4Z6IA

Crystal structure of brd9 bromodomain in complex with a substituted valerolactam quinolone ligand
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 9
publication title LP99: Discovery and Synthesis of the First Selective BRD7/9 Bromodomain Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 44
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4z6iA00
4QUTA 4BW2A 5DYCA 3DWYA 4KV4A 5DFDA 5DYXA 4QB3A 4YAXA 3G0JA 4O7FA 4YY6A 3MXFA 4TU4A 3QZVA 4A9OA 5LKXA 2I8NA 4XY8A 3U5PA 5I88A 4QSXA 2G4AA 3UV4A 4XY9A 4KV1A 5LJ0A 4QSQA 5HEMA 5COIA 4O7BA 4J1PA 4XUBA 5IIDA 2D9EA 4A9FA 4YADA 4O76A 5CP5A 4ALHA 4CUQA 2YDWA 4A9EA 5FFVA 5J0DA 4Q0NA 3Q2FA 5EPBA 5C87A 3U5OA 5KTWA 2DVQA 4QR5A 2D82A 4O72A 4CFKA 5EWWA 4CUSA 5CUCA 5EWDA 5F1LA 4A9JA 4O77A 4N4IA 4UYEA 5I29A 4BW1A 5F3AA 5A5OA 5DKHA 2LSPB 5CY9A 4NYWA 4UYDA 3UVXA 4XYAA 5FE7A 4HXNA 5E9VA 5EV9A 5L96A 4NR4A 3O34A 5C7NA 4TT2A 4NUDA 4YYJA 4XUAA 5CRMA 3O36A 5FFYA 4UYFB 5ENFA 4HBWA 5ENJA 4NR8A 5KTUA 4CUTA 5EM3A 5DKCA 4QZSA 5DBMA 4QR3A 5E3GA 5E9MA 4YK0A 3MB4A 5L8UA 5BT3A 5LVRA 4PCIA 4Q0OA 4WHUA 5DYUA 4O7EA 4CUUA 3QZTA 5HQ7A 5ENHA 4ZW1A 3IU5A 5ACYA 3AQAA 3TLPA 5E3DA 3ZYUA 5A83A 5CQ5A 3NXBA 2I7KA 3S92A 2YEKA 5F1HA 4TYLA 5EI4A 4TT6A 1JM4B 5I7YA 2OO1A 2KTBB 5ETBA 5CQ4A 4TT4A 5FE9A 4YBTA 2N9GA 4ZC9A 5FB1A 5A5NA 4QSRA 2F6JA 4NS5A 5DLXA 5E0RA 4IOOA 4UITA 5KO4A 4MEPA 2RFJA 4YYKA 5FG6A 5I83A 3U5JA 5CGPA 2RS9B 5CQ3A 3P5OA 5A5RA 4NUCA 5FE2A 2YW5A 5I40A 5CU8A 5DLZA 5AD2A 5FH8A 4QSWA 2DATA 3MULA 1E6IA 4OUFA 4HXMA 5A7CA 3SVFA 2YYNA 4NUEA 3K2JA 5L99A 4MR6A 4NQNA 4YH4A 5F61A 5ENCA 4AKNA 2RNXA 5D3PA 5A5QA 5C8GA 4BW4A 4IORA 5E74A 3U5KA 5F36A 4QNSA 4OGJA 5EICA 3JVLA 4NXJA 2DVVA 1JSPB 4UYFA 4QYDA 3RCWA 3P1CA 4YABA 4GPJA 4LZSA 4TU6A 4TQNA 5D3SA 5HM0A 5D3LA 4QY4A 5TB6A 5HRWA 5DYAA 3LQJA 5EVAA 5CQAA 4TZ2A 3DAIA 4YYHA 3UVDA 5HFRA 5CUBA 3GG3A 5ETDA 4O71A 4YC9A 5CUEA 4BJXA 5G4RA 4Z6HA 4QEWA 5EPRA 4BHWA 4YYMA 5DFCA 4J3IA 3IU6A 4NR5A 2R0YA 5F62A 3FKMX 2E7NA 4O7AA 5F25A 3ONIA 3UV2A 4O75A 3JVKA 4IOQA 5EPSA 4CUPA 5A82A 5C85A 5IGKA 3LJWA 5DFBA 5CUDA 2DVSA 4HXRA 4UIVA 3O33A 4UYGA 5H1UA 5EQ1A 5K29A 5LJ2A 2GRCA 4QEVA 2H60A 1EQFA 5FFWA 3HMHA 4MR4A 5HRVA 2F6NA 4LC2A 3D7CA 3MB3A 2YELA 4LYWA 5DW2A 5LKZA 4QUUA 5F63A 4QSPA 2L5EA 5F60A 5D26A 5JWMA 5LKTA 4Z1SA 2L85A 5JI8A 3P1EA 5H1TA 4A9LA 5LJ1A 5CS8A 4UYHA 4YBMA 4IR3A 5AMEA 5BT5A 4LRGA 4LDFA 4LZ2A 4NRAA 5CQ6A 1ZS5A 5D3RA 3UVWA 5HLSA 4IR4A 4F3IA 5IGNA 5I86A 5I7XA 3G0LA 5DKDA 5FG4A 4MR5A 3LQIA 3MUKA 4CL9A 1F68A 4NR6A 3Q2EA 5BT4A 5CRZA 4O70A 2RNYA 4IR5A 4TTEA 5ENBA 5HCLA 4PS5A 5HRXA 5LKUA 3SVGA 4HBVA 4UIWA 5D3TA 3P1FA 4YYNA 4MENA 2R0VA 4Z6IA 4HXLA 5HELA 4PTBA 2WP2A 4A9IA 4QBMA 5ENEA 4YBSA 5FE6A 5A81A 4PKLA 5AMFA 5L98A 5C89A 2RI7A 4NRCA 4LYIA 4LYSA 4HXKA 5H85A 4A9KA 4MR3A 4LZRA 4QC1A 5FE3A 5FH6A 2NXBA 5LVQA 3QZSA 4YY4A 2E3KA 4UIYA 4N4GA 3JVJA 5FB0A 4MEQA 2FSAA 3I3JA 5EA1A 5KHMA 4NQMA 5D7XA 4C67A 5E9LA 2DKWA 4WIVA 2RNWA 5EWVA 4CLBA 5D25A 4NR7A 5A5PA 5H1VA 5G4SA 4RVRA 5EISA 4FLPA 3U5NA 3U5MA 2DVRA 2MJVB 3U5LA 5EK9A 5I80A 1N72A 2OUOA 5DW1A 4QR4A 4DONA 3UVYA 4QSVA 4J0RA 5E9IA 3HMEA 4NYXA 5L8TA 4QSTA 4N4HA 3UW9A 4HBXA 4ALGA 4NYVA 4Z1QA 5EU1A 4O74A 4YYDA 4Y03A 4E96A 5EGUA 4HXOA 5E73A 4HXPA 4YH3A 5CQTA 4N4FA 5CQ8A 5D24A 5F5ZA 5A5SA 2E7OA 5CPEA 3SVHA 5CUGA 5D0CA 5DX4A 4N3WA 4QYLA 5F2PA 3HMFA 5FBXA 4Z93A 2WP1A 4OGIA 5D3HA 5IBNA 5FE0A 4A9MA 5FE8A 4YATA 5IG6A 5FG5A 5II2A 5IGMA 3P1DA 5EWCA 3O37A 5CUAA 2R10A 5CZGA 4BW3A 5HENA 5TCMA 3LQHA 5CTLA 4UIUA 3AADA 5FH7A 4O78A 5E7DA 5ENIA 5FE5A 1WUGA 4A9NA 5EWHA 4UIZA 1WUMA 4C66A 5C4QA 4X2IA 4MEOA 5HFQA 5ENGA 4TS8A 4CURA 4HXSA 5I1QA 4QC3A 5KTXA 5IGLA 1X0JA 4TZ8A 4J0SA 5CQ7A 3LXJA 5FE4A 4CFLA 5CFWA 5FDZA 3O35A 4LR6A 5DY7A 5L97A 4A9HA 5A85A 5D3JA 4PCEA 4ZQLA 5D3NA 5HQ5A 4HBYA 4IR6A 3JVMA 4NRBA 4QSUA 5E9KA 2RO1A 3S91A 4YYIA 5EP7A 4YYGA 5E9YA 2YEMA 2DWWA 2YQDA 5HJCA 5II1A 3UV5A 5I89A 5HQ6A 4QEUA 4WHWA 2OSSA 3MQMA 4QSSA 2L84A 4NR9A 4O7CA 4PY6A 5AD3A 4KCXA 5FE1A 5KU3A 5LUUA 4UIXA 2R0SA
