5ENFA

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with fragment-4 n10142 (sgc - diamond i04-1 fragment screening)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PH-interacting protein
publication title A poised fragment library enables rapid synthetic expansion yielding the first reported inhibitors of PHIP(2), an atypical bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 46
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5enfA00
2DWWA 2YYNA 3O36A 5IGNA 5CY9A 5I80A 4MR3A 4IR5A 4HXKA 4NUDA 2H60A 2I8NA 5II1A 4Z6IA 4MR5A 5CUEA 5L96A 5LVQA 3O33A 5EVAA 4HBVA 4YBMA 3AQAA 5EWHA 5A82A 3JVMA 5C85A 5I7YA 2L84A 4UIYA 3LXJA 5HJCA 5DYCA 4NQNA 5E0RA 4TQNA 5AD3A 4LZRA 4O7FA 5HELA 4ZQLA 4PS5A 4TT4A 4O77A 3JVKA 5CZGA 5HFQA 4NR5A 5D3RA 5CFWA 5F60A 2YW5A 5A5SA 5AMFA 2DATA 3Q2FA 3I3JA 2R0SA 5CGPA 4YK0A 5D3PA 5CUBA 3U5OA 5ENGA 4QSTA 3P1DA 4HXOA 4QSSA 4QZSA 4NYVA 4YATA 2GRCA 4QYLA 5A5OA 5EPBA 5A83A 4A9EA 5HRWA 4E96A 4A9OA 4NR6A 5FE0A 3RCWA 3NXBA 4NUCA 4A9MA 5DLXA 5F3AA 5EI4A 5AMEA 4YH4A 5CUAA 4YADA 4MEOA 4KV1A 3DWYA 4UYGA 5LJ2A 4NUEA 5AD2A 4NR9A 4J3IA 4LYWA 5E9VA 2G4AA 4UIZA 5CQ7A 4YC9A 4BHWA 3P1CA 4UYFA 5FE2A 5CQ6A 3K2JA 3FKMX 4BW3A 4ALHA 5L97A 5FFVA 5D26A 2DKWA 4GPJA 4YH3A 3Q2EA 3U5LA 4NXJA 5BT3A 4TS8A 4TT6A 4Z1QA 4TTEA 5HRXA 4UITA 5ENHA 3ONIA 2WP2A 4O7EA 4A9LA 2E7NA 4WIVA 5EM3A 2N9GA 5DKHA 5FH8A 3HMHA 5LJ0A 5HQ7A 4HXMA 5FB1A 4PCIA 5KHMA 2D82A 5LJ1A 5E9KA 2OO1A 4Y03A 5D3NA 5G4RA 5IIDA 4LDFA 2RNXA 5DYAA 5FDZA 4BW2A 5FH7A 4QY4A 3MULA 5EPRA 4IR4A 4NR4A 5CUCA 2YDWA 4DONA 3ZYUA 5A5PA 4NR7A 3DAIA 5LKZA 4UYDA 3U5JA 4HBXA 2L85A 4NYWA 5E9LA 3UVYA 5ENIA 5KTWA 1ZS5A 2DVVA 1JSPB 5H1VA 4A9JA 5CP5A 4BW4A 5E3DA 5D3TA 4PY6A 5EP7A 5HENA 3IU6A 5EQ1A 3UV2A 5DYUA 3JVLA 4QSRA 5EWCA 5BT5A 5L98A 2DVRA 3O34A 5C7NA 4BJXA 5A5RA 4O7CA 4Q0OA 5HM0A 4XY9A 5E7DA 5I40A 1EQFA 3G0LA 4QSVA 2YEKA 3SVGA 4HXNA 4RVRA 4O72A 4YYHA 4A9KA 5ACYA 2YQDA 4IOQA 5A85A 3O35A 5IGLA 5E9YA 4KCXA 5C87A 5D3HA 5H1UA 4HBYA 4AKNA 3SVFA 4NS5A 4UIWA 5DW2A 5EWWA 2L5EA 5L8UA 4YBSA 4IR6A 5JWMA 5D3SA 4NYXA 4CUPA 4TU4A 5FE3A 1WUGA 5EK9A 3QZTA 2R0VA 4HXPA 4LZSA 4MR4A 5IG6A 4QR3A 5HLSA 4MR6A 5K29A 4WHWA 4O75A 2OSSA 5F2PA 4OUFA 5FFWA 4CFKA 5FE8A 1E6IA 4QR5A 3UV5A 2E3KA 4XUAA 4F3IA 4O7AA 5CRZA 5ENCA 4QSPA 5IGKA 5I1QA 3S92A 5L8TA 4YYDA 5ENEA 5JI8A 5F5ZA 5FE5A 4MEPA 4QNSA 5I29A 5CUDA 5FB0A 4LR6A 5C4QA 3G0JA 3QZVA 4HBWA 5I7XA 3MUKA 5DKCA 4A9IA 5FG6A 5F63A 4O78A 3HMFA 4LZ2A 5EGUA 5CQAA 4CLBA 3U5NA 5I86A 5C89A 5G4SA 5FE6A 3UVDA 5FG5A 4BW1A 5E73A 5HFRA 5CU8A 5FFYA 5E74A 5H85A 5DKDA 4N4FA 4CUQA 4ALGA 5E9IA 4IORA 5CQ8A 4WHUA 5FG4A 5DLZA 5DY7A 4YYKA 5CRMA 5LUUA 3UVWA 