A;  2R0S A;  4HXK A;  5A5Q A;  4HBY A;  4NUD A;  5E9M A;  4HXM A;  3SVG A;  4YBT A;  5HLS A;  4UIV A;  5I88 A;  4XUA A;  5FE7 A;  5EPS A;  5I86 A;  4NR8 A;  5F3A A;  5HEL A;  5D3P A;  5EVA A;  5CQ3 A;  2L85 A;  4BHW A;  5LJ2 A;  4A9I A;  5A5O A;  4UYF A;  5E3G A;  3O33 A;  4YYH A;  5CQA A;  4PCI A;  4YAT A;  5DKH A;  4NQM A;  5IGM A;  1E6I A;  4QBM A;  4N4G A;  4KV1 A;  3LQJ A;  4TS8 A;  5ENB A;  4AKN A;  4YYD A;  4UYF B;  5F1L A;  2DVV A;  5A81 A;  4N4H A;  4C66 A;  4UIW A;  2YQD A;  3UVX A;  4GPJ A;  4CUP A;  5C8G A;  4A9N A;  3AAD A;  2D82 A;  3AQA A;  4Z6I A;  4QUT A;  5FE9 A;  5DBM A;  5IID A;  5CFW A;  4NYV A;  4Z1S A;  4TQN A;  5I83 A;  3D7C A;  4FLP A;  4QR3 A;  4HXP A;  3O34 A;  5I1Q A;  5FB1 A;  4UYD A;  5BT5 A;  5E7D A;  4LC2 A;  5FBX A;  4J3I A;  3IU6 A;  5D3T A;  2E7N A;  5HM0 A;  4QEU A;  5F1H A;  3UVD A;  5LVR A;  5KU3 A;  4TTE A;  5DFD A;  2RNY A;  2DKW A;  3I3J A;  4NR9 A;  5D7X A;  2F6J A;  4UIY A;  5DW2 A;  4QNS A;  5CP5 A;  5A7C A;  2DAT A;  3MB3 A;  5EGU A;  4IR3 A;  5A5S A;  5HEM A;  4O78 A;  3MUK A;  5DYA A;  3HMF A;  2DVQ A;  4NR4 A;  3MQM A;  5FE3 A;  3RCW A;  1ZS5 A;  4MEO A;  4YYG A;  3P1F A;  5E9I A;  4O70 A;  5HQ6 A;  2G4A A;  5CQ6 A;  5E0R A;  4HBX A;  3JVM A;  2RO1 A;  4KCX A;  5E9L A;  4TYL A;  5DYX A;  5D0C A;  4N4I A;  5DFC A;  4TT4 A;  5CY9 A;  4PS5 A;  5C4Q A;  3LQI A;  5FFW A;  4Z6H A;  5I29 A;  2YDW A;  4QEW A;  3JVJ A;  4WHW A;  5C7N A;  5LKU A;  5FE0 A;  3UVW A;  2F6N A;  4XUB A;  4ALG A;  5CUC A;  3S92 A;  5J0D A;  5HJC A;  4YYI A;  4NYX A;  5DW1 A;  5CS8 A;  5EWV A;  4MEN A;  5KTW A;  5ENE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...