5ENFA

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with fragment-4 n10142 (sgc - diamond i04-1 fragment screening)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PH-interacting protein
publication title A poised fragment library enables rapid synthetic expansion yielding the first reported inhibitors of PHIP(2), an atypical bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 46
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5enfA00
4MEOA 5BT3A 5L97A 4WIVA 5IBNA 4A9FA 4C66A 4NQMA 5EPSA 3IU6A 5ENJA 4CLBA 5CFWA 5JWMA 5CQ7A 3U5LA 3ZYUA 5IGLA 4E96A 4LZSA 5I80A 5A83A 4QSVA 4Z6IA 3FKMX 4HBXA 4UIVA 2E7NA 4TQNA 4QYDA 5C4QA 4TT2A 2RFJA 4A9JA 4YYKA 5CRZA 3U5KA 4PS5A 4NUDA 4UYDA 4OGJA 3U5NA 4YY4A 2NXBA 4QSUA 5D3TA 3P1CA 4YC9A 2WP2A 4GPJA 2E7OA 3NXBA 4OUFA 5E3DA 5LKXA 5L99A 5C89A 4TZ2A 3S92A 4O77A 5H1UA 3JVKA 5ETBA 4O7EA 4YAXA 1WUMA 3O36A 4HXOA 5EWVA 4YBSA 5CP5A 4CUPA 4DONA 4QEWA 5HQ7A 5D7XA 5HFQA 4UIWA 4CUSA 5D25A 3U5MA 5CQ4A 5EVAA 5DLXA 3O33A 5D3SA 3QZTA 5DW2A 5ENFA 5DKHA 5CQ6A 4HBWA 5ACYA 2F6NA 4KV1A 5DYCA 5CUEA 4Z1QA 4A9LA 2L84A 4QSXA 4QSSA 5CPEA 5FE2A 5HENA 4MR4A 5D0CA 5F1HA 2D9EA 4CUTA 5DYAA 3HMFA 4BW1A 5ENIA 4XY8A 4MEQA 3LQHA 3K2JA 3O34A 5CU8A 4A9NA 4UIZA 5C85A 4NYXA 5L8TA 5IGNA 4N4HA 3UV4A 5H1TA 4QB3A 5EWHA 5EA1A 5HRXA 3DWYA 1EQFA 5LKZA 5EI4A 5LJ0A 4LRGA 4QEVA 5E9MA 5E7DA 5A5OA 4UYFA 5FE9A 4NR6A 5D26A 4TU4A 4O71A 4TS8A 3D7CA 5EISA 4NQNA 5LJ2A 4NXJA 3LJWA 4YYDA 2H60A 5FFWA 5CRMA 5F62A 4PY6A 5A85A 4CFKA 3SVHA 2WP1A 4QYLA 5C8GA 5FDZA 3P1EA 4MR3A 5A81A 4IR6A 5F63A 4YYHA 5F2PA 3JVMA 3UW9A 4NRCA 5FB0A 5IGMA 4PTBA 5F1LA 5LJ1A 5EGUA 5CZGA 4O70A 5E3GA 5FH6A 3MUKA 4QR3A 4CL9A 5AMEA 5E9YA 2I8NA 4LYSA 5E74A 5ENCA 4TT6A 3RCWA 3SVGA 3U5OA 5HCLA 3DAIA 4CFLA 5CQ3A 3MULA 4UYHA 5G4SA 5I7YA 4HXNA 4WHUA 5DLZA 4A9OA 5EK9A 5LUUA 4QBMA 4ZW1A 4HXKA 5ENEA 5AD3A 4MR5A 5CGPA 5HLSA 3G0LA 3QZSA 4O72A 3P1FA 5F61A 4YK0A 4YYMA 5L96A 5HQ5A 5I88A 5HELA 4MEPA 5A5NA 4A9EA 5COIA 2RO1A 3AADA 4Y03A 4A9MA 3GG3A 5ENHA 5EPRA 3G0JA 4Z1SA 4A9HA 5E9VA 5FE5A 4O7AA 3P1DA 5JI8A 4IOOA 5DKCA 4LR6A 5CQAA 5E9LA 4UYFB 4LC2A 4N4GA 4RVRA 5DKDA 4Z6HA 5D3HA 3S91A 5FE7A 3MB3A 5ENBA 5F60A 5FFYA 4FLPA 3LQJA 4AKNA 5KTXA 5G4RA 3MXFA 5FH7A 2YW5A 5I29A 5FG4A 2G4AA 4IR5A 5KHMA 2I7KA 5I7XA 3I3JA 2L85A 4XUAA 4IR3A 4QY4A 4YBTA 4Z93A 4HXRA 4NR8A 5IIDA 4PCEA 4N3WA 3MB4A 5C7NA 4TU6A 4IR4A 4NR7A 1F68A 5ENGA 5CUBA 5TCMA 4HBVA 4TT4A 5D3JA 4O78A 4ZC9A 4UYEA 4MR6A 4BW2A 4J1PA 5DYUA 4NYVA 5LKUA 4IOQA 4Q0OA 5DBMA 5AD2A 4PCIA 5CQ8A 5CTLA 4YYJA 4QR4A 5F36A 4YYIA 4N4IA 5F25A 5CUDA 5AMFA 3P5OA 5C87A 3O35A 1N72A 4WHWA 4CUUA 5E0RA 5I40A 5D3LA 3SVFA 4O7CA 5FG6A 3UVXA 1E6IA 5J0DA 4J0RA 5LVQA 4TTEA 2R0YA 3LQIA 2DVQA 2DVSA 4UIYA 3UV2A 3UVWA 4YADA 5HJCA 5CUCA 4ALGA 5FE4A 5EICA 4O74A 5FE3A 5IG6A 4LYWA 4ZQLA 5CS8A 3AQAA 5EV9A 1ZS5A 4PKLA 4XY9A 5DW1A 4LZRA 4XYAA 4YH3A 2YEKA 4NR9A 1WUGA 5KO4A 2YYNA 4QSTA 5A7CA 4QUTA 4A9IA 4J3IA 5FE0A 2DVRA 4UYGA 4IORA 4QSPA 4NUCA 4HXPA 5FB1A 5FBXA 4C67A 5A5SA 2L5EA 4QC1A 3HMEA 4QC3A 4LZ2A 2OO1A 4BW4A 4NS5A 4N4FA 2YELA 1JM4B 3ONIA 2R10A 2YDWA 2OUOA 4O7BA 1JSPB 5L8UA 5EWCA 5HQ6A 2DATA 3U5PA 4X2IA 5CQ5A 2GRCA 4O76A 4NR4A 5EM3A 5DX4A 5BT5A 4OGIA 3O37A 5FG5A 4O7FA 3Q2EA 5CUAA 5I86A 3TLPA 5I1QA 4NR5A 4QR5A 5E73A 2RI7A 4YYNA 2RNWA 5D3NA 2RNXA 4NRAA 5H85A 5II2A 4QEUA 5D3RA 5EP7A 4LDFA 2F6JA 5IGKA 2DWWA 4J0SA 4NRBA 4HXSA 5EPBA 4HXLA 2LSPB 5EU1A 5CY9A 5E9KA 2DKWA 5K29A 3LXJA 3IU5A 5H1VA 4KV4A 2R0VA 5A5RA 5LKTA 5LVRA 5TB6A 2E3KA 5DFCA 4YBMA 