5CQ5A 4QC3A 4NQMA 5I83A 5DFBA 3P5OA 4J0SA 4YAXA 4YYGA 4CFLA 3D7CA 5EWDA 5ETBA 4YY4A 5C8GA 4ZC9A 4QUUA 4HXRA 4PKLA 2I7KA 5FE7A 3MXFA 5E3GA 4MENA 5BT4A 5HEMA 4J1PA 3P1EA 4LYIA 4N4GA 4NRAA 4TU6A 5LKUA 4PTBA 4C67A 3JVJA 4LC2A 3AADA 5DX4A 1N72A 5CS8A 5E9MA 4TZ2A 3UW9A 2DVQA 4QYDA 5EU1A 4NR8A 4OGIA 4YBTA 5D7XA 5KTUA 4A9NA 4UIXA 3GG3A 4YY6A 5A5QA 5D0CA 5HQ6A 5F62A 5A81A 3IU5A 3LQJA 4YYMA 5J0DA 1WUMA 5I89A 2RS9B 4O70A 4CUSA 5II2A 4C66A 5I88A 2YELA 4QR4A 5HRVA 5TCMA 3MQMA 5CQ3A 2OUOA 5IGMA 3U5MA 5DBMA 4QEWA 4IR3A 4A9FA 4QEVA 5CQTA 3O37A 4XYAA 5DFCA 4NRCA 5A7CA 2RI7A 2NXBA 4UYFB 5FH6A 4QSXA 4FLPA 4YYNA 5TB6A 3LQHA 5DW1A 4LRGA 2RO1A 1F68A 5D3LA 5CTLA 4ZW1A 2LSPB 4Q0NA 5LKXA 4QC1A 4QUTA 5ENBA 5EPSA 4Z93A 4A9HA 2DVSA 5LKTA 5FE9A 4QBMA 5D3JA 4HXSA 5KU3A 4HXLA 4LYSA 4IOOA 4UYEA 4PCEA 3LQIA 3S91A 2RNYA 2R0YA 4O7BA 5ENJA 4CURA 4TZ8A 2D9EA 2F6NA 4Z1SA 5IBNA 2RFJA 4CUUA 4OGJA 5EISA 4UIVA 4CL9A 5HQ5A 3SVHA 3LJWA 4QSUA 5CQ4A 3UVXA 3TLPA 5F36A 5A5NA 3MB4A 3U5KA 5FE1A 2WP1A 4TT2A 4XUBA 5FBXA 5FE4A 2R10A 5DFDA 4O71A 5H1TA 5F25A 2E7OA 2KTBB 1JM4B 5ENFA 5ETDA 5EICA 2RNWA 4YYJA 3QZSA 4XY8A 2F6JA 5D24A 1X0JA 4O74A 5EV9A 5F61A 4KV4A 4QB3A 5F1HA 4MEQA 4N4IA 5COIA 4X2IA 3U5PA 4UYHA 5D25A 5L99A 4N3WA 5EWVA 2YEMA 3HMEA 4N4HA 5KTXA 5CPEA 5DYXA 5LVRA 4UIUA 5CUGA 3MB3A 4CUTA 4J0RA 3P1FA 4YYIA 4QSWA 5HCLA 4TYLA 4QSQA 4O76A 4Z6HA 4NRBA 4QEUA 3UV4A 5KO4A 2MJVB 4YABA 2FSAA 5EA1A 5F1LA
chains in the Genus database with same CATH superfamily
2DWWA 2YYNA 3O36A 5IGNA 5CY9A 5I80A 4MR3A 4IR5A 4HXKA 4NUDA 2H60A 2I8NA 5II1A 4Z6IA 4MR5A 5CUEA 5L96A 5LVQA 3O33A 1ZKRA 5EVAA 4HBVA 4YBMA 3AQAA 5EWHA 5A82A 3JVMA 5C85A 5I7YA 2L84A 4UIYA 3LXJA 5HJCA 5DYCA 4NQNA 5E0RA 4TQNA 5AD3A 4LZRA 4O7FA 5HELA 4ZQLA 4PS5A 4TT4A 4O77A 3JVKA 5CZGA 5HFQA 4NR5A 5D3RA 5CFWA 5F60A 2YW5A 5A5SA 5AMFA 2DATA 3Q2FA 3I3JA 2R0SA 5CGPA 4YK0A 5D3PA 5CUBA 3U5OA 5ENGA 4QSTA 3P1DA 4HXOA 4QSSA 4QZSA 4NYVA 4YATA 2GRCA 4QYLA 5A5OA 5EPBA 5A83A 4A9EA 5HRWA 4E96A 4A9OA 4NR6A 5FE0A 3RCWA 3NXBA 4NUCA 4A9MA 5DLXA 5F3AA 3ERRA 5EI4A 5AMEA 4YH4A 5CUAA 4YADA 4MEOA 4KV1A 3DWYA 4UYGA 5LJ2A 4NUEA 5AD2A 4NR9A 4J3IA 4LYWA 5E9VA 2G4AA 4UIZA 5CQ7A 4YC9A 4BHWA 3P1CA 4UYFA 5FE2A 5CQ6A 3VKGA 3K2JA 3FKMX 4BW3A 4ALHA 5L97A 5FFVA 5D26A 2DKWA 4GPJA 4YH3A 3Q2EA 3U5LA 4NXJA 5BT3A 4TS8A 4TT6A 4Z1QA 4TTEA 5HRXA 4UITA 5ENHA 3ONIA 2WP2A 4O7EA 4A9LA 2E7NA 4WIVA 5EM3A 2N9GA 5DKHA 5FH8A 3HMHA 5LJ0A 5HQ7A 4HXMA 5FB1A 4PCIA 5KHMA 2D82A 5LJ1A 5E9KA 2OO1A 4Y03A 5D3NA 5G4RA 5IIDA 4LDFA 2RNXA 5DYAA 5FDZA 4BW2A 5FH7A 4QY4A 3MULA 5EPRA 4IR4A 4NR4A 5CUCA 2YDWA 4DONA 3ZYUA 5A5PA 4NR7A 3DAIA 5LKZA 4UYDA 3U5JA 4HBXA 2L85A 4NYWA 