chains in the Genus database with same CATH superfamily
4QUTA 4BW2A 5DYCA 3DWYA 4KV4A 5DFDA 5DYXA 4QB3A 4YAXA 3G0JA 4O7FA 4YY6A 3MXFA 4TU4A 3QZVA 4A9OA 5LKXA 2I8NA 4XY8A 3U5PA 5I88A 4QSXA 2G4AA 3UV4A 4XY9A 4KV1A 5LJ0A 4QSQA 5HEMA 5COIA 4O7BA 4J1PA 4XUBA 5IIDA 2D9EA 4A9FA 4YADA 4O76A 5CP5A 4ALHA 4CUQA 2YDWA 4A9EA 5FFVA 5J0DA 4Q0NA 3Q2FA 5EPBA 5C87A 3U5OA 5KTWA 2DVQA 4QR5A 2D82A 4O72A 4CFKA 5EWWA 4CUSA 5CUCA 5EWDA 1ZKRA 5F1LA 4A9JA 4O77A 4N4IA 4UYEA 5I29A 4BW1A 5F3AA 5A5OA 3VKGA 5DKHA 2LSPB 5CY9A 4NYWA 4UYDA 3UVXA 4XYAA 5FE7A 4HXNA 5E9VA 5EV9A 5L96A 4NR4A 3O34A 5C7NA 4TT2A 4NUDA 4YYJA 4XUAA 5CRMA 3O36A 5FFYA 4UYFB 5ENFA 4HBWA 5ENJA 4NR8A 5KTUA 4CUTA 5EM3A 5DKCA 4QZSA 5DBMA 4QR3A 5E3GA 5E9MA 4YK0A 3MB4A 5L8UA 5BT3A 5LVRA 4PCIA 4Q0OA 4WHUA 5DYUA 4O7EA 4CUUA 3QZTA 3D1BA 5HQ7A 5ENHA 4ZW1A 3IU5A 5ACYA 3AQAA 3TLPA 5E3DA 3ZYUA 5A83A 5CQ5A 3NXBA 2I7KA 3S92A 2YEKA 5F1HA 4TYLA 5EI4A 4TT6A 1JM4B 5I7YA 2OO1A 2KTBB 5ETBA 5CQ4A 4TT4A 5FE9A 4YBTA 2N9GA 4ZC9A 5FB1A 5A5NA 4QSRA 2F6JA 4NS5A 5DLXA 3D1DA 5E0RA 4IOOA 4UITA 5KO4A 4MEPA 2RFJA 4YYKA 5FG6A 5I83A 3U5JA 5CGPA 2RS9B 5CQ3A 3P5OA 5A5RA 4NUCA 5FE2A 2YW5A 5I40A 5CU8A 5DLZA 5AD2A 5FH8A 4QSWA 2DATA 3MULA 1E6IA 4OUFA 4HXMA 5A7CA 3SVFA 2YYNA 4NUEA 3K2JA 5L99A 4MR6A 4NQNA 4YH4A 5F61A 5ENCA 4AKNA 2RNXA 5D3PA 5A5QA 5C8GA 4BW4A 4IORA 5E74A 3U5KA 5F36A 4QNSA 4OGJA 5EICA 3JVLA 4NXJA 2DVVA 1JSPB 4UYFA 4QYDA 3RCWA 3P1CA 4YABA 4GPJA 4LZSA 4TU6A 4TQNA 5D3SA 5HM0A 5D3LA 4QY4A 5TB6A 5HRWA 5DYAA 3LQJA 5EVAA 5CQAA 4TZ2A 3DAIA 4YYHA 3UVDA 5HFRA 5CUBA 3GG3A 5ETDA 4O71A 4YC9A 5CUEA 4BJXA 5G4RA 4Z6HA 4QEWA 3ERRA 5EPRA 4BHWA 4YYMA 5DFCA 4J3IA 3IU6A 4NR5A 2R0YA 5F62A 3FKMX 2E7NA 4O7AA 5F25A 3ONIA 3UV2A 4O75A 3JVKA 4IOQA 5EPSA 4CUPA 5A82A 5C85A 3VKHA 5IGKA 3LJWA 5DFBA 5CUDA 2DVSA 4HXRA 4UIVA 3O33A 4UYGA 5H1UA 5EQ1A 2EJNA 5K29A 5LJ2A 2GRCA 4QEVA 2H60A 1EQFA 5FFWA 3HMHA 4MR4A 5HRVA 2F6NA 4LC2A 3D7CA 3MB3A 2YELA 4LYWA 5DW2A 5LKZA 4QUUA 5F63A 4QSPA 2L5EA 5F60A 5D26A 5JWMA 5LKTA 4Z1SA 2L85A 5JI8A 3P1EA 5H1TA 4A9LA 5LJ1A 5CS8A 4UYHA 4YBMA 4IR3A 5AMEA 5BT5A 4LRGA 4LDFA 4LZ2A 4NRAA 5CQ6A 1ZS5A 5D3RA 3UVWA 5HLSA 4IR4A 4F3IA 5IGNA 5I86A 4AKHA 5I7XA 3G0LA 5DKDA 5FG4A 4MR5A 3LQIA 3MUKA 4CL9A 1F68A 4NR6A 3Q2EA 5BT4A 5CRZA 4O70A 2RNYA 4IR5A 4TTEA 5ENBA 5HCLA 4PS5A 5HRXA 5LKUA 3SVGA 4HBVA 4UIWA 5D3TA 3P1FA 4YYNA 4MENA 2R0VA 4Z6IA 4HXLA 1PUOA 5HELA 4PTBA 2WP2A 4A9IA 4QBMA 5ENEA 4YBSA 5FE6A 5A81A 4PKLA 5AMFA 5L98A 5C89A 2RI7A 4NRCA 4LYIA 4LYSA 4HXKA 5H85A 4A9KA 4MR3A 4LZRA 4QC1A 5FE3A 5FH6A 2NXBA 5LVQA 3QZSA 4YY4A 2E3KA 4UIYA 4N4GA 3JVJA 4AKIA 5FB0A 4MEQA 2FSAA 3I3JA 5EA1A 5KHMA 4NQMA 5D7XA 4C67A 5E9LA 2DKWA 4WIVA 2RNWA 5EWVA 4CLBA 5D25A 4NR7A 5A5PA 5H1VA 5G4SA 4RVRA 5EISA 4FLPA 3U5NA 3U5MA 2DVRA 2MJVB 3U5LA 5EK9A 5I80A 1N72A 2OUOA 5DW1A 4QR4A 4DONA 3UVYA 4QSVA 4J0RA 5E9IA 3HMEA 4NYXA 5L8TA 4QSTA 4AI6A 4N4HA 3UW9A 4HBXA 4ALGA 4NYVA 4Z1QA 5EU1A 4O74A 4YYDA 4Y03A 4E96A 5EGUA 4HXOA 5E73A 4HXPA 4YH3A 5CQTA 4N4FA 5CQ8A 5D24A 5F5ZA 