2YQDA 3HMHA 2D82A 4HBYA 5HM0A 2FSAA 4ALHA 5I89A 5DYXA 4UITA 5HEMA 4YH4A 5FE6A 4NYWA 4CURA 5F5ZA 5EWWA 4QSQA 2R0SA 2RNYA 5DFDA 2N9GA 2YEMA 4TYLA 5FFVA 5A5QA 3QZVA 3MQMA 4YABA 4F3IA 4BJXA 4A9KA 4BW3A 5CQTA 5L98A 3JVJA 5EWDA 2MJVB 4YY6A 4YYGA 2DVVA 5F3AA 4UIXA 4QZSA 2OSSA 3UVDA 4KCXA 2KTBB 5HFRA 4O75A 4QSRA 4Q0NA 4UIUA 5KU3A 5FE8A 5FH8A 4XUBA 5FE1A 4QSWA 4TZ8A 4QUUA 5KTWA 3JVLA 4BHWA 3Q2FA 3U5JA 1X0JA 4CUQA 4NUEA 5I83A 4MENA 5ETDA 5EQ1A 5II1A 4YATA 5HRVA 5BT4A 5DY7A 5CUGA 5HRWA 4QNSA 5D3PA 5D24A 3UVYA 5E9IA 3UV5A 2RS9B 4HXMA 5KTUA 5DFBA 5A82A 5A5PA 4LYIA
chains in the Genus database with same CATH superfamily
4MEOA 5BT3A 5L97A 4WIVA 5IBNA 4A9FA 4C66A 4NQMA 5EPSA 3IU6A 5ENJA 4CLBA 3D1BA 5CFWA 5JWMA 5CQ7A 3U5LA 3ZYUA 5IGLA 4E96A 4LZSA 5I80A 5A83A 4QSVA 4Z6IA 3FKMX 4HBXA 4UIVA 2E7NA 4TQNA 4QYDA 5C4QA 4TT2A 2RFJA 4A9JA 4YYKA 5CRZA 3U5KA 4PS5A 1PUOA 4NUDA 4UYDA 4OGJA 3U5NA 4YY4A 2NXBA 4QSUA 5D3TA 3P1CA 4YC9A 2WP2A 4GPJA 2E7OA 3NXBA 4OUFA 5E3DA 5LKXA 5L99A 5C89A 4TZ2A 3S92A 4O77A 5H1UA 3JVKA 5ETBA 4O7EA 4AI6A 4YAXA 1WUMA 3O36A 4HXOA 5EWVA 4YBSA 5CP5A 4CUPA 4DONA 4QEWA 5HQ7A 5D7XA 5HFQA 4UIWA 4CUSA 5D25A 3U5MA 5CQ4A 5EVAA 5DLXA 3O33A 5D3SA 3QZTA 5DW2A 5ENFA 5DKHA 5CQ6A 4HBWA 5ACYA 2F6NA 4KV1A 5DYCA 5CUEA 4Z1QA 4A9LA 2L84A 4QSXA 4QSSA 5CPEA 5FE2A 5HENA 4MR4A 5D0CA 5F1HA 2D9EA 4CUTA 5DYAA 3HMFA 4BW1A 5ENIA 4XY8A 4MEQA 3LQHA 3K2JA 3O34A 5CU8A 4A9NA 4UIZA 5C85A 4NYXA 5L8TA 5IGNA 4N4HA 3UV4A 5H1TA 4QB3A 5EWHA 5EA1A 5HRXA 3DWYA 1EQFA 5LKZA 5EI4A 5LJ0A 4LRGA 4QEVA 5E9MA 5E7DA 5A5OA 4UYFA 5FE9A 4NR6A 5D26A 4TU4A 4O71A 4TS8A 3D7CA 5EISA 4NQNA 5LJ2A 4NXJA 3LJWA 4YYDA 2H60A 5FFWA 5CRMA 5F62A 4PY6A 5A85A 4CFKA 3SVHA 2WP1A 4QYLA 5C8GA 5FDZA 3P1EA 4MR3A 5A81A 4IR6A 5F63A 4YYHA 5F2PA 3JVMA 3UW9A 4NRCA 5FB0A 5IGMA 4PTBA 5F1LA 5LJ1A 5EGUA 5CZGA 4O70A 5E3GA 5FH6A 3MUKA 4QR3A 4CL9A 5AMEA 5E9YA 2I8NA 4LYSA 5E74A 5ENCA 4TT6A 3RCWA 3SVGA 3U5OA 5HCLA 3DAIA 4CFLA 5CQ3A 3MULA 4UYHA 5G4SA 3VKGA 5I7YA 4HXNA 4WHUA 5DLZA 4A9OA 5EK9A 5LUUA 4QBMA 4ZW1A 4HXKA 5ENEA 5AD3A 4MR5A 5CGPA 5HLSA 3G0LA 3QZSA 4O72A 3P1FA 5F61A 4YK0A 4YYMA 5L96A 5HQ5A 5I88A 5HELA 4MEPA 5A5NA 4A9EA 5COIA 2RO1A 3AADA 4Y03A 4A9MA 3GG3A 5ENHA 5EPRA 3G0JA 4Z1SA 4A9HA 5E9VA 5FE5A 4O7AA 3P1DA 5JI8A 4IOOA 5DKCA 4LR6A 5CQAA 5E9LA 4UYFB 4LC2A 4N4GA 4RVRA 5DKDA 4Z6HA 5D3HA 3S91A 5FE7A 3MB3A 5ENBA 5F60A 5FFYA 4FLPA 3LQJA 4AKNA 5KTXA 5G4RA 4AKHA 3MXFA 5FH7A 2YW5A 5I29A 5FG4A 2G4AA 4IR5A 5KHMA 2I7KA 5I7XA 3I3JA 2L85A 4XUAA 4IR3A 4QY4A 4YBTA 4Z93A 4HXRA 4NR8A 5IIDA 4PCEA 4N3WA 3MB4A 3D1DA 5C7NA 4TU6A 4IR4A 4NR7A 1F68A 5ENGA 5CUBA 5TCMA 4HBVA 4TT4A 5D3JA 4O78A 4ZC9A 4UYEA 4MR6A 1ZKRA 4BW2A 4J1PA 5DYUA 4NYVA 5LKUA 4IOQA 4Q0OA 2EJNA 5DBMA 5AD2A 4PCIA 5CQ8A 5CTLA 4YYJA 3VKHA 4QR4A 5F36A 4YYIA 4N4IA 5F25A 5CUDA 5AMFA 3P5OA 5C87A 3O35A 1N72A 4WHWA 4CUUA 5E0RA 5I40A 5D3LA 3SVFA 4O7CA 5FG6A 3UVXA 1E6IA 5J0DA 4J0RA 5LVQA 4TTEA 2R0YA 3LQIA 2DVQA 2DVSA 4UIYA 3UV2A 3UVWA 4YADA 5HJCA 5CUCA 4ALGA 5FE4A 5EICA 4O74A 5FE3A 5IG6A 4LYWA 4ZQLA 5CS8A 3AQAA 5EV9A 1ZS5A 4PKLA 4XY9A 5DW1A 4LZRA 4XYAA 4YH3A 2YEKA 4NR9A 1WUGA 5KO4A 2YYNA 4QSTA 5A7CA 4QUTA 4A9IA 4J3IA 5FE0A 2DVRA 4UYGA 4IORA 4QSPA 4NUCA 4HXPA 5FB1A 5FBXA 4C67A 5A5SA 2L5EA 4QC1A 3HMEA 4QC3A 4LZ2A 2OO1A 4BW4A 4NS5A 4N4FA 2YELA 1JM4B 3ONIA 2R10A 2YDWA 2OUOA 4O7BA 1JSPB 5L8UA 5EWCA 5HQ6A 2DATA 3U5PA 4X2IA 5CQ5A 2GRCA 4O76A 4NR4A 5EM3A 5DX4A 5BT5A 4OGIA 3O37A 5FG5A 4O7FA 3Q2EA 5CUAA 5I86A 3TLPA 5I1QA 4AKIA 4NR5A 4QR5A 5E73A 2RI7A 4YYNA 2RNWA 