5E9LA 3UVYA 5ENIA 5KTWA 1ZS5A 2DVVA 1JSPB 5H1VA 4A9JA 5CP5A 4BW4A 5E3DA 5D3TA 4PY6A 5EP7A 5HENA 3IU6A 5EQ1A 3UV2A 5DYUA 3JVLA 4QSRA 5EWCA 5BT5A 5L98A 2DVRA 3O34A 5C7NA 4BJXA 5A5RA 1PUOA 4O7CA 4Q0OA 5HM0A 4XY9A 5E7DA 5I40A 1EQFA 3G0LA 4QSVA 2YEKA 3SVGA 4HXNA 4RVRA 4O72A 4YYHA 4A9KA 5ACYA 2YQDA 4AI6A 4IOQA 5A85A 3O35A 5IGLA 5E9YA 4KCXA 5C87A 5D3HA 5H1UA 4HBYA 4AKNA 3SVFA 4NS5A 4UIWA 5DW2A 5EWWA 2L5EA 5L8UA 4YBSA 4IR6A 5JWMA 5D3SA 4NYXA 4CUPA 4TU4A 5FE3A 1WUGA 5EK9A 3QZTA 2R0VA 4HXPA 4LZSA 4MR4A 5IG6A 4QR3A 5HLSA 4MR6A 2EJNA 5K29A 4WHWA 4O75A 2OSSA 5F2PA 4OUFA 5FFWA 4CFKA 5FE8A 1E6IA 4QR5A 3UV5A 2E3KA 4XUAA 4F3IA 4O7AA 5CRZA 5ENCA 4QSPA 5IGKA 5I1QA 3S92A 5L8TA 4YYDA 5ENEA 5JI8A 5F5ZA 5FE5A 4MEPA 4QNSA 5I29A 5CUDA 5FB0A 4LR6A 5C4QA 3G0JA 3QZVA 4HBWA 5I7XA 3MUKA 5DKCA 4A9IA 5FG6A 5F63A 4O78A 3HMFA 4LZ2A 5EGUA 4AKHA 5CQAA 4CLBA 3U5NA 3D1DA 5I86A 5C89A 5G4SA 5FE6A 3UVDA 5FG5A 4BW1A 5E73A 5HFRA 5CU8A 5FFYA 5E74A 5H85A 5DKDA 4N4FA 4CUQA 4ALGA 5E9IA 4IORA 5CQ8A 4WHUA 5FG4A 5DLZA 5DY7A 4YYKA 5CRMA 5LUUA 3UVWA 5CQ5A 4QC3A 4NQMA 5I83A 5DFBA 3P5OA 3D1BA 4J0SA 4YAXA 4YYGA 4CFLA 3D7CA 5EWDA 5ETBA 4YY4A 5C8GA 4ZC9A 4QUUA 4HXRA 4PKLA 2I7KA 5FE7A 3MXFA 5E3GA 4MENA 5BT4A 5HEMA 4J1PA 3P1EA 4LYIA 4N4GA 4NRAA 4TU6A 5LKUA 4PTBA 4C67A 3JVJA 4LC2A 3AADA 5DX4A 1N72A 5CS8A 5E9MA 4TZ2A 3UW9A 2DVQA 4QYDA 5EU1A 4NR8A 4OGIA 4AKGA 4YBTA 5D7XA 5KTUA 4A9NA 4UIXA 3GG3A 4YY6A 5A5QA 5D0CA 5HQ6A 5F62A 5A81A 3IU5A 3LQJA 4YYMA 5J0DA 1WUMA 5I89A 2RS9B 4O70A 4CUSA 5II2A 4C66A 5I88A 2YELA 4QR4A 5HRVA 5TCMA 3MQMA 5CQ3A 2OUOA 5IGMA 3U5MA 5DBMA 4QEWA 4IR3A 4A9FA 4QEVA 5CQTA 3O37A 4XYAA 5DFCA 4NRCA 5A7CA 2RI7A 2NXBA 4UYFB 5FH6A 4QSXA 4FLPA 4YYNA 5TB6A 3LQHA 5DW1A 4LRGA 2RO1A 1F68A 5D3LA 5CTLA 4ZW1A 2LSPB 4Q0NA 5LKXA 4QC1A 4QUTA 5ENBA 5EPSA 4Z93A 4A9HA 2DVSA 5LKTA 5FE9A 4QBMA 5D3JA 4HXSA 5KU3A 4HXLA 4LYSA 4IOOA 4UYEA 4PCEA 3LQIA 3S91A 2RNYA 2R0YA 4AKIA 4O7BA 5ENJA 4CURA 4TZ8A 2D9EA 2F6NA 4Z1SA 5IBNA 2RFJA 4CUUA 4OGJA 5EISA 4UIVA 4CL9A 5HQ5A 3SVHA 3LJWA 4QSUA 5CQ4A 3UVXA 3TLPA 5F36A 5A5NA 3MB4A 3U5KA 5FE1A 2WP1A 4TT2A 4XUBA 5FBXA 5FE4A 2R10A 5DFDA 4O71A 5H1TA 5F25A 2E7OA 2KTBB 1JM4B 5ENFA 5ETDA 5EICA 2RNWA 4YYJA 3QZSA 4XY8A 2F6JA 5D24A 1X0JA 4O74A 5EV9A 5F61A 4KV4A 4QB3A 5F1HA 4MEQA 4N4IA 5COIA 4X2IA 3U5PA 4UYHA 5D25A 5L99A 4N3WA 5EWVA 2YEMA 3HMEA 4N4HA 5KTXA 5CPEA 3VKHA 5DYXA 5LVRA 4UIUA 5CUGA 3MB3A 4CUTA 4J0RA 3P1FA 4YYIA 4QSWA 5HCLA 4TYLA 4QSQA 4O76A 4Z6HA 4NRBA 4QEUA 3UV4A 5KO4A 2MJVB 4YABA 2FSAA 5EA1A 5F1LA
chains in the Genus database with same CATH topology