5A5SA 2E7OA 5CPEA 3SVHA 5CUGA 5D0CA 5DX4A 4N3WA 4QYLA 5F2PA 3HMFA 5FBXA 4Z93A 2WP1A 4OGIA 5D3HA 5IBNA 4AKGA 5FE0A 4A9MA 5FE8A 4YATA 5IG6A 5FG5A 5II2A 5IGMA 3P1DA 5EWCA 3O37A 5CUAA 2R10A 5CZGA 4BW3A 5HENA 5TCMA 3LQHA 5CTLA 4UIUA 3AADA 5FH7A 4O78A 5E7DA 5ENIA 5FE5A 1WUGA 4A9NA 5EWHA 4UIZA 1WUMA 4C66A 5C4QA 4X2IA 4MEOA 5HFQA 5ENGA 4TS8A 4CURA 4HXSA 5I1QA 4QC3A 5KTXA 5IGLA 1X0JA 4TZ8A 4J0SA 5CQ7A 3LXJA 5FE4A 4CFLA 5CFWA 5FDZA 3O35A 4LR6A 5DY7A 5L97A 4A9HA 5A85A 5D3JA 4PCEA 4ZQLA 5D3NA 5HQ5A 4HBYA 4IR6A 3JVMA 4NRBA 4QSUA 5E9KA 2RO1A 3S91A 4YYIA 5EP7A 4YYGA 5E9YA 2YEMA 2DWWA 2YQDA 5HJCA 5II1A 3UV5A 5I89A 5HQ6A 4QEUA 4WHWA 2OSSA 3MQMA 4QSSA 2L84A 4NR9A 4O7CA 4PY6A 5AD3A 4KCXA 5FE1A 5KU3A 5LUUA 4UIXA 2R0SA
chains in the Genus database with same CATH topology
4QUTA 4BW2A 5DYCA 3DWYA 4KV4A 5DFDA 5DYXA 4QB3A 4YAXA 3G0JA 4O7FA 4YY6A 3MXFA 4TU4A 3QZVA 4A9OA 5LKXA 2I8NA 4XY8A 3U5PA 5I88A 4QSXA 2G4AA 3UV4A 4XY9A 4KV1A 5LJ0A 4QSQA 5HEMA 5COIA 4O7BA 4J1PA 4XUBA 5IIDA 2D9EA 4A9FA 4YADA 4O76A 5CP5A 4ALHA 4CUQA 2YDWA 4A9EA 5FFVA 5J0DA 4Q0NA 3Q2FA 5EPBA 5C87A 3U5OA 5KTWA 2DVQA 4QR5A 2D82A 4O72A 4CFKA 5EWWA 4CUSA 5CUCA 5EWDA 5F1LA 4A9JA 4O77A 4N4IA 4UYEA 5I29A 4BW1A 5F3AA 5A5OA 5DKHA 2LSPB 5CY9A 4NYWA 4UYDA 3UVXA 4XYAA 5FE7A 4HXNA 5E9VA 5EV9A 5L96A 4NR4A 3O34A 5C7NA 4TT2A 4NUDA 4YYJA 4XUAA 5CRMA 3O36A 5FFYA 4UYFB 5ENFA 4HBWA 5ENJA 4NR8A 5KTUA 4CUTA 5EM3A 5DKCA 4QZSA 5DBMA 4QR3A 5E3GA 5E9MA 4YK0A 3MB4A 5L8UA 5BT3A 5LVRA 4PCIA 4Q0OA 4WHUA 5DYUA 4O7EA 4CUUA 3QZTA 5HQ7A 5ENHA 4ZW1A 3IU5A 5ACYA 3AQAA 3TLPA 5E3DA 3ZYUA 5A83A 5CQ5A 3NXBA 2I7KA 3S92A 2YEKA 5F1HA 4TYLA 5EI4A 4TT6A 1JM4B 5I7YA 2OO1A 2KTBB 5ETBA 5CQ4A 4TT4A 5FE9A 4YBTA 2N9GA 4ZC9A 5FB1A 5A5NA 4QSRA 2F6JA 4NS5A 5DLXA 5E0RA 4IOOA 4UITA 5KO4A 4MEPA 2RFJA 4YYKA 5FG6A 5I83A 3U5JA 5CGPA 2RS9B 5CQ3A 3P5OA 5A5RA 4NUCA 5FE2A 2YW5A 5I40A 5CU8A 5DLZA 5AD2A 5FH8A 4QSWA 2DATA 3MULA 1E6IA 4OUFA 4HXMA 5A7CA 3SVFA 2YYNA 4NUEA 3K2JA 5L99A 4MR6A 4NQNA 4YH4A 5F61A 5ENCA 4AKNA 2RNXA 5D3PA 5A5QA 5C8GA 4BW4A 4IORA 5E74A 3U5KA 5F36A 4QNSA 4OGJA 5EICA 3JVLA 4NXJA 2DVVA 1JSPB 4UYFA 4QYDA 3RCWA 3P1CA 4YABA 4GPJA 4LZSA 4TU6A 4TQNA 5D3SA 5HM0A 5D3LA 4QY4A 5TB6A 5HRWA 5DYAA 3LQJA 5EVAA 5CQAA 4TZ2A 3DAIA 4YYHA 3UVDA 5HFRA 5CUBA 3GG3A 5ETDA 4O71A 4YC9A 5CUEA 4BJXA 5G4RA 4Z6HA 4QEWA 5EPRA 4BHWA 4YYMA 5DFCA 4J3IA 3IU6A 4NR5A 2R0YA 5F62A 3FKMX 2E7NA 4O7AA 5F25A 3ONIA 3UV2A 4O75A 3JVKA 4IOQA 5EPSA 4CUPA 5A82A 5C85A 5IGKA 3LJWA 5DFBA 5CUDA 2DVSA 4HXRA 4UIVA 3O33A 4UYGA 5H1UA 5EQ1A 5K29A 5LJ2A 2GRCA 4QEVA 2H60A 1EQFA 5FFWA 3HMHA 4MR4A 5HRVA 2F6NA 4LC2A 3D7CA 3MB3A 2YELA 4LYWA 5DW2A 5LKZA 4QUUA 5F63A 4QSPA 2L5EA 5F60A 5D26A 5JWMA 5LKTA 4Z1SA 2L85A 5JI8A 3P1EA 5H1TA 4A9LA 5LJ1A 5CS8A 4UYHA 4YBMA 4IR3A 5AMEA 5BT5A 4LRGA 4LDFA 4LZ2A 4NRAA 5CQ6A 1ZS5A 5D3RA 3UVWA 5HLSA 4IR4A 4F3IA 5IGNA 5I86A 5I7XA 3G0LA 5DKDA 5FG4A 4MR5A 3LQIA 3MUKA 4CL9A 1F68A 4NR6A 3Q2EA 5BT4A 5CRZA 4O70A 2RNYA 4IR5A 4TTEA 5ENBA 5HCLA 4PS5A 5HRXA 5LKUA 3SVGA 4HBVA 4UIWA 5D3TA 3P1FA 4YYNA 4MENA 2R0VA 4Z6IA 4HXLA 5HELA 4PTBA 2WP2A 4A9IA 4QBMA 5ENEA 4YBSA 5FE6A 5A81A 4PKLA 5AMFA 5L98A 5C89A 2RI7A 4NRCA 4LYIA 4LYSA 4HXKA 5H85A 4A9KA 4MR3A 4LZRA 4QC1A 5FE3A 5FH6A 2NXBA 5LVQA 3QZSA 4YY4A 2E3KA 4UIYA 4N4GA 3JVJA 5FB0A 4MEQA 2FSAA 3I3JA 5EA1A 5KHMA 4NQMA 5D7XA 4C67A 5E9LA 2DKWA 4WIVA 2RNWA 5EWVA 4CLBA 5D25A 4NR7A 5A5PA 5H1VA 5G4SA 4RVRA 5EISA 4FLPA 3U5NA 3U5MA 2DVRA 2MJVB 3U5LA 5EK9A 5I80A 1N72A 2OUOA 5DW1A 4QR4A 4DONA 3UVYA 