5D3NA 2RNXA 4NRAA 5H85A 5II2A 4QEUA 5D3RA 5EP7A 4LDFA 2F6JA 5IGKA 2DWWA 4J0SA 4NRBA 4HXSA 5EPBA 4HXLA 2LSPB 5EU1A 5CY9A 5E9KA 2DKWA 5K29A 3LXJA 3IU5A 5H1VA 4KV4A 2R0VA 5A5RA 5LKTA 5LVRA 5TB6A 2E3KA 5DFCA 4YBMA 2YQDA 3HMHA 2D82A 4HBYA 5HM0A 2FSAA 4ALHA 5I89A 5DYXA 4UITA 5HEMA 4YH4A 5FE6A 4NYWA 4CURA 5F5ZA 5EWWA 4QSQA 2R0SA 2RNYA 5DFDA 2N9GA 2YEMA 4TYLA 5FFVA 5A5QA 3QZVA 3MQMA 4YABA 4F3IA 4BJXA 4A9KA 4BW3A 5CQTA 5L98A 3JVJA 5EWDA 2MJVB 4YY6A 4YYGA 3ERRA 2DVVA 5F3AA 4UIXA 4QZSA 2OSSA 3UVDA 4KCXA 2KTBB 5HFRA 4O75A 4QSRA 4Q0NA 4UIUA 4AKGA 5KU3A 5FE8A 5FH8A 4XUBA 5FE1A 4QSWA 4TZ8A 4QUUA 5KTWA 3JVLA 4BHWA 3Q2FA 3U5JA 1X0JA 4CUQA 4NUEA 5I83A 4MENA 5ETDA 5EQ1A 5II1A 4YATA 5HRVA 5BT4A 5DY7A 5CUGA 5HRWA 4QNSA 5D3PA 5D24A 3UVYA 5E9IA 3UV5A 2RS9B 4HXMA 5KTUA 5DFBA 5A82A 5A5PA 4LYIA
chains in the Genus database with same CATH topology
4MEOA 5BT3A 5L97A 4WIVA 5IBNA 4A9FA 4C66A 4NQMA 5EPSA 3IU6A 5ENJA 4CLBA 5CFWA 5JWMA 5CQ7A 3U5LA 3ZYUA 5IGLA 4E96A 4LZSA 5I80A 5A83A 4QSVA 4Z6IA 3FKMX 4HBXA 4UIVA 2E7NA 4TQNA 4QYDA 5C4QA 4TT2A 2RFJA 4A9JA 4YYKA 5CRZA 3U5KA 4PS5A 4NUDA 4UYDA 4OGJA 3U5NA 4YY4A 2NXBA 4QSUA 5D3TA 3P1CA 4YC9A 2WP2A 4GPJA 2E7OA 3NXBA 4OUFA 5E3DA 5LKXA 5L99A 5C89A 4TZ2A 3S92A 4O77A 5H1UA 3JVKA 5ETBA 4O7EA 4YAXA 1WUMA 3O36A 4HXOA 5EWVA 4YBSA 5CP5A 4CUPA 4DONA 4QEWA 5HQ7A 5D7XA 5HFQA 4UIWA 4CUSA 5D25A 3U5MA 5CQ4A 5EVAA 5DLXA 3O33A 5D3SA 3QZTA 5DW2A 5ENFA 5DKHA 5CQ6A 4HBWA 5ACYA 2F6NA 4KV1A 5DYCA 5CUEA 4Z1QA 4A9LA 2L84A 4QSXA 4QSSA 5CPEA 5FE2A 5HENA 4MR4A 5D0CA 5F1HA 2D9EA 4CUTA 5DYAA 3HMFA 4BW1A 5ENIA 4XY8A 4MEQA 3LQHA 3K2JA 3O34A 5CU8A 4A9NA 4UIZA 5C85A 4NYXA 5L8TA 5IGNA 4N4HA 3UV4A 5H1TA 4QB3A 5EWHA 5EA1A 5HRXA 3DWYA 1EQFA 5LKZA 5EI4A 5LJ0A 4LRGA 4QEVA 5E9MA 5E7DA 5A5OA 4UYFA 5FE9A 4NR6A 5D26A 4TU4A 4O71A 4TS8A 3D7CA 5EISA 4NQNA 5LJ2A 4NXJA 3LJWA 4YYDA 2H60A 5FFWA 5CRMA 5F62A 4PY6A 5A85A 4CFKA 3SVHA 2WP1A 4QYLA 5C8GA 5FDZA 3P1EA 4MR3A 5A81A 4IR6A 5F63A 4YYHA 5F2PA 3JVMA 3UW9A 4NRCA 5FB0A 5IGMA 4PTBA 5F1LA 5LJ1A 5EGUA 5CZGA 4O70A 5E3GA 5FH6A 3MUKA 4QR3A 4CL9A 5AMEA 5E9YA 2I8NA 4LYSA 5E74A 5ENCA 4TT6A 3RCWA 3SVGA 3U5OA 5HCLA 3DAIA 4CFLA 5CQ3A 3MULA 4UYHA 5G4SA 5I7YA 4HXNA 4WHUA 5DLZA 4A9OA 5EK9A 5LUUA 4QBMA 4ZW1A 4HXKA 5ENEA 5AD3A 4MR5A 5CGPA 5HLSA 3G0LA 3QZSA 4O72A 3P1FA 5F61A 4YK0A 4YYMA 5L96A 5HQ5A 5I88A 5HELA 4MEPA 5A5NA 4A9EA 5COIA 2RO1A 3AADA 4Y03A 4A9MA 3GG3A 5ENHA 5EPRA 3G0JA 4Z1SA 4A9HA 5E9VA 5FE5A 4O7AA 3P1DA 5JI8A 4IOOA 5DKCA 4LR6A 5CQAA 5E9LA 4UYFB 4LC2A 4N4GA 4RVRA 5DKDA 4Z6HA 5D3HA 3S91A 5FE7A 3MB3A 5ENBA 5F60A 5FFYA 4FLPA 3LQJA 4AKNA 5KTXA 5G4RA 3MXFA 5FH7A 2YW5A 5I29A 5FG4A 2G4AA 4IR5A 5KHMA 2I7KA 5I7XA 3I3JA 2L85A 4XUAA 4IR3A 4QY4A 4YBTA 4Z93A 4HXRA 4NR8A 5IIDA 4PCEA 4N3WA 3MB4A 5C7NA 4TU6A 4IR4A 4NR7A 1F68A 5ENGA 5CUBA 5TCMA 4HBVA 4TT4A 5D3JA 4O78A 4ZC9A 4UYEA 4MR6A 4BW2A 4J1PA 5DYUA 4NYVA 5LKUA 4IOQA 4Q0OA 5DBMA 5AD2A 4PCIA 5CQ8A 5CTLA 4YYJA 4QR4A 5F36A 4YYIA 4N4IA 5F25A 5CUDA 5AMFA 3P5OA 5C87A 3O35A 1N72A 4WHWA 4CUUA 5E0RA 5I40A 5D3LA 3SVFA 4O7CA 5FG6A 3UVXA 1E6IA 5J0DA 4J0RA 5LVQA 4TTEA 2R0YA 3LQIA 2DVQA 2DVSA 4UIYA 3UV2A 3UVWA 4YADA 5HJCA 5CUCA 4ALGA 5FE4A 5EICA 4O74A 5FE3A 5IG6A 4LYWA 4ZQLA 5CS8A 3AQAA 5EV9A 1ZS5A 4PKLA 4XY9A 5DW1A 4LZRA 4XYAA 4YH3A 2YEKA 4NR9A 1WUGA 5KO4A 2YYNA 4QSTA 5A7CA 4QUTA 4A9IA 4J3IA 5FE0A 2DVRA 4UYGA 4IORA 4QSPA 4NUCA 4HXPA 5FB1A 5FBXA 4C67A 5A5SA 2L5EA 4QC1A 3HMEA 4QC3A 4LZ2A 2OO1A 4BW4A 4NS5A 4N4FA 2YELA 1JM4B 3ONIA 2R10A 2YDWA 2OUOA 4O7BA 1JSPB 5L8UA 