2DWWA 2YYNA 3O36A 5IGNA 5CY9A 5I80A 4MR3A 4IR5A 4HXKA 4NUDA 2H60A 2I8NA 5II1A 4Z6IA 4MR5A 5CUEA 5L96A 5LVQA 3O33A 5EVAA 4HBVA 4YBMA 3AQAA 5EWHA 5A82A 3JVMA 5C85A 5I7YA 2L84A 4UIYA 3LXJA 5HJCA 5DYCA 4NQNA 5E0RA 4TQNA 5AD3A 4LZRA 4O7FA 5HELA 4ZQLA 4PS5A 4TT4A 4O77A 3JVKA 5CZGA 5HFQA 4NR5A 5D3RA 5CFWA 5F60A 2YW5A 5A5SA 5AMFA 2DATA 3Q2FA 3I3JA 2R0SA 5CGPA 4YK0A 5D3PA 5CUBA 3U5OA 5ENGA 4QSTA 3P1DA 4HXOA 4QSSA 4QZSA 4NYVA 4YATA 2GRCA 4QYLA 5A5OA 5EPBA 5A83A 4A9EA 5HRWA 4E96A 4A9OA 4NR6A 5FE0A 3RCWA 3NXBA 4NUCA 4A9MA 5DLXA 5F3AA 5EI4A 5AMEA 4YH4A 5CUAA 4YADA 4MEOA 4KV1A 3DWYA 4UYGA 5LJ2A 4NUEA 5AD2A 4NR9A 4J3IA 4LYWA 5E9VA 2G4AA 4UIZA 5CQ7A 4YC9A 4BHWA 3P1CA 4UYFA 5FE2A 5CQ6A 3K2JA 3FKMX 4BW3A 4ALHA 5L97A 5FFVA 5D26A 2DKWA 4GPJA 4YH3A 3Q2EA 3U5LA 4NXJA 5BT3A 4TS8A 4TT6A 4Z1QA 4TTEA 5HRXA 4UITA 5ENHA 3ONIA 2WP2A 4O7EA 4A9LA 2E7NA 4WIVA 5EM3A 2N9GA 5DKHA 5FH8A 3HMHA 5LJ0A 5HQ7A 4HXMA 5FB1A 4PCIA 5KHMA 2D82A 5LJ1A 5E9KA 2OO1A 4Y03A 5D3NA 5G4RA 5IIDA 4LDFA 2RNXA 5DYAA 5FDZA 4BW2A 5FH7A 4QY4A 3MULA 5EPRA 4IR4A 4NR4A 5CUCA 2YDWA 4DONA 3ZYUA 5A5PA 4NR7A 3DAIA 5LKZA 4UYDA 3U5JA 4HBXA 2L85A 4NYWA 5E9LA 3UVYA 5ENIA 5KTWA 1ZS5A 2DVVA 1JSPB 5H1VA 4A9JA 5CP5A 4BW4A 5E3DA 5D3TA 4PY6A 5EP7A 5HENA 3IU6A 5EQ1A 3UV2A 5DYUA 3JVLA 4QSRA 5EWCA 5BT5A 5L98A 2DVRA 3O34A 5C7NA 4BJXA 5A5RA 4O7CA 4Q0OA 5HM0A 4XY9A 5E7DA 5I40A 1EQFA 3G0LA 4QSVA 2YEKA 3SVGA 4HXNA 4RVRA 4O72A 4YYHA 4A9KA 5ACYA 2YQDA 4IOQA 5A85A 3O35A 5IGLA 5E9YA 4KCXA 5C87A 5D3HA 5H1UA 4HBYA 4AKNA 3SVFA 4NS5A 4UIWA 5DW2A 5EWWA 2L5EA 5L8UA 4YBSA 4IR6A 5JWMA 5D3SA 4NYXA 4CUPA 4TU4A 5FE3A 1WUGA 5EK9A 3QZTA 2R0VA 4HXPA 4LZSA 4MR4A 5IG6A 4QR3A 5HLSA 4MR6A 5K29A 4WHWA 4O75A 2OSSA 5F2PA 4OUFA 5FFWA 4CFKA 5FE8A 1E6IA 4QR5A 3UV5A 2E3KA 4XUAA 4F3IA 4O7AA 5CRZA 5ENCA 4QSPA 5IGKA 5I1QA 3S92A 5L8TA 4YYDA 5ENEA 5JI8A 5F5ZA 5FE5A 4MEPA 4QNSA 5I29A 5CUDA 5FB0A 4LR6A 5C4QA 3G0JA 3QZVA 4HBWA 5I7XA 3MUKA 5DKCA 4A9IA 5FG6A 5F63A 4O78A 3HMFA 4LZ2A 5EGUA 5CQAA 4CLBA 3U5NA 5I86A 5C89A 5G4SA 5FE6A 3UVDA 5FG5A 4BW1A 5E73A 5HFRA 5CU8A 5FFYA 5E74A 5H85A 5DKDA 4N4FA 4CUQA 4ALGA 5E9IA 4IORA 5CQ8A 4WHUA 5FG4A 5DLZA 5DY7A 4YYKA 5CRMA 5LUUA 3UVWA 5CQ5A 4QC3A 4NQMA 5I83A 5DFBA 3P5OA 4J0SA 4YAXA 4YYGA 4CFLA 3D7CA 5EWDA 5ETBA 4YY4A 5C8GA 4ZC9A 4QUUA 4HXRA 4PKLA 2I7KA 5FE7A 3MXFA 5E3GA 4MENA 5BT4A 5HEMA 4J1PA 3P1EA 4LYIA 4N4GA 4NRAA 4TU6A 5LKUA 4PTBA 4C67A 3JVJA 4LC2A 3AADA 5DX4A 1N72A 5CS8A 5E9MA 4TZ2A 3UW9A 2DVQA 4QYDA 5EU1A 4NR8A 4OGIA 4YBTA 5D7XA 5KTUA 4A9NA 4UIXA 3GG3A 4YY6A 5A5QA 5D0CA 5HQ6A 5F62A 5A81A 3IU5A 3LQJA 4YYMA 5J0DA 1WUMA 5I89A 2RS9B 4O70A 4CUSA 5II2A 4C66A 5I88A 2YELA 4QR4A 5HRVA 5TCMA 3MQMA 5CQ3A 2OUOA 5IGMA 3U5MA 5DBMA 4QEWA 4IR3A 4A9FA 4QEVA 5CQTA 3O37A 4XYAA 5DFCA 