4QSVA 4J0RA 5E9IA 3HMEA 4NYXA 5L8TA 4QSTA 4N4HA 3UW9A 4HBXA 4ALGA 4NYVA 4Z1QA 5EU1A 4O74A 4YYDA 4Y03A 4E96A 5EGUA 4HXOA 5E73A 4HXPA 4YH3A 5CQTA 4N4FA 5CQ8A 5D24A 5F5ZA 5A5SA 2E7OA 5CPEA 3SVHA 5CUGA 5D0CA 5DX4A 4N3WA 4QYLA 5F2PA 3HMFA 5FBXA 4Z93A 2WP1A 4OGIA 5D3HA 5IBNA 5FE0A 4A9MA 5FE8A 4YATA 5IG6A 5FG5A 5II2A 5IGMA 3P1DA 5EWCA 3O37A 5CUAA 2R10A 5CZGA 4BW3A 5HENA 5TCMA 3LQHA 5CTLA 4UIUA 3AADA 5FH7A 4O78A 5E7DA 5ENIA 5FE5A 1WUGA 4A9NA 5EWHA 4UIZA 1WUMA 4C66A 5C4QA 4X2IA 4MEOA 5HFQA 5ENGA 4TS8A 4CURA 4HXSA 5I1QA 4QC3A 5KTXA 5IGLA 1X0JA 4TZ8A 4J0SA 5CQ7A 3LXJA 5FE4A 4CFLA 5CFWA 5FDZA 3O35A 4LR6A 5DY7A 5L97A 4A9HA 5A85A 5D3JA 4PCEA 4ZQLA 5D3NA 5HQ5A 4HBYA 4IR6A 3JVMA 4NRBA 4QSUA 5E9KA 2RO1A 3S91A 4YYIA 5EP7A 4YYGA 5E9YA 2YEMA 2DWWA 2YQDA 5HJCA 5II1A 3UV5A 5I89A 5HQ6A 4QEUA 4WHWA 2OSSA 3MQMA 4QSSA 2L84A 4NR9A 4O7CA 4PY6A 5AD3A 4KCXA 5FE1A 5KU3A 5LUUA 4UIXA 2R0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QUT A;  4BW2 A;  5DYC A;  3DWY A;  4KV4 A;  5DFD A;  5DYX A;  4QB3 A;  4YAX A;  3G0J A;  4O7F A;  4YY6 A;  3MXF A;  4TU4 A;  3QZV A;  4A9O A;  5LKX A;  2I8N A;  4XY8 A;  3U5P A;  5I88 A;  4QSX A;  2G4A A;  3UV4 A;  4XY9 A;  4KV1 A;  5LJ0 A;  4QSQ A;  5HEM A;  5COI A;  4O7B A;  4J1P A;  4XUB A;  5IID A;  2D9E A;  4A9F A;  4YAD A;  4O76 A;  5CP5 A;  4ALH A;  4CUQ A;  2YDW A;  4A9E A;  5FFV A;  5J0D A;  4Q0N A;  3Q2F A;  5EPB A;  5C87 A;  3U5O A;  5KTW A;  2DVQ A;  4QR5 A;  2D82 A;  4O72 A;  4CFK A;  5EWW A;  4CUS A;  5CUC A;  5EWD A;  5F1L A;  4A9J A;  4O77 A;  4N4I A;  4UYE A;  5I29 A;  4BW1 A;  5F3A A;  5A5O A;  5DKH A;  2LSP B;  5CY9 A;  4NYW A;  4UYD A;  3UVX A;  4XYA A;  5FE7 A;  4HXN A;  5E9V A;  5EV9 A;  5L96 A;  4NR4 A;  3O34 A;  5C7N A;  4TT2 A;  4NUD A;  4YYJ A;  4XUA A;  5CRM A;  3O36 A;  5FFY A;  4UYF B;  5ENF A;  4HBW A;  5ENJ A;  4NR8 A;  5KTU A;  4CUT A;  5EM3 A;  5DKC A;  4QZS A;  5DBM A;  4QR3 A;  5E3G A;  5E9M A;  4YK0 A;  3MB4 A;  5L8U A;  5BT3 A;  5LVR A;  4PCI A;  4Q0O A;  4WHU A;  5DYU A;  4O7E A;  4CUU A;  3QZT A;  5HQ7 A;  5ENH A;  4ZW1 A;  3IU5 A;  5ACY A;  3AQA A;  3TLP A;  5E3D A;  3ZYU A;  5A83 A;  5CQ5 A;  3NXB A;  2I7K A;  3S92 A;  2YEK A;  5F1H A;  4TYL A;  5EI4 A;  4TT6 A;  1JM4 B;  5I7Y A;  2OO1 A;  2KTB B;  5ETB A;  5CQ4 A;  4TT4 A;  5FE9 A;  4YBT A;  2N9G A;  4ZC9 A;  5FB1 A;  5A5N A;  4QSR A;  2F6J A;  4NS5 A;  5DLX A;  5E0R A;  4IOO A;  4UIT A;  5KO4 A;  4MEP A;  2RFJ A;  4YYK A;  5FG6 A;  5I83 A;  3U5J A;  5CGP A;  2RS9 B;  5CQ3 A;  3P5O A;  5A5R A;  4NUC A;  5FE2 A;  2YW5 A;  5I40 A;  5CU8 A;  5DLZ A;  5AD2 A;  5FH8 A;  4QSW A;  2DAT A;  3MUL A;  1E6I A;  4OUF A;  4HXM A;  5A7C A;  3SVF A;  2YYN A;  4NUE A;  3K2J A;  5L99 A;  4MR6 A;  4NQN A;  4YH4 A;  5F61 A;  5ENC A;  4AKN A;  2RNX A;  5D3P A;  5A5Q A;  5C8G A;  4BW4 A;  4IOR A;  5E74 A;  3U5K A;  5F36 A;  4QNS A;  4OGJ A;  5EIC A;  3JVL A;  4NXJ A;  2DVV A;  1JSP B;  4UYF A;  4QYD A;  3RCW A;  3P1C A;  4YAB A;  4GPJ A;  4LZS A;  4TU6 A;  4TQN A;  5D3S A;  5HM0 A;  5D3L A;  4QY4 A;  5TB6 A;  5HRW A;  5DYA A;  3LQJ A;  5EVA A;  5CQA A;  4TZ2 A;  3DAI A;  4YYH A;  3UVD A;  5HFR A;  5CUB A;  3GG3 A;  5ETD A;  4O71 A;  4YC9 A;  5CUE A;  4BJX A;  5G4R A;  4Z6H A;  4QEW A;  5EPR A;  4BHW A;  4YYM A;  5DFC A;  4J3I A;  3IU6 A;  4NR5 A;  2R0Y A;  5F62 A;  3FKM X;  2E7N A;  4O7A A;  5F25 A;  3ONI A;  3UV2 A;  4O75 A;  3JVK A;  4IOQ A;  5EPS A;  4CUP A;  5A82 A;  5C85 A;  5IGK A;  3LJW A;  5DFB A;  