5EWCA 5HQ6A 2DATA 3U5PA 4X2IA 5CQ5A 2GRCA 4O76A 4NR4A 5EM3A 5DX4A 5BT5A 4OGIA 3O37A 5FG5A 4O7FA 3Q2EA 5CUAA 5I86A 3TLPA 5I1QA 4NR5A 4QR5A 5E73A 2RI7A 4YYNA 2RNWA 5D3NA 2RNXA 4NRAA 5H85A 5II2A 4QEUA 5D3RA 5EP7A 4LDFA 2F6JA 5IGKA 2DWWA 4J0SA 4NRBA 4HXSA 5EPBA 4HXLA 2LSPB 5EU1A 5CY9A 5E9KA 2DKWA 5K29A 3LXJA 3IU5A 5H1VA 4KV4A 2R0VA 5A5RA 5LKTA 5LVRA 5TB6A 2E3KA 5DFCA 4YBMA 2YQDA 3HMHA 2D82A 4HBYA 5HM0A 2FSAA 4ALHA 5I89A 5DYXA 4UITA 5HEMA 4YH4A 5FE6A 4NYWA 4CURA 5F5ZA 5EWWA 4QSQA 2R0SA 2RNYA 5DFDA 2N9GA 2YEMA 4TYLA 5FFVA 5A5QA 3QZVA 3MQMA 4YABA 4F3IA 4BJXA 4A9KA 4BW3A 5CQTA 5L98A 3JVJA 5EWDA 2MJVB 4YY6A 4YYGA 2DVVA 5F3AA 4UIXA 4QZSA 2OSSA 3UVDA 4KCXA 2KTBB 5HFRA 4O75A 4QSRA 4Q0NA 4UIUA 5KU3A 5FE8A 5FH8A 4XUBA 5FE1A 4QSWA 4TZ8A 4QUUA 5KTWA 3JVLA 4BHWA 3Q2FA 3U5JA 1X0JA 4CUQA 4NUEA 5I83A 4MENA 5ETDA 5EQ1A 5II1A 4YATA 5HRVA 5BT4A 5DY7A 5CUGA 5HRWA 4QNSA 5D3PA 5D24A 3UVYA 5E9IA 3UV5A 2RS9B 4HXMA 5KTUA 5DFBA 5A82A 5A5PA 4LYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEO A;  5BT3 A;  5L97 A;  4WIV A;  5IBN A;  4A9F A;  4C66 A;  4NQM A;  5EPS A;  3IU6 A;  5ENJ A;  4CLB A;  5CFW A;  5JWM A;  5CQ7 A;  3U5L A;  3ZYU A;  5IGL A;  4E96 A;  4LZS A;  5I80 A;  5A83 A;  4QSV A;  4Z6I A;  3FKM X;  4HBX A;  4UIV A;  2E7N A;  4TQN A;  4QYD A;  5C4Q A;  4TT2 A;  2RFJ A;  4A9J A;  4YYK A;  5CRZ A;  3U5K A;  4PS5 A;  4NUD A;  4UYD A;  4OGJ A;  3U5N A;  4YY4 A;  2NXB A;  4QSU A;  5D3T A;  3P1C A;  4YC9 A;  2WP2 A;  4GPJ A;  2E7O A;  3NXB A;  4OUF A;  5E3D A;  5LKX A;  5L99 A;  5C89 A;  4TZ2 A;  3S92 A;  4O77 A;  5H1U A;  3JVK A;  5ETB A;  4O7E A;  4YAX A;  1WUM A;  3O36 A;  4HXO A;  5EWV A;  4YBS A;  5CP5 A;  4CUP A;  4DON A;  4QEW A;  5HQ7 A;  5D7X A;  5HFQ A;  4UIW A;  4CUS A;  5D25 A;  3U5M A;  5CQ4 A;  5EVA A;  5DLX A;  3O33 A;  5D3S A;  3QZT A;  5DW2 A;  5ENF A;  5DKH A;  5CQ6 A;  4HBW A;  5ACY A;  2F6N A;  4KV1 A;  5DYC A;  5CUE A;  4Z1Q A;  4A9L A;  2L84 A;  4QSX A;  4QSS A;  5CPE A;  5FE2 A;  5HEN A;  4MR4 A;  5D0C A;  5F1H A;  2D9E A;  4CUT A;  5DYA A;  3HMF A;  4BW1 A;  5ENI A;  4XY8 A;  4MEQ A;  3LQH A;  3K2J A;  3O34 A;  5CU8 A;  4A9N A;  4UIZ A;  5C85 A;  4NYX A;  5L8T A;  5IGN A;  4N4H A;  3UV4 A;  5H1T A;  4QB3 A;  5EWH A;  5EA1 A;  5HRX A;  3DWY A;  1EQF A;  5LKZ A;  5EI4 A;  5LJ0 A;  4LRG A;  4QEV A;  5E9M A;  5E7D A;  5A5O A;  4UYF A;  5FE9 A;  4NR6 A;  5D26 A;  4TU4 A;  4O71 A;  4TS8 A;  3D7C A;  5EIS A;  4NQN A;  5LJ2 A;  4NXJ A;  3LJW A;  4YYD A;  2H60 A;  5FFW A;  5CRM A;  5F62 A;  4PY6 A;  5A85 A;  4CFK A;  3SVH A;  2WP1 A;  4QYL A;  5C8G A;  5FDZ A;  3P1E A;  4MR3 A;  5A81 A;  4IR6 A;  5F63 A;  4YYH A;  5F2P A;  3JVM A;  3UW9 A;  4NRC A;  5FB0 A;  5IGM A;  4PTB A;  5F1L A;  5LJ1 A;  5EGU A;  5CZG A;  4O70 A;  5E3G A;  5FH6 A;  3MUK A;  4QR3 A;  4CL9 A;  5AME A;  5E9Y A;  2I8N A;  4LYS A;  5E74 A;  5ENC A;  4TT6 A;  3RCW A;  3SVG A;  3U5O A;  5HCL A;  3DAI A;  4CFL A;  5CQ3 A;  3MUL A;  4UYH A;  5G4S A;  5I7Y A;  4HXN A;  4WHU A;  5DLZ A;  4A9O A;  5EK9 A;  5LUU A;  4QBM A;  4ZW1 A;  4HXK A;  5ENE A;  5AD3 A;  4MR5 A;  5CGP A;  5HLS A;  3G0L A;  3QZS A;  4O72 A;  3P1F A;  5F61 A;  4YK0 A;  4YYM A;  5L96 A;  5HQ5 A;  5I88 A;  5HEL A;  4MEP A;  5A5N A;  4A9E A;  5COI A;  2RO1 A;  3AAD A;  4Y03 A;  4A9M A;  3GG3 A;  5ENH A;  5EPR A;  3G0J A;  4Z1S A;  4A9H A;  5E9V A;  5FE5 A;  4O7A A;  3P1D A;  5JI8 A;  4IOO A;  5DKC A;  4LR6 A;  5CQA A;  5E9L A;  4UYF B;  4LC2 A;  4N4G A;  4RVR A;  5DKD A;  