4NRCA 5A7CA 2RI7A 2NXBA 4UYFB 5FH6A 4QSXA 4FLPA 4YYNA 5TB6A 3LQHA 5DW1A 4LRGA 2RO1A 1F68A 5D3LA 5CTLA 4ZW1A 2LSPB 4Q0NA 5LKXA 4QC1A 4QUTA 5ENBA 5EPSA 4Z93A 4A9HA 2DVSA 5LKTA 5FE9A 4QBMA 5D3JA 4HXSA 5KU3A 4HXLA 4LYSA 4IOOA 4UYEA 4PCEA 3LQIA 3S91A 2RNYA 2R0YA 4O7BA 5ENJA 4CURA 4TZ8A 2D9EA 2F6NA 4Z1SA 5IBNA 2RFJA 4CUUA 4OGJA 5EISA 4UIVA 4CL9A 5HQ5A 3SVHA 3LJWA 4QSUA 5CQ4A 3UVXA 3TLPA 5F36A 5A5NA 3MB4A 3U5KA 5FE1A 2WP1A 4TT2A 4XUBA 5FBXA 5FE4A 2R10A 5DFDA 4O71A 5H1TA 5F25A 2E7OA 2KTBB 1JM4B 5ENFA 5ETDA 5EICA 2RNWA 4YYJA 3QZSA 4XY8A 2F6JA 5D24A 1X0JA 4O74A 5EV9A 5F61A 4KV4A 4QB3A 5F1HA 4MEQA 4N4IA 5COIA 4X2IA 3U5PA 4UYHA 5D25A 5L99A 4N3WA 5EWVA 2YEMA 3HMEA 4N4HA 5KTXA 5CPEA 5DYXA 5LVRA 4UIUA 5CUGA 3MB3A 4CUTA 4J0RA 3P1FA 4YYIA 4QSWA 5HCLA 4TYLA 4QSQA 4O76A 4Z6HA 4NRBA 4QEUA 3UV4A 5KO4A 2MJVB 4YABA 2FSAA 5EA1A 5F1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWW A;  2YYN A;  3O36 A;  5IGN A;  5CY9 A;  5I80 A;  4MR3 A;  4IR5 A;  4HXK A;  4NUD A;  2H60 A;  2I8N A;  5II1 A;  4Z6I A;  4MR5 A;  5CUE A;  5L96 A;  5LVQ A;  3O33 A;  5EVA A;  4HBV A;  4YBM A;  3AQA A;  5EWH A;  5A82 A;  3JVM A;  5C85 A;  5I7Y A;  2L84 A;  4UIY A;  3LXJ A;  5HJC A;  5DYC A;  4NQN A;  5E0R A;  4TQN A;  5AD3 A;  4LZR A;  4O7F A;  5HEL A;  4ZQL A;  4PS5 A;  4TT4 A;  4O77 A;  3JVK A;  5CZG A;  5HFQ A;  4NR5 A;  5D3R A;  5CFW A;  5F60 A;  2YW5 A;  5A5S A;  5AMF A;  2DAT A;  3Q2F A;  3I3J A;  2R0S A;  5CGP A;  4YK0 A;  5D3P A;  5CUB A;  3U5O A;  5ENG A;  4QST A;  3P1D A;  4HXO A;  4QSS A;  4QZS A;  4NYV A;  4YAT A;  2GRC A;  4QYL A;  5A5O A;  5EPB A;  5A83 A;  4A9E A;  5HRW A;  4E96 A;  4A9O A;  4NR6 A;  5FE0 A;  3RCW A;  3NXB A;  4NUC A;  4A9M A;  5DLX A;  5F3A A;  5EI4 A;  5AME A;  4YH4 A;  5CUA A;  4YAD A;  4MEO A;  4KV1 A;  3DWY A;  4UYG A;  5LJ2 A;  4NUE A;  5AD2 A;  4NR9 A;  4J3I A;  4LYW A;  5E9V A;  2G4A A;  4UIZ A;  5CQ7 A;  4YC9 A;  4BHW A;  3P1C A;  4UYF A;  5FE2 A;  5CQ6 A;  3K2J A;  3FKM X;  4BW3 A;  4ALH A;  5L97 A;  5FFV A;  5D26 A;  2DKW A;  4GPJ A;  4YH3 A;  3Q2E A;  3U5L A;  4NXJ A;  5BT3 A;  4TS8 A;  4TT6 A;  4Z1Q A;  4TTE A;  5HRX A;  4UIT A;  5ENH A;  3ONI A;  2WP2 A;  4O7E A;  4A9L A;  2E7N A;  4WIV A;  5EM3 A;  2N9G A;  5DKH A;  5FH8 A;  3HMH A;  5LJ0 A;  5HQ7 A;  4HXM A;  5FB1 A;  4PCI A;  5KHM A;  2D82 A;  5LJ1 A;  5E9K A;  2OO1 A;  4Y03 A;  5D3N A;  5G4R A;  5IID A;  4LDF A;  2RNX A;  5DYA A;  5FDZ A;  4BW2 A;  5FH7 A;  4QY4 A;  3MUL A;  5EPR A;  4IR4 A;  4NR4 A;  5CUC A;  2YDW A;  4DON A;  3ZYU A;  5A5P A;  4NR7 A;  3DAI A;  5LKZ A;  4UYD A;  3U5J A;  4HBX A;  2L85 A;  4NYW A;  5E9L A;  3UVY A;  5ENI