5CUD A;  2DVS A;  4HXR A;  4UIV A;  3O33 A;  4UYG A;  5H1U A;  5EQ1 A;  5K29 A;  5LJ2 A;  2GRC A;  4QEV A;  2H60 A;  1EQF A;  5FFW A;  3HMH A;  4MR4 A;  5HRV A;  2F6N A;  4LC2 A;  3D7C A;  3MB3 A;  2YEL A;  4LYW A;  5DW2 A;  5LKZ A;  4QUU A;  5F63 A;  4QSP A;  2L5E A;  5F60 A;  5D26 A;  5JWM A;  5LKT A;  4Z1S A;  2L85 A;  5JI8 A;  3P1E A;  5H1T A;  4A9L A;  5LJ1 A;  5CS8 A;  4UYH A;  4YBM A;  4IR3 A;  5AME A;  5BT5 A;  4LRG A;  4LDF A;  4LZ2 A;  4NRA A;  5CQ6 A;  1ZS5 A;  5D3R A;  3UVW A;  5HLS A;  4IR4 A;  4F3I A;  5IGN A;  5I86 A;  5I7X A;  3G0L A;  5DKD A;  5FG4 A;  4MR5 A;  3LQI A;  3MUK A;  4CL9 A;  1F68 A;  4NR6 A;  3Q2E A;  5BT4 A;  5CRZ A;  4O70 A;  2RNY A;  4IR5 A;  4TTE A;  5ENB A;  5HCL A;  4PS5 A;  5HRX A;  5LKU A;  3SVG A;  4HBV A;  4UIW A;  5D3T A;  3P1F A;  4YYN A;  4MEN A;  2R0V A;  4Z6I A;  4HXL A;  5HEL A;  4PTB A;  2WP2 A;  4A9I A;  4QBM A;  5ENE A;  4YBS A;  5FE6 A;  5A81 A;  4PKL A;  5AMF A;  5L98 A;  5C89 A;  2RI7 A;  4NRC A;  4LYI A;  4LYS A;  4HXK A;  5H85 A;  4A9K A;  4MR3 A;  4LZR A;  4QC1 A;  5FE3 A;  5FH6 A;  2NXB A;  5LVQ A;  3QZS A;  4YY4 A;  2E3K A;  4UIY A;  4N4G A;  3JVJ A;  5FB0 A;  4MEQ A;  2FSA A;  3I3J A;  5EA1 A;  5KHM A;  4NQM A;  5D7X A;  4C67 A;  5E9L A;  2DKW A;  4WIV A;  2RNW A;  5EWV A;  4CLB A;  5D25 A;  4NR7 A;  5A5P A;  5H1V A;  5G4S A;  4RVR A;  5EIS A;  4FLP A;  3U5N A;  3U5M A;  2DVR A;  2MJV B;  3U5L A;  5EK9 A;  5I80 A;  1N72 A;  2OUO A;  5DW1 A;  4QR4 A;  4DON A;  3UVY A;  4QSV A;  4J0R A;  5E9I A;  3HME A;  4NYX A;  5L8T A;  4QST A;  4N4H A;  3UW9 A;  4HBX A;  4ALG A;  4NYV A;  4Z1Q A;  5EU1 A;  4O74 A;  4YYD A;  4Y03 A;  4E96 A;  5EGU A;  4HXO A;  5E73 A;  4HXP A;  4YH3 A;  5CQT A;  4N4F A;  5CQ8 A;  5D24 A;  5F5Z A;  5A5S A;  2E7O A;  5CPE A;  3SVH A;  5CUG A;  5D0C A;  5DX4 A;  4N3W A;  4QYL A;  5F2P A;  3HMF A;  5FBX A;  4Z93 A;  2WP1 A;  4OGI A;  5D3H A;  5IBN A;  5FE0 A;  4A9M A;  5FE8 A;  4YAT A;  5IG6 A;  5FG5 A;  5II2 A;  5IGM A;  3P1D A;  5EWC A;  3O37 A;  5CUA A;  2R10 A;  5CZG A;  4BW3 A;  5HEN A;  5TCM A;  3LQH A;  5CTL A;  4UIU A;  3AAD A;  5FH7 A;  4O78 A;  5E7D A;  5ENI A;  5FE5 A;  1WUG A;  4A9N A;  5EWH A;  4UIZ A;  1WUM A;  4C66 A;  5C4Q A;  4X2I A;  4MEO A;  5HFQ A;  5ENG A;  4TS8 A;  4CUR A;  4HXS A;  5I1Q A;  4QC3 A;  5KTX A;  5IGL A;  1X0J A;  4TZ8 A;  4J0S A;  5CQ7 A;  3LXJ A;  5FE4 A;  4CFL A;  5CFW A;  5FDZ A;  3O35 A;  4LR6 A;  5DY7 A;  5L97 A;  4A9H A;  5A85 A;  5D3J A;  4PCE A;  4ZQL A;  5D3N A;  5HQ5 A;  4HBY A;  4IR6 A;  3JVM A;  4NRB A;  4QSU A;  5E9K A;  2RO1 A;  3S91 A;  4YYI A;  5EP7 A;  4YYG A;  5E9Y A;  2YEM A;  2DWW A;  2YQD A;  5HJC A;  5II1 A;  3UV5 A;  5I89 A;  5HQ6 A;  4QEU A;  4WHW A;  2OSS A;  3MQM A;  4QSS A;  2L84 A;  4NR9 A;  4O7C A;  4PY6 A;  5AD3 A;  4KCX A;  5FE1 A;  5KU3 A;  5LUU A;  4UIX A;  2R0S A; 
#chains in the Genus database with same CATH topology
 4QUT A;  4BW2 A;  5DYC A;  3DWY A;  4KV4 A;  5DFD A;  5DYX A;  4QB3 A;  4YAX A;  3G0J A;  4O7F A;  4YY6 A;  3MXF A;  4TU4 A;  3QZV A;  4A9O A;  5LKX A;  2I8N A;  4XY8 A;  3U5P A;  5I88 A;  4QSX A;  2G4A A;  3UV4 A;  4XY9 A;  4KV1 A;  5LJ0 A;  4QSQ A;  5HEM A;  5COI A;  4O7B A;  4J1P A;  4XUB A;  5IID A;  2D9E A;  4A9F A;  4YAD A;  4O76 A;  5CP5 A;  4ALH A;  4CUQ A;  2YDW A;  4A9E A;  5FFV A;  5J0D A;  4Q0N A;  3Q2F A;  5EPB A;  5C87 A;  3U5O A;  5KTW A;  2DVQ A;  4QR5 A;  2D82 A;  4O72 A;  4CFK A;  5EWW A;  4CUS A;  5CUC A;  5EWD