4Z6H A;  5D3H A;  3S91 A;  5FE7 A;  3MB3 A;  5ENB A;  5F60 A;  5FFY A;  4FLP A;  3LQJ A;  4AKN A;  5KTX A;  5G4R A;  3MXF A;  5FH7 A;  2YW5 A;  5I29 A;  5FG4 A;  2G4A A;  4IR5 A;  5KHM A;  2I7K A;  5I7X A;  3I3J A;  2L85 A;  4XUA A;  4IR3 A;  4QY4 A;  4YBT A;  4Z93 A;  4HXR A;  4NR8 A;  5IID A;  4PCE A;  4N3W A;  3MB4 A;  5C7N A;  4TU6 A;  4IR4 A;  4NR7 A;  1F68 A;  5ENG A;  5CUB A;  5TCM A;  4HBV A;  4TT4 A;  5D3J A;  4O78 A;  4ZC9 A;  4UYE A;  4MR6 A;  4BW2 A;  4J1P A;  5DYU A;  4NYV A;  5LKU A;  4IOQ A;  4Q0O A;  5DBM A;  5AD2 A;  4PCI A;  5CQ8 A;  5CTL A;  4YYJ A;  4QR4 A;  5F36 A;  4YYI A;  4N4I A;  5F25 A;  5CUD A;  5AMF A;  3P5O A;  5C87 A;  3O35 A;  1N72 A;  4WHW A;  4CUU A;  5E0R A;  5I40 A;  5D3L A;  3SVF A;  4O7C A;  5FG6 A;  3UVX A;  1E6I A;  5J0D A;  4J0R A;  5LVQ A;  4TTE A;  2R0Y A;  3LQI A;  2DVQ A;  2DVS A;  4UIY A;  3UV2 A;  3UVW A;  4YAD A;  5HJC A;  5CUC A;  4ALG A;  5FE4 A;  5EIC A;  4O74 A;  5FE3 A;  5IG6 A;  4LYW A;  4ZQL A;  5CS8 A;  3AQA A;  5EV9 A;  1ZS5 A;  4PKL A;  4XY9 A;  5DW1 A;  4LZR A;  4XYA A;  4YH3 A;  2YEK A;  4NR9 A;  1WUG A;  5KO4 A;  2YYN A;  4QST A;  5A7C A;  4QUT A;  4A9I A;  4J3I A;  5FE0 A;  2DVR A;  4UYG A;  4IOR A;  4QSP A;  4NUC A;  4HXP A;  5FB1 A;  5FBX A;  4C67 A;  5A5S A;  2L5E A;  4QC1 A;  3HME A;  4QC3 A;  4LZ2 A;  2OO1 A;  4BW4 A;  4NS5 A;  4N4F A;  2YEL A;  1JM4 B;  3ONI A;  2R10 A;  2YDW A;  2OUO A;  4O7B A;  1JSP B;  5L8U A;  5EWC A;  5HQ6 A;  2DAT A;  3U5P A;  4X2I A;  5CQ5 A;  2GRC A;  4O76 A;  4NR4 A;  5EM3 A;  5DX4 A;  5BT5 A;  4OGI A;  3O37 A;  5FG5 A;  4O7F A;  3Q2E A;  5CUA A;  5I86 A;  3TLP A;  5I1Q A;  4NR5 A;  4QR5 A;  5E73 A;  2RI7 A;  4YYN A;  2RNW A;  5D3N A;  2RNX A;  4NRA A;  5H85 A;  5II2 A;  4QEU A;  5D3R A;  5EP7 A;  4LDF A;  2F6J A;  5IGK A;  2DWW A;  4J0S A;  4NRB A;  4HXS A;  5EPB A;  4HXL A;  2LSP B;  5EU1 A;  5CY9 A;  5E9K A;  2DKW A;  5K29 A;  3LXJ A;  3IU5 A;  5H1V A;  4KV4 A;  2R0V A;  5A5R A;  5LKT A;  5LVR A;  5TB6 A;  2E3K A;  5DFC A;  4YBM A;  2YQD A;  3HMH A;  2D82 A;  4HBY A;  5HM0 A;  2FSA A;  4ALH A;  5I89 A;  5DYX A;  4UIT A;  5HEM A;  4YH4 A;  5FE6 A;  4NYW A;  4CUR A;  5F5Z A;  5EWW A;  4QSQ A;  2R0S A;  2RNY A;  5DFD A;  2N9G A;  2YEM A;  4TYL A;  5FFV A;  5A5Q A;  3QZV A;  3MQM A;  4YAB A;  4F3I A;  4BJX A;  4A9K A;  4BW3 A;  5CQT A;  5L98 A;  3JVJ A;  5EWD A;  2MJV B;  4YY6 A;  4YYG A;  2DVV A;  5F3A A;  4UIX A;  4QZS A;  2OSS A;  3UVD A;  4KCX A;  2KTB B;  5HFR A;  4O75 A;  4QSR A;  4Q0N A;  4UIU A;  5KU3 A;  5FE8 A;  5FH8 A;  4XUB A;  5FE1 A;  4QSW A;  4TZ8 A;  4QUU A;  5KTW A;  3JVL A;  4BHW A;  3Q2F A;  3U5J A;  1X0J A;  4CUQ A;  4NUE A;  5I83 A;  4MEN A;  5ETD A;  5EQ1 A;  5II1 A;  4YAT A;  5HRV A;  5BT4 A;  5DY7 A;  5CUG A;  5HRW A;  4QNS A;  5D3P A;  5D24 A;  3UVY A;  5E9I A;  3UV5 A;  2RS9 B;  4HXM A;  5KTU A;  5DFB A;  5A82 A;  5A5P A;  4LYI A; 
#chains in the Genus database with same CATH topology