A;  5KTW A;  1ZS5 A;  2DVV A;  1JSP B;  5H1V A;  4A9J A;  5CP5 A;  4BW4 A;  5E3D A;  5D3T A;  4PY6 A;  5EP7 A;  5HEN A;  3IU6 A;  5EQ1 A;  3UV2 A;  5DYU A;  3JVL A;  4QSR A;  5EWC A;  5BT5 A;  5L98 A;  2DVR A;  3O34 A;  5C7N A;  4BJX A;  5A5R A;  4O7C A;  4Q0O A;  5HM0 A;  4XY9 A;  5E7D A;  5I40 A;  1EQF A;  3G0L A;  4QSV A;  2YEK A;  3SVG A;  4HXN A;  4RVR A;  4O72 A;  4YYH A;  4A9K A;  5ACY A;  2YQD A;  4IOQ A;  5A85 A;  3O35 A;  5IGL A;  5E9Y A;  4KCX A;  5C87 A;  5D3H A;  5H1U A;  4HBY A;  4AKN A;  3SVF A;  4NS5 A;  4UIW A;  5DW2 A;  5EWW A;  2L5E A;  5L8U A;  4YBS A;  4IR6 A;  5JWM A;  5D3S A;  4NYX A;  4CUP A;  4TU4 A;  5FE3 A;  1WUG A;  5EK9 A;  3QZT A;  2R0V A;  4HXP A;  4LZS A;  4MR4 A;  5IG6 A;  4QR3 A;  5HLS A;  4MR6 A;  5K29 A;  4WHW A;  4O75 A;  2OSS A;  5F2P A;  4OUF A;  5FFW A;  4CFK A;  5FE8 A;  1E6I A;  4QR5 A;  3UV5 A;  2E3K A;  4XUA A;  4F3I A;  4O7A A;  5CRZ A;  5ENC A;  4QSP A;  5IGK A;  5I1Q A;  3S92 A;  5L8T A;  4YYD A;  5ENE A;  5JI8 A;  5F5Z A;  5FE5 A;  4MEP A;  4QNS A;  5I29 A;  5CUD A;  5FB0 A;  4LR6 A;  5C4Q A;  3G0J A;  3QZV A;  4HBW A;  5I7X A;  3MUK A;  5DKC A;  4A9I A;  5FG6 A;  5F63 A;  4O78 A;  3HMF A;  4LZ2 A;  5EGU A;  5CQA A;  4CLB A;  3U5N A;  5I86 A;  5C89 A;  5G4S A;  5FE6 A;  3UVD A;  5FG5 A;  4BW1 A;  5E73 A;  5HFR A;  5CU8 A;  5FFY A;  5E74 A;  5H85 A;  5DKD A;  4N4F A;  4CUQ A;  4ALG A;  5E9I A;  4IOR A;  5CQ8 A;  4WHU A;  5FG4 A;  5DLZ A;  5DY7 A;  4YYK A;  5CRM A;  5LUU A;  3UVW A;  5CQ5 A;  4QC3 A;  4NQM A;  5I83 A;  5DFB A;  3P5O A;  4J0S A;  4YAX A;  4YYG A;  4CFL A;  3D7C A;  5EWD A;  5ETB A;  4YY4 A;  5C8G A;  4ZC9 A;  4QUU A;  4HXR A;  4PKL A;  2I7K A;  5FE7 A;  3MXF A;  5E3G A;  4MEN A;  5BT4 A;  5HEM A;  4J1P A;  3P1E A;  4LYI A;  4N4G A;  4NRA A;  4TU6 A;  5LKU A;  4PTB A;  4C67 A;  3JVJ A;  4LC2 A;  3AAD A;  5DX4 A;  1N72 A;  5CS8 A;  5E9M A;  4TZ2 A;  3UW9 A;  2DVQ A;  4QYD A;  5EU1 A;  4NR8 A;  4OGI A;  4YBT A;  5D7X A;  5KTU A;  4A9N A;  4UIX A;  3GG3 A;  4YY6 A;  5A5Q A;  5D0C A;  5HQ6 A;  5F62 A;  5A81 A;  3IU5 A;  3LQJ A;  4YYM A;  5J0D A;  1WUM A;  5I89 A;  2RS9 B;  4O70 A;  4CUS A;  5II2 A;  4C66 A;  5I88 A;  2YEL A;  4QR4 A;  5HRV A;  5TCM A;  3MQM A;  5CQ3 A;  2OUO A;  5IGM A;  3U5M A;  5DBM A;  4QEW A;  4IR3 A;  4A9F A;  4QEV A;  5CQT A;  3O37 A;  4XYA A;  5DFC A;  4NRC A;  5A7C A;  2RI7 A;  2NXB A;  4UYF B;  5FH6 A;  4QSX A;  4FLP A;  4YYN A;  5TB6 A;  3LQH A;  5DW1 A;  4LRG A;  2RO1 A;  1F68 A;  5D3L A;  5CTL A;  4ZW1 A;  2LSP B;  4Q0N A;  5LKX A;  4QC1 A;  4QUT A;  5ENB A;  5EPS A;  4Z93 A;  4A9H A;  2DVS A;  5LKT A;  5FE9 A;  