A;  1ZKR A;  5F1L A;  4A9J A;  4O77 A;  4N4I A;  4UYE A;  5I29 A;  4BW1 A;  5F3A A;  5A5O A;  3VKG A;  5DKH A;  2LSP B;  5CY9 A;  4NYW A;  4UYD A;  3UVX A;  4XYA A;  5FE7 A;  4HXN A;  5E9V A;  5EV9 A;  5L96 A;  4NR4 A;  3O34 A;  5C7N A;  4TT2 A;  4NUD A;  4YYJ A;  4XUA A;  5CRM A;  3O36 A;  5FFY A;  4UYF B;  5ENF A;  4HBW A;  5ENJ A;  4NR8 A;  5KTU A;  4CUT A;  5EM3 A;  5DKC A;  4QZS A;  5DBM A;  4QR3 A;  5E3G A;  5E9M A;  4YK0 A;  3MB4 A;  5L8U A;  5BT3 A;  5LVR A;  4PCI A;  4Q0O A;  4WHU A;  5DYU A;  4O7E A;  4CUU A;  3QZT A;  3D1B A;  5HQ7 A;  5ENH A;  4ZW1 A;  3IU5 A;  5ACY A;  3AQA A;  3TLP A;  5E3D A;  3ZYU A;  5A83 A;  5CQ5 A;  3NXB A;  2I7K A;  3S92 A;  2YEK A;  5F1H A;  4TYL A;  5EI4 A;  4TT6 A;  1JM4 B;  5I7Y A;  2OO1 A;  2KTB B;  5ETB A;  5CQ4 A;  4TT4 A;  5FE9 A;  4YBT A;  2N9G A;  4ZC9 A;  5FB1 A;  5A5N A;  4QSR A;  2F6J A;  4NS5 A;  5DLX A;  3D1D A;  5E0R A;  4IOO A;  4UIT A;  5KO4 A;  4MEP A;  2RFJ A;  4YYK A;  5FG6 A;  5I83 A;  3U5J A;  5CGP A;  2RS9 B;  5CQ3 A;  3P5O A;  5A5R A;  4NUC A;  5FE2 A;  2YW5 A;  5I40 A;  5CU8 A;  5DLZ A;  5AD2 A;  5FH8 A;  4QSW A;  2DAT A;  3MUL A;  1E6I A;  4OUF A;  4HXM A;  5A7C A;  3SVF A;  2YYN A;  4NUE A;  3K2J A;  5L99 A;  4MR6 A;  4NQN A;  4YH4 A;  5F61 A;  5ENC A;  4AKN A;  2RNX A;  5D3P A;  5A5Q A;  5C8G A;  4BW4 A;  4IOR A;  5E74 A;  3U5K A;  5F36 A;  4QNS A;  4OGJ A;  5EIC A;  3JVL A;  4NXJ A;  2DVV A;  1JSP B;  4UYF A;  4QYD A;  3RCW A;  3P1C A;  4YAB A;  4GPJ A;  4LZS A;  4TU6 A;  4TQN A;  5D3S A;  5HM0 A;  5D3L A;  4QY4 A;  5TB6 A;  5HRW A;  5DYA A;  3LQJ A;  5EVA A;  5CQA A;  4TZ2 A;  3DAI A;  4YYH A;  3UVD A;  5HFR A;  5CUB A;  3GG3 A;  5ETD A;  4O71 A;  4YC9 A;  5CUE A;  4BJX A;  5G4R A;  4Z6H A;  4QEW A;  3ERR A;  5EPR A;  4BHW A;  4YYM A;  5DFC A;  4J3I A;  3IU6 A;  4NR5 A;  2R0Y A;  5F62 A;  3FKM X;  2E7N A;  4O7A A;  5F25 A;  3ONI A;  3UV2 A;  4O75 A;  3JVK A;  4IOQ A;  5EPS A;  4CUP A;  5A82 A;  5C85 A;  3VKH A;  5IGK A;  3LJW A;  5DFB A;  5CUD A;  2DVS A;  4HXR A;  4UIV A;  3O33 A;  4UYG A;  5H1U A;  5EQ1 A;  2EJN A;  5K29 A;  5LJ2 A;  2GRC A;  4QEV A;  2H60 A;  1EQF A;  5FFW A;  3HMH A;  4MR4 A;  5HRV A;  2F6N A;  4LC2 A;  3D7C A;  3MB3 A;  2YEL A;  4LYW A;  5DW2 A;  5LKZ A;  4QUU A;  5F63 A;  4QSP A;  2L5E A;  5F60 A;  5D26 A;  5JWM A;  5LKT A;  4Z1S A;  2L85 A;  5JI8 A;  3P1E A;  5H1T A;  4A9L A;  5LJ1 A;  5CS8 A;  4UYH A;  4YBM A;  4IR3 A;  5AME A;  5BT5 A;  4LRG A;  4LDF A;  4LZ2 A;  4NRA A;  5CQ6 A;  1ZS5 A;  5D3R A;  3UVW A;  5HLS A;  4IR4 A;  4F3I A;  5IGN A;  5I86 A;  4AKH A;  5I7X A;  3G0L A;  5DKD A;  5FG4 A;  4MR5 A;  3LQI A;  3MUK A;  4CL9 A;  1F68 A;  4NR6 A;  3Q2E A;  5BT4 A;  5CRZ A;  4O70 A;  2RNY A;  4IR5 A;  4TTE A;  5ENB A;  5HCL A;  4PS5 A;  5HRX A;  5LKU A;  3SVG A;  4HBV A;  4UIW A;  5D3T A;  3P1F A;  4YYN A;  4MEN A;  2R0V A;  4Z6I A;  4HXL A;  1PUO A;  5HEL A;  4PTB A;  2WP2 A;  4A9I A;  4QBM A;  5ENE A;  4YBS A;  5FE6 A;  5A81 A;  4PKL A;  5AMF A;  5L98 A;  5C89 A;  2RI7 A;  4NRC A;  4LYI A;  4LYS A;  4HXK A;  5H85 A;  4A9K A;  4MR3 A;  4LZR A;  4QC1 A;  5FE3 A;  5FH6 A;  2NXB A;  5LVQ A;  3QZS A;  4YY4 A;  2E3K A;  4UIY A;  4N4G A;  3JVJ A;  4AKI A;  5FB0 A;  4MEQ A;  2FSA A;  3I3J A;  5EA1 A;  5KHM A;  4NQM A;  5D7X A;  4C67 A;  5E9L A;  2DKW A;  4WIV A;  2RNW A;  5EWV A;  4CLB A;  5D25 A;  4NR7 A;  5A5P A;  5H1V A;  5G4S A;  4RVR A;  5EIS A;  4FLP A;  3U5N A;  3U5M A;  2DVR A;  2MJV B;  