 4MEO A;  5BT3 A;  5L97 A;  4WIV A;  5IBN A;  4A9F A;  4C66 A;  4NQM A;  5EPS A;  3IU6 A;  5ENJ A;  4CLB A;  3D1B A;  5CFW A;  5JWM A;  5CQ7 A;  3U5L A;  3ZYU A;  5IGL A;  4E96 A;  4LZS A;  5I80 A;  5A83 A;  4QSV A;  4Z6I A;  3FKM X;  4HBX A;  4UIV A;  2E7N A;  4TQN A;  4QYD A;  5C4Q A;  4TT2 A;  2RFJ A;  4A9J A;  4YYK A;  5CRZ A;  3U5K A;  4PS5 A;  1PUO A;  4NUD A;  4UYD A;  4OGJ A;  3U5N A;  4YY4 A;  2NXB A;  4QSU A;  5D3T A;  3P1C A;  4YC9 A;  2WP2 A;  4GPJ A;  2E7O A;  3NXB A;  4OUF A;  5E3D A;  5LKX A;  5L99 A;  5C89 A;  4TZ2 A;  3S92 A;  4O77 A;  5H1U A;  3JVK A;  5ETB A;  4O7E A;  4AI6 A;  4YAX A;  1WUM A;  3O36 A;  4HXO A;  5EWV A;  4YBS A;  5CP5 A;  4CUP A;  4DON A;  4QEW A;  5HQ7 A;  5D7X A;  5HFQ A;  4UIW A;  4CUS A;  5D25 A;  3U5M A;  5CQ4 A;  5EVA A;  5DLX A;  3O33 A;  5D3S A;  3QZT A;  5DW2 A;  5ENF A;  5DKH A;  5CQ6 A;  4HBW A;  5ACY A;  2F6N A;  4KV1 A;  5DYC A;  5CUE A;  4Z1Q A;  4A9L A;  2L84 A;  4QSX A;  4QSS A;  5CPE A;  5FE2 A;  5HEN A;  4MR4 A;  5D0C A;  5F1H A;  2D9E A;  4CUT A;  5DYA A;  3HMF A;  4BW1 A;  5ENI A;  4XY8 A;  4MEQ A;  3LQH A;  3K2J A;  3O34 A;  5CU8 A;  4A9N A;  4UIZ A;  5C85 A;  4NYX A;  5L8T A;  5IGN A;  4N4H A;  3UV4 A;  5H1T A;  4QB3 A;  5EWH A;  5EA1 A;  5HRX A;  3DWY A;  1EQF A;  5LKZ A;  5EI4 A;  5LJ0 A;  4LRG A;  4QEV A;  5E9M A;  5E7D A;  5A5O A;  4UYF A;  5FE9 A;  4NR6 A;  5D26 A;  4TU4 A;  4O71 A;  4TS8 A;  3D7C A;  5EIS A;  4NQN A;  5LJ2 A;  4NXJ A;  3LJW A;  4YYD A;  2H60 A;  5FFW A;  5CRM A;  5F62 A;  4PY6 A;  5A85 A;  4CFK A;  3SVH A;  2WP1 A;  4QYL A;  5C8G A;  5FDZ A;  3P1E A;  4MR3 A;  5A81 A;  4IR6 A;  5F63 A;  4YYH A;  5F2P A;  3JVM A;  3UW9 A;  4NRC A;  5FB0 A;  5IGM A;  4PTB A;  5F1L A;  5LJ1 A;  5EGU A;  5CZG A;  4O70 A;  5E3G A;  5FH6 A;  3MUK A;  4QR3 A;  4CL9 A;  5AME A;  5E9Y A;  2I8N A;  4LYS A;  5E74 A;  5ENC A;  4TT6 A;  3RCW A;  3SVG A;  3U5O A;  5HCL A;  3DAI A;  4CFL A;  5CQ3 A;  3MUL A;  4UYH A;  5G4S A;  3VKG A;  5I7Y A;  4HXN A;  4WHU A;  5DLZ A;  4A9O A;  5EK9 A;  5LUU A;  4QBM A;  4ZW1 A;  4HXK A;  5ENE A;  5AD3 A;  4MR5 A;  5CGP A;  5HLS A;  3G0L A;  3QZS A;  4O72 A;  3P1F A;  5F61 A;  4YK0 A;  4YYM A;  5L96 A;  5HQ5 A;  5I88 A;  5HEL A;  4MEP A;  5A5N A;  4A9E A;  5COI A;  2RO1 A;  3AAD A;  4Y03 A;  4A9M A;  3GG3 A;  5ENH A;  5EPR A;  3G0J A;  4Z1S A;  4A9H A;  5E9V A;  5FE5 A;  4O7A A;  3P1D A;  5JI8 A;  4IOO A;  5DKC A;  4LR6 A;  5CQA A;  5E9L A;  4UYF B;  4LC2 A;  4N4G A;  4RVR A;  5DKD A;  4Z6H A;  5D3H A;  3S91 A;  5FE7 A;  3MB3 A;  5ENB A;  5F60 A;  5FFY A;  4FLP A;  3LQJ A;  4AKN A;  5KTX A;  5G4R A;  4AKH A;  3MXF A;  5FH7 A;  2YW5 A;  5I29 A;  5FG4 A;  2G4A A;  4IR5 A;  5KHM A;  2I7K A;  5I7X A;  3I3J A;  2L85 A;  4XUA A;  4IR3 A;  4QY4 A;  4YBT A;  4Z93 A;  4HXR A;  4NR8 A;  5IID A;  4PCE A;  4N3W A;  3MB4 A;  3D1D A;  5C7N A;  4TU6 A;  4IR4 A;  4NR7 A;  1F68 A;  5ENG A;  5CUB A;  5TCM A;  4HBV A;  4TT4 A;  5D3J A;  4O78 A;  4ZC9 A;  4UYE A;  4MR6 A;  1ZKR A;  4BW2 A;  4J1P A;  5DYU A;  4NYV A;  5LKU A;  4IOQ A;  4Q0O A;  2EJN A;  5DBM A;  5AD2 A;  4PCI A;  5CQ8 A;  5CTL A;  4YYJ A;  3VKH A;  4QR4 A;  5F36 A;  4YYI A;  4N4I A;  5F25 A;  5CUD A;  5AMF A;  3P5O A;  5C87 A;  3O35 A;  1N72 A;  4WHW A;  4CUU A;  5E0R A;  5I40 A;  5D3L A;  3SVF A;  4O7C A;  5FG6 A;  3UVX A;  1E6I A;  5J0D A;  4J0R A;  5LVQ A;  4TTE A;  2R0Y A;  3LQI A;  2DVQ A;  2DVS A;  4UIY A;  3UV2 A;  3UVW A;  4YAD A;  5HJC A;  5CUC A;  4ALG A;  5FE4 A;  5EIC A;  4O74 A;  5FE3 A;  5IG6 A;  4LYW A;  4ZQL A;  5CS8 A;  3AQA A;  5EV9 A;  1ZS5 A;  4PKL A;  4XY9 A;  5DW1 A;  4LZR A;  4XYA A;  4YH3 A;  2YEK A;  4NR9 A;  1WUG A;  5KO4 A;  2YYN A;  4QST A;  5A7C A;  4QUT A;  4A9I A;  4J3I A;  5FE0 A;  2DVR A;  4UYG A;  4IOR A;  4QSP A;  4NUC A;  4HXP A;  5FB1 A;  5FBX A;  4C67 A;  5A5S A;  2L5E A;  4QC1 A;  3HME A;  4QC3 A;  4LZ2 A;  2OO1 A;  4BW4 A;  4NS5 A;  4N4F A;  2YEL A;  1JM4 B;  3ONI A;  2R10 A;  2YDW A;  2OUO A;  4O7B A;  1JSP B;  5L8U