4QBM A;  5D3J A;  4HXS A;  5KU3 A;  4HXL A;  4LYS A;  4IOO A;  4UYE A;  4PCE A;  3LQI A;  3S91 A;  2RNY A;  2R0Y A;  4O7B A;  5ENJ A;  4CUR A;  4TZ8 A;  2D9E A;  2F6N A;  4Z1S A;  5IBN A;  2RFJ A;  4CUU A;  4OGJ A;  5EIS A;  4UIV A;  4CL9 A;  5HQ5 A;  3SVH A;  3LJW A;  4QSU A;  5CQ4 A;  3UVX A;  3TLP A;  5F36 A;  5A5N A;  3MB4 A;  3U5K A;  5FE1 A;  2WP1 A;  4TT2 A;  4XUB A;  5FBX A;  5FE4 A;  2R10 A;  5DFD A;  4O71 A;  5H1T A;  5F25 A;  2E7O A;  2KTB B;  1JM4 B;  5ENF A;  5ETD A;  5EIC A;  2RNW A;  4YYJ A;  3QZS A;  4XY8 A;  2F6J A;  5D24 A;  1X0J A;  4O74 A;  5EV9 A;  5F61 A;  4KV4 A;  4QB3 A;  5F1H A;  4MEQ A;  4N4I A;  5COI A;  4X2I A;  3U5P A;  4UYH A;  5D25 A;  5L99 A;  4N3W A;  5EWV A;  2YEM A;  3HME A;  4N4H A;  5KTX A;  5CPE A;  5DYX A;  5LVR A;  4UIU A;  5CUG A;  3MB3 A;  4CUT A;  4J0R A;  3P1F A;  4YYI A;  4QSW A;  5HCL A;  4TYL A;  4QSQ A;  4O76 A;  4Z6H A;  4NRB A;  4QEU A;  3UV4 A;  5KO4 A;  2MJV B;  4YAB A;  2FSA A;  5EA1 A;  5F1L A; 
#chains in the Genus database with same CATH topology
 2DWW A;  2YYN A;  3O36 A;  5IGN A;  5CY9 A;  5I80 A;  4MR3 A;  4IR5 A;  4HXK A;  4NUD A;  2H60 A;  2I8N A;  5II1 A;  4Z6I A;  4MR5 A;  5CUE A;  5L96 A;  5LVQ A;  3O33 A;  1ZKR A;  5EVA A;  4HBV A;  4YBM A;  3AQA A;  5EWH A;  5A82 A;  3JVM A;  5C85 A;  5I7Y A;  2L84 A;  4UIY A;  3LXJ A;  5HJC A;  5DYC A;  4NQN A;  5E0R A;  4TQN A;  5AD3 A;  4LZR A;  4O7F A;  5HEL A;  4ZQL A;  4PS5 A;  4TT4 A;  4O77 A;  3JVK A;  5CZG A;  5HFQ A;  4NR5 A;  5D3R A;  5CFW A;  5F60 A;  2YW5 A;  5A5S A;  5AMF A;  2DAT A;  3Q2F A;  3I3J A;  2R0S A;  5CGP A;  4YK0 A;  5D3P A;  5CUB A;  3U5O A;  5ENG A;  4QST A;  3P1D A;  4HXO A;  4QSS A;  4QZS A;  4NYV A;  4YAT A;  2GRC A;  4QYL A;  5A5O A;  5EPB A;  5A83 A;  4A9E A;  5HRW A;  4E96 A;  4A9O A;  4NR6 A;  5FE0 A;  3RCW A;  3NXB A;  4NUC A;  4A9M A;  5DLX A;  5F3A A;  3ERR A;  5EI4 A;  5AME A;  4YH4 A;  5CUA A;  4YAD A;  4MEO A;  4KV1 A;  3DWY A;  4UYG A;  5LJ2 A;  4NUE A;  5AD2 A;  4NR9 A;  4J3I A;  4LYW A;  5E9V A;  2G4A A;  4UIZ A;  5CQ7 A;  4YC9 A;  4BHW A;  3P1C A;  4UYF A;  5FE2 A;  5CQ6 A;  3VKG A;  3K2J A;  3FKM X;  4BW3 A;  4ALH A;  5L97 A;  5FFV A;  5D26 A;  2DKW A;  4GPJ A;  4YH3 A;  3Q2E A;  3U5L A;  4NXJ A;  5BT3 A;  4TS8 A;  4TT6 A;  4Z1Q A;  4TTE A;  5HRX A;  4UIT A;  5ENH A;  3ONI A;  2WP2 A;  4O7E A;  4A9L A;  2E7N A;  4WIV A;  5EM3 A;  2N9G A;  5DKH A;  5FH8 A;  3HMH A;  5LJ0 A;  5HQ7 A;  4HXM A;  5FB1 A;  4PCI A;  5KHM A;  2D82 A;  5LJ1 A;  5E9K A;  2OO1 A;  4Y03 A;  5D3N A;  5G4R A;  5IID A;  4LDF A;  2RNX A;  5DYA A;  5FDZ A;  4BW2 A;  5FH7 A;  4QY4 A;  3MUL