3U5L A;  5EK9 A;  5I80 A;  1N72 A;  2OUO A;  5DW1 A;  4QR4 A;  4DON A;  3UVY A;  4QSV A;  4J0R A;  5E9I A;  3HME A;  4NYX A;  5L8T A;  4QST A;  4AI6 A;  4N4H A;  3UW9 A;  4HBX A;  4ALG A;  4NYV A;  4Z1Q A;  5EU1 A;  4O74 A;  4YYD A;  4Y03 A;  4E96 A;  5EGU A;  4HXO A;  5E73 A;  4HXP A;  4YH3 A;  5CQT A;  4N4F A;  5CQ8 A;  5D24 A;  5F5Z A;  5A5S A;  2E7O A;  5CPE A;  3SVH A;  5CUG A;  5D0C A;  5DX4 A;  4N3W A;  4QYL A;  5F2P A;  3HMF A;  5FBX A;  4Z93 A;  2WP1 A;  4OGI A;  5D3H A;  5IBN A;  4AKG A;  5FE0 A;  4A9M A;  5FE8 A;  4YAT A;  5IG6 A;  5FG5 A;  5II2 A;  5IGM A;  3P1D A;  5EWC A;  3O37 A;  5CUA A;  2R10 A;  5CZG A;  4BW3 A;  5HEN A;  5TCM A;  3LQH A;  5CTL A;  4UIU A;  3AAD A;  5FH7 A;  4O78 A;  5E7D A;  5ENI A;  5FE5 A;  1WUG A;  4A9N A;  5EWH A;  4UIZ A;  1WUM A;  4C66 A;  5C4Q A;  4X2I A;  4MEO A;  5HFQ A;  5ENG A;  4TS8 A;  4CUR A;  4HXS A;  5I1Q A;  4QC3 A;  5KTX A;  5IGL A;  1X0J A;  4TZ8 A;  4J0S A;  5CQ7 A;  3LXJ A;  5FE4 A;  4CFL A;  5CFW A;  5FDZ A;  3O35 A;  4LR6 A;  5DY7 A;  5L97 A;  4A9H A;  5A85 A;  5D3J A;  4PCE A;  4ZQL A;  5D3N A;  5HQ5 A;  4HBY A;  4IR6 A;  3JVM A;  4NRB A;  4QSU A;  5E9K A;  2RO1 A;  3S91 A;  4YYI A;  5EP7 A;  4YYG A;  5E9Y A;  2YEM A;  2DWW A;  2YQD A;  5HJC A;  5II1 A;  3UV5 A;  5I89 A;  5HQ6 A;  4QEU A;  4WHW A;  2OSS A;  3MQM A;  4QSS A;  2L84 A;  4NR9 A;  4O7C A;  4PY6 A;  5AD3 A;  4KCX A;  5FE1 A;  5KU3 A;  5LUU A;  4UIX A;  2R0S A; 
#chains in the Genus database with same CATH homology
 4QUT A;  4BW2 A;  5DYC A;  3DWY A;  4KV4 A;  5DFD A;  5DYX A;  4QB3 A;  4YAX A;  3G0J A;  4O7F A;  4YY6 A;  3MXF A;  4TU4 A;  3QZV A;  4A9O A;  5LKX A;  2I8N A;  4XY8 A;  3U5P A;  5I88 A;  4QSX A;  2G4A A;  3UV4 A;  4XY9 A;  4KV1 A;  5LJ0 A;  4QSQ A;  5HEM A;  5COI A;  4O7B A;  4J1P A;  4XUB A;  5IID A;  2D9E A;  4A9F A;  4YAD A;  4O76 A;  5CP5 A;  4ALH A;  4CUQ A;  2YDW A;  4A9E A;  5FFV A;  5J0D A;  4Q0N A;  3Q2F A;  5EPB A;  5C87 A;  3U5O A;  5KTW A;  2DVQ A;  4QR5 A;  2D82 A;  4O72 A;  4CFK A;  5EWW A;  4CUS A;  5CUC A;  5EWD A;  5F1L A;  4A9J A;  4O77 A;  4N4I A;  4UYE A;  5I29 A;  4BW1 A;  5F3A A;  5A5O A;  5DKH A;  2LSP B;  5CY9 A;  4NYW A;  4UYD A;  3UVX A;  4XYA A;  5FE7 A;  4HXN A;  5E9V A;  5EV9 A;  5L96 A;  4NR4 A;  3O34 A;  5C7N A;  4TT2 A;  4NUD A;  4YYJ A;  4XUA A;  5CRM A;  3O36 A;  5FFY A;  4UYF B;  5ENF A;  4HBW A;  5ENJ A;  4NR8 A;  5KTU A;  4CUT A;  5EM3 A;  5DKC A;  4QZS A;  5DBM A;  4QR3 A;  5E3G A;  5E9M A;  4YK0 A;  3MB4 A;  5L8U A;  5BT3 A;  5LVR A;  4PCI A;  4Q0O A;  4WHU A;  5DYU A;  4O7E A;  4CUU A;  3QZT A;  5HQ7 A;  5ENH A;  4ZW1 A;  3IU5 A;  5ACY A;  3AQA A;  3TLP A;  5E3D A;  3ZYU A;  5A83 A;  5CQ5 A;  3NXB A;  2I7K A;  3S92 A;  2YEK A;  5F1H A;  4TYL A;  5EI4 A;  4TT6 A;  1JM4 B;  5I7Y A;  2OO1 A;  2KTB B;  5ETB A;  5CQ4 A;  4TT4 A;  5FE9 A;  4YBT A;  2N9G A;  4ZC9 A;  5FB1 A;  5A5N A;  4QSR A;  2F6J A;  4NS5 A;  5DLX A;  5E0R A;  4IOO A;  4UIT A;  5KO4 A;  4MEP A;  2RFJ A;  4YYK A;  5FG6 A;  5I83 A;  3U5J A;  5CGP A;  2RS9 B;  5CQ3 A;  3P5O A;  5A5R A;  4NUC A;  5FE2 A;  2YW5 A;  5I40 A;  5CU8 A;  5DLZ A;  5AD2 A;  5FH8 A;  4QSW A;  2DAT A;  3MUL A;  1E6I A;  4OUF A;  4HXM A;  5A7C A;  3SVF A;  2YYN A;  4NUE A;  3K2J A;  5L99 A;  4MR6 A;  4NQN A;  4YH4 A;  5F61 A;  5ENC A;  4AKN A;  2RNX A;  5D3P A;  5A5Q A;  5C8G A;  4BW4 A;  4IOR A;  5E74 A;  3U5K A;  5F36 A;  4QNS A;  4OGJ A;  5EIC A;  3JVL A;  4NXJ A;  2DVV A;  