A;  5EWC A;  5HQ6 A;  2DAT A;  3U5P A;  4X2I A;  5CQ5 A;  2GRC A;  4O76 A;  4NR4 A;  5EM3 A;  5DX4 A;  5BT5 A;  4OGI A;  3O37 A;  5FG5 A;  4O7F A;  3Q2E A;  5CUA A;  5I86 A;  3TLP A;  5I1Q A;  4AKI A;  4NR5 A;  4QR5 A;  5E73 A;  2RI7 A;  4YYN A;  2RNW A;  5D3N A;  2RNX A;  4NRA A;  5H85 A;  5II2 A;  4QEU A;  5D3R A;  5EP7 A;  4LDF A;  2F6J A;  5IGK A;  2DWW A;  4J0S A;  4NRB A;  4HXS A;  5EPB A;  4HXL A;  2LSP B;  5EU1 A;  5CY9 A;  5E9K A;  2DKW A;  5K29 A;  3LXJ A;  3IU5 A;  5H1V A;  4KV4 A;  2R0V A;  5A5R A;  5LKT A;  5LVR A;  5TB6 A;  2E3K A;  5DFC A;  4YBM A;  2YQD A;  3HMH A;  2D82 A;  4HBY A;  5HM0 A;  2FSA A;  4ALH A;  5I89 A;  5DYX A;  4UIT A;  5HEM A;  4YH4 A;  5FE6 A;  4NYW A;  4CUR A;  5F5Z A;  5EWW A;  4QSQ A;  2R0S A;  2RNY A;  5DFD A;  2N9G A;  2YEM A;  4TYL A;  5FFV A;  5A5Q A;  3QZV A;  3MQM A;  4YAB A;  4F3I A;  4BJX A;  4A9K A;  4BW3 A;  5CQT A;  5L98 A;  3JVJ A;  5EWD A;  2MJV B;  4YY6 A;  4YYG A;  3ERR A;  2DVV A;  5F3A A;  4UIX A;  4QZS A;  2OSS A;  3UVD A;  4KCX A;  2KTB B;  5HFR A;  4O75 A;  4QSR A;  4Q0N A;  4UIU A;  4AKG A;  5KU3 A;  5FE8 A;  5FH8 A;  4XUB A;  5FE1 A;  4QSW A;  4TZ8 A;  4QUU A;  5KTW A;  3JVL A;  4BHW A;  3Q2F A;  3U5J A;  1X0J A;  4CUQ A;  4NUE A;  5I83 A;  4MEN A;  5ETD A;  5EQ1 A;  5II1 A;  4YAT A;  5HRV A;  5BT4 A;  5DY7 A;  5CUG A;  5HRW A;  4QNS A;  5D3P A;  5D24 A;  3UVY A;  5E9I A;  3UV5 A;  2RS9 B;  4HXM A;  5KTU A;  5DFB A;  5A82 A;  5A5P A;  4LYI A; 
#chains in the Genus database with same CATH homology
 4MEO A;  5BT3 A;  5L97 A;  4WIV A;  5IBN A;  4A9F A;  4C66 A;  4NQM A;  5EPS A;  3IU6 A;  5ENJ A;  4CLB A;  5CFW A;  5JWM A;  5CQ7 A;  3U5L A;  3ZYU A;  5IGL A;  4E96 A;  4LZS A;  5I80 A;  5A83 A;  4QSV A;  4Z6I A;  3FKM X;  4HBX A;  4UIV A;  2E7N A;  4TQN A;  4QYD A;  5C4Q A;  4TT2 A;  2RFJ A;  4A9J A;  4YYK A;  5CRZ A;  3U5K A;  4PS5 A;  4NUD A;  4UYD A;  4OGJ A;  3U5N A;  4YY4 A;  2NXB A;  4QSU A;  5D3T A;  3P1C A;  4YC9 A;  2WP2 A;  4GPJ A;  2E7O A;  3NXB A;  4OUF A;  5E3D A;  5LKX A;  5L99 A;  5C89 A;  4TZ2 A;  3S92 A;  4O77 A;  5H1U A;  3JVK A;  5ETB A;  4O7E A;  4YAX A;  1WUM A;  3O36 A;  4HXO A;  5EWV A;  4YBS A;  5CP5 A;  4CUP A;  4DON A;  4QEW A;  5HQ7 A;  5D7X A;  5HFQ A;  4UIW A;  4CUS A;  5D25 A;  3U5M A;  5CQ4 A;  5EVA A;  5DLX A;  3O33 A;  5D3S A;  3QZT A;  5DW2 A;  5ENF A;  5DKH A;  5CQ6 A;  4HBW A;  5ACY A;  2F6N A;  4KV1 A;  5DYC A;  5CUE A;  4Z1Q A;  4A9L A;  2L84 A;  4QSX A;  4QSS A;  5CPE A;  5FE2 A;  5HEN A;  4MR4 A;  5D0C A;  5F1H A;  2D9E A;  4CUT A;  5DYA A;  3HMF A;  4BW1 A;  5ENI A;  4XY8 A;  4MEQ A;  3LQH A;  3K2J A;  3O34 A;  5CU8 A;  4A9N A;  4UIZ A;  5C85 A;  4NYX A;  5L8T A;  5IGN A;  4N4H A;  3UV4 A;  5H1T A;  4QB3 A;  5EWH A;  5EA1 A;  5HRX A;  3DWY A;  1EQF A;  5LKZ A;  5EI4 A;  5LJ0 A;  4LRG A;  4QEV A;  5E9M A;  5E7D A;  5A5O A;  4UYF A;  5FE9 A;  4NR6 A;  5D26 A;  4TU4 A;  4O71 A;  4TS8 A;  3D7C A;  5EIS A;  4NQN A;  5LJ2 A;  4NXJ A;  3LJW A;  4YYD A;  2H60 A;  5FFW A;  5CRM A;  5F62 A;  4PY6 A;  5A85 A;  4CFK A;  3SVH A;  2WP1 A;  4QYL A;  5C8G A;  5FDZ A;  3P1E A;  4MR3 A;  5A81 A;  4IR6 A;  5F63 A;  4YYH A;  5F2P A;  3JVM A;  3UW9 A;  4NRC A;  5FB0 A;  5IGM A;  4PTB A;  5F1L A;  5LJ1 A;  5EGU A;  5CZG A;  4O70 A;  5E3G A;  5FH6 A;  3MUK A;  4QR3 A;  4CL9 A;  5AME A;  5E9Y A;  2I8N A;  4LYS A;  5E74 A;  5ENC A;  4TT6 A;  3RCW A;  3SVG A;  3U5O A;  5HCL A;  3DAI A;  4CFL A;  5CQ3 A;  3MUL A;  4UYH A;  