1JSP B;  4UYF A;  4QYD A;  3RCW A;  3P1C A;  4YAB A;  4GPJ A;  4LZS A;  4TU6 A;  4TQN A;  5D3S A;  5HM0 A;  5D3L A;  4QY4 A;  5TB6 A;  5HRW A;  5DYA A;  3LQJ A;  5EVA A;  5CQA A;  4TZ2 A;  3DAI A;  4YYH A;  3UVD A;  5HFR A;  5CUB A;  3GG3 A;  5ETD A;  4O71 A;  4YC9 A;  5CUE A;  4BJX A;  5G4R A;  4Z6H A;  4QEW A;  5EPR A;  4BHW A;  4YYM A;  5DFC A;  4J3I A;  3IU6 A;  4NR5 A;  2R0Y A;  5F62 A;  3FKM X;  2E7N A;  4O7A A;  5F25 A;  3ONI A;  3UV2 A;  4O75 A;  3JVK A;  4IOQ A;  5EPS A;  4CUP A;  5A82 A;  5C85 A;  5IGK A;  3LJW A;  5DFB A;  5CUD A;  2DVS A;  4HXR A;  4UIV A;  3O33 A;  4UYG A;  5H1U A;  5EQ1 A;  5K29 A;  5LJ2 A;  2GRC A;  4QEV A;  2H60 A;  1EQF A;  5FFW A;  3HMH A;  4MR4 A;  5HRV A;  2F6N A;  4LC2 A;  3D7C A;  3MB3 A;  2YEL A;  4LYW A;  5DW2 A;  5LKZ A;  4QUU A;  5F63 A;  4QSP A;  2L5E A;  5F60 A;  5D26 A;  5JWM A;  5LKT A;  4Z1S A;  2L85 A;  5JI8 A;  3P1E A;  5H1T A;  4A9L A;  5LJ1 A;  5CS8 A;  4UYH A;  4YBM A;  4IR3 A;  5AME A;  5BT5 A;  4LRG A;  4LDF A;  4LZ2 A;  4NRA A;  5CQ6 A;  1ZS5 A;  5D3R A;  3UVW A;  5HLS A;  4IR4 A;  4F3I A;  5IGN A;  5I86 A;  5I7X A;  3G0L A;  5DKD A;  5FG4 A;  4MR5 A;  3LQI A;  3MUK A;  4CL9 A;  1F68 A;  4NR6 A;  3Q2E A;  5BT4 A;  5CRZ A;  4O70 A;  2RNY A;  4IR5 A;  4TTE A;  5ENB A;  5HCL A;  4PS5 A;  5HRX A;  5LKU A;  3SVG A;  4HBV A;  4UIW A;  5D3T A;  3P1F A;  4YYN A;  4MEN A;  2R0V A;  4Z6I A;  4HXL A;  5HEL A;  4PTB A;  2WP2 A;  4A9I A;  4QBM A;  5ENE A;  4YBS A;  5FE6 A;  5A81 A;  4PKL A;  5AMF A;  5L98 A;  5C89 A;  2RI7 A;  4NRC A;  4LYI A;  4LYS A;  4HXK A;  5H85 A;  4A9K A;  4MR3 A;  4LZR A;  4QC1 A;  5FE3 A;  5FH6 A;  2NXB A;  5LVQ A;  3QZS A;  4YY4 A;  2E3K A;  4UIY A;  4N4G A;  3JVJ A;  5FB0 A;  4MEQ A;  2FSA A;  3I3J A;  5EA1 A;  5KHM A;  4NQM A;  5D7X A;  4C67 A;  5E9L A;  2DKW A;  4WIV A;  2RNW A;  5EWV A;  4CLB A;  5D25 A;  4NR7 A;  5A5P A;  5H1V A;  5G4S A;  4RVR A;  5EIS A;  4FLP A;  3U5N A;  3U5M A;  2DVR A;  2MJV B;  3U5L A;  5EK9 A;  5I80 A;  1N72 A;  2OUO A;  5DW1 A;  4QR4 A;  4DON A;  3UVY A;  4QSV A;  4J0R A;  5E9I A;  3HME A;  4NYX A;  5L8T A;  4QST A;  4N4H A;  3UW9 A;  4HBX A;  4ALG A;  4NYV A;  4Z1Q A;  5EU1 A;  4O74 A;  4YYD A;  4Y03 A;  4E96 A;  5EGU A;  4HXO A;  5E73 A;  4HXP A;  4YH3 A;  5CQT A;  4N4F A;  5CQ8 A;  5D24 A;  5F5Z A;  5A5S A;  2E7O A;  5CPE A;  3SVH A;  5CUG A;  5D0C A;  5DX4 A;  4N3W A;  4QYL A;  5F2P A;  3HMF A;  5FBX A;  4Z93 A;  2WP1 A;  4OGI A;  5D3H A;  5IBN A;  5FE0 A;  4A9M A;  5FE8 A;  4YAT A;  5IG6 A;  5FG5 A;  5II2 A;  5IGM A;  3P1D A;  5EWC A;  3O37 A;  5CUA A;  2R10 A;  5CZG A;  4BW3 A;  5HEN A;  5TCM A;  3LQH A;  5CTL A;  4UIU A;  3AAD A;  5FH7 A;  4O78 A;  5E7D A;  5ENI A;  5FE5 A;  1WUG A;  4A9N A;  5EWH A;  4UIZ A;  1WUM A;  4C66 A;  5C4Q A;  4X2I A;  4MEO A;  5HFQ A;  5ENG A;  4TS8 A;  4CUR A;  4HXS A;  5I1Q A;  4QC3 A;  5KTX A;  5IGL A;  1X0J A;  4TZ8 A;  4J0S A;  5CQ7 A;  3LXJ A;  5FE4 A;  4CFL A;  5CFW A;  5FDZ A;  3O35 A;  4LR6 A;  5DY7 A;  5L97 A;  4A9H A;  5A85 A;  5D3J A;  4PCE A;  4ZQL A;  5D3N A;  5HQ5 A;  4HBY A;  4IR6 A;  3JVM A;  4NRB A;  4QSU A;  5E9K A;  2RO1 A;  3S91 A;  4YYI A;  5EP7 A;  4YYG A;  5E9Y A;  2YEM A;  2DWW A;  2YQD A;  5HJC A;  5II1 A;  3UV5 A;  5I89 A;  5HQ6 A;  4QEU A;  4WHW A;  2OSS A;  3MQM A;  4QSS A;  2L84 A;  4NR9 A;  4O7C A;  4PY6 A;  5AD3 A;  4KCX A;  5FE1 A;  5KU3 A;  5LUU A;  4UIX A;  2R0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...