5G4S A;  5I7Y A;  4HXN A;  4WHU A;  5DLZ A;  4A9O A;  5EK9 A;  5LUU A;  4QBM A;  4ZW1 A;  4HXK A;  5ENE A;  5AD3 A;  4MR5 A;  5CGP A;  5HLS A;  3G0L A;  3QZS A;  4O72 A;  3P1F A;  5F61 A;  4YK0 A;  4YYM A;  5L96 A;  5HQ5 A;  5I88 A;  5HEL A;  4MEP A;  5A5N A;  4A9E A;  5COI A;  2RO1 A;  3AAD A;  4Y03 A;  4A9M A;  3GG3 A;  5ENH A;  5EPR A;  3G0J A;  4Z1S A;  4A9H A;  5E9V A;  5FE5 A;  4O7A A;  3P1D A;  5JI8 A;  4IOO A;  5DKC A;  4LR6 A;  5CQA A;  5E9L A;  4UYF B;  4LC2 A;  4N4G A;  4RVR A;  5DKD A;  4Z6H A;  5D3H A;  3S91 A;  5FE7 A;  3MB3 A;  5ENB A;  5F60 A;  5FFY A;  4FLP A;  3LQJ A;  4AKN A;  5KTX A;  5G4R A;  3MXF A;  5FH7 A;  2YW5 A;  5I29 A;  5FG4 A;  2G4A A;  4IR5 A;  5KHM A;  2I7K A;  5I7X A;  3I3J A;  2L85 A;  4XUA A;  4IR3 A;  4QY4 A;  4YBT A;  4Z93 A;  4HXR A;  4NR8 A;  5IID A;  4PCE A;  4N3W A;  3MB4 A;  5C7N A;  4TU6 A;  4IR4 A;  4NR7 A;  1F68 A;  5ENG A;  5CUB A;  5TCM A;  4HBV A;  4TT4 A;  5D3J A;  4O78 A;  4ZC9 A;  4UYE A;  4MR6 A;  4BW2 A;  4J1P A;  5DYU A;  4NYV A;  5LKU A;  4IOQ A;  4Q0O A;  5DBM A;  5AD2 A;  4PCI A;  5CQ8 A;  5CTL A;  4YYJ A;  4QR4 A;  5F36 A;  4YYI A;  4N4I A;  5F25 A;  5CUD A;  5AMF A;  3P5O A;  5C87 A;  3O35 A;  1N72 A;  4WHW A;  4CUU A;  5E0R A;  5I40 A;  5D3L A;  3SVF A;  4O7C A;  5FG6 A;  3UVX A;  1E6I A;  5J0D A;  4J0R A;  5LVQ A;  4TTE A;  2R0Y A;  3LQI A;  2DVQ A;  2DVS A;  4UIY A;  3UV2 A;  3UVW A;  4YAD A;  5HJC A;  5CUC A;  4ALG A;  5FE4 A;  5EIC A;  4O74 A;  5FE3 A;  5IG6 A;  4LYW A;  4ZQL A;  5CS8 A;  3AQA A;  5EV9 A;  1ZS5 A;  4PKL A;  4XY9 A;  5DW1 A;  4LZR A;  4XYA A;  4YH3 A;  2YEK A;  4NR9 A;  1WUG A;  5KO4 A;  2YYN A;  4QST A;  5A7C A;  4QUT A;  4A9I A;  4J3I A;  5FE0 A;  2DVR A;  4UYG A;  4IOR A;  4QSP A;  4NUC A;  4HXP A;  5FB1 A;  5FBX A;  4C67 A;  5A5S A;  2L5E A;  4QC1 A;  3HME A;  4QC3 A;  4LZ2 A;  2OO1 A;  4BW4 A;  4NS5 A;  4N4F A;  2YEL A;  1JM4 B;  3ONI A;  2R10 A;  2YDW A;  2OUO A;  4O7B A;  1JSP B;  5L8U A;  5EWC A;  5HQ6 A;  2DAT A;  3U5P A;  4X2I A;  5CQ5 A;  2GRC A;  4O76 A;  4NR4 A;  5EM3 A;  5DX4 A;  5BT5 A;  4OGI A;  3O37 A;  5FG5 A;  4O7F A;  3Q2E A;  5CUA A;  5I86 A;  3TLP A;  5I1Q A;  4NR5 A;  4QR5 A;  5E73 A;  2RI7 A;  4YYN A;  2RNW A;  5D3N A;  2RNX A;  4NRA A;  5H85 A;  5II2 A;  4QEU A;  5D3R A;  5EP7 A;  4LDF A;  2F6J A;  5IGK A;  2DWW A;  4J0S A;  4NRB A;  4HXS A;  5EPB A;  4HXL A;  2LSP B;  5EU1 A;  5CY9 A;  5E9K A;  2DKW A;  5K29 A;  3LXJ A;  3IU5 A;  5H1V A;  4KV4 A;  2R0V A;  5A5R A;  5LKT A;  5LVR A;  5TB6 A;  2E3K A;  5DFC A;  4YBM A;  2YQD A;  3HMH A;  2D82 A;  4HBY A;  5HM0 A;  2FSA A;  4ALH A;  5I89 A;  5DYX A;  4UIT A;  5HEM A;  4YH4 A;  5FE6 A;  4NYW A;  4CUR A;  5F5Z A;  5EWW A;  4QSQ A;  2R0S A;  2RNY A;  5DFD A;  2N9G A;  2YEM A;  4TYL A;  5FFV A;  5A5Q A;  3QZV A;  3MQM A;  4YAB A;  4F3I A;  4BJX A;  4A9K A;  4BW3 A;  5CQT A;  5L98 A;  3JVJ A;  5EWD A;  2MJV B;  4YY6 A;  4YYG A;  2DVV A;  5F3A A;  4UIX A;  4QZS A;  2OSS A;  3UVD A;  4KCX A;  2KTB B;  5HFR A;  4O75 A;  4QSR A;  4Q0N A;  4UIU A;  5KU3 A;  5FE8 A;  5FH8 A;  4XUB A;  5FE1 A;  4QSW A;  4TZ8 A;  4QUU A;  5KTW A;  3JVL A;  4BHW A;  3Q2F A;  3U5J A;  1X0J A;  4CUQ A;  4NUE A;  5I83 A;  4MEN A;  5ETD A;  5EQ1 A;  5II1 A;  4YAT A;  5HRV A;  5BT4 A;  5DY7 A;  5CUG A;  5HRW A;  4QNS A;  5D3P A;  5D24 A;  3UVY A;  5E9I A;  3UV5 A;  2RS9 B;  4HXM A;  5KTU A;  5DFB A;  5A82 A;  5A5P A;  4LYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...