A;  5EPR A;  4IR4 A;  4NR4 A;  5CUC A;  2YDW A;  4DON A;  3ZYU A;  5A5P A;  4NR7 A;  3DAI A;  5LKZ A;  4UYD A;  3U5J A;  4HBX A;  2L85 A;  4NYW A;  5E9L A;  3UVY A;  5ENI A;  5KTW A;  1ZS5 A;  2DVV A;  1JSP B;  5H1V A;  4A9J A;  5CP5 A;  4BW4 A;  5E3D A;  5D3T A;  4PY6 A;  5EP7 A;  5HEN A;  3IU6 A;  5EQ1 A;  3UV2 A;  5DYU A;  3JVL A;  4QSR A;  5EWC A;  5BT5 A;  5L98 A;  2DVR A;  3O34 A;  5C7N A;  4BJX A;  5A5R A;  1PUO A;  4O7C A;  4Q0O A;  5HM0 A;  4XY9 A;  5E7D A;  5I40 A;  1EQF A;  3G0L A;  4QSV A;  2YEK A;  3SVG A;  4HXN A;  4RVR A;  4O72 A;  4YYH A;  4A9K A;  5ACY A;  2YQD A;  4AI6 A;  4IOQ A;  5A85 A;  3O35 A;  5IGL A;  5E9Y A;  4KCX A;  5C87 A;  5D3H A;  5H1U A;  4HBY A;  4AKN A;  3SVF A;  4NS5 A;  4UIW A;  5DW2 A;  5EWW A;  2L5E A;  5L8U A;  4YBS A;  4IR6 A;  5JWM A;  5D3S A;  4NYX A;  4CUP A;  4TU4 A;  5FE3 A;  1WUG A;  5EK9 A;  3QZT A;  2R0V A;  4HXP A;  4LZS A;  4MR4 A;  5IG6 A;  4QR3 A;  5HLS A;  4MR6 A;  2EJN A;  5K29 A;  4WHW A;  4O75 A;  2OSS A;  5F2P A;  4OUF A;  5FFW A;  4CFK A;  5FE8 A;  1E6I A;  4QR5 A;  3UV5 A;  2E3K A;  4XUA A;  4F3I A;  4O7A A;  5CRZ A;  5ENC A;  4QSP A;  5IGK A;  5I1Q A;  3S92 A;  5L8T A;  4YYD A;  5ENE A;  5JI8 A;  5F5Z A;  5FE5 A;  4MEP A;  4QNS A;  5I29 A;  5CUD A;  5FB0 A;  4LR6 A;  5C4Q A;  3G0J A;  3QZV A;  4HBW A;  5I7X A;  3MUK A;  5DKC A;  4A9I A;  5FG6 A;  5F63 A;  4O78 A;  3HMF A;  4LZ2 A;  5EGU A;  4AKH A;  5CQA A;  4CLB A;  3U5N A;  3D1D A;  5I86 A;  5C89 A;  5G4S A;  5FE6 A;  3UVD A;  5FG5 A;  4BW1 A;  5E73 A;  5HFR A;  5CU8 A;  5FFY A;  5E74 A;  5H85 A;  5DKD A;  4N4F A;  4CUQ A;  4ALG A;  5E9I A;  4IOR A;  5CQ8 A;  4WHU A;  5FG4 A;  5DLZ A;  5DY7 A;  4YYK A;  5CRM A;  5LUU A;  3UVW A;  5CQ5 A;  4QC3 A;  4NQM A;  5I83 A;  5DFB A;  3P5O A;  3D1B A;  4J0S A;  4YAX A;  4YYG A;  4CFL A;  3D7C A;  5EWD A;  5ETB A;  4YY4 A;  5C8G A;  4ZC9 A;  4QUU A;  4HXR A;  4PKL A;  2I7K A;  5FE7 A;  3MXF A;  5E3G A;  4MEN A;  5BT4 A;  5HEM A;  4J1P A;  3P1E A;  4LYI A;  4N4G A;  4NRA A;  4TU6 A;  5LKU A;  4PTB A;  4C67 A;  3JVJ A;  4LC2 A;  3AAD A;  5DX4 A;  1N72 A;  5CS8 A;  5E9M A;  4TZ2 A;  3UW9 A;  2DVQ A;  4QYD A;  5EU1 A;  4NR8 A;  4OGI A;  4AKG A;  4YBT A;  5D7X A;  5KTU A;  4A9N A;  4UIX A;  3GG3 A;  4YY6 A;  5A5Q A;  5D0C A;  5HQ6 A;  5F62 A;  5A81 A;  3IU5 A;  3LQJ A;  4YYM A;  5J0D A;  1WUM A;  5I89 A;  2RS9 B;  4O70 A;  4CUS A;  5II2 A;  4C66 A;  5I88 A;  2YEL A;  4QR4 A;  5HRV A;  5TCM A;  3MQM A;  5CQ3 A;  2OUO A;  5IGM A;  3U5M A;  5DBM A;  4QEW A;  4IR3 A;  4A9F A;  4QEV A;  5CQT A;  3O37 A;  4XYA A;  5DFC A;  4NRC A;  5A7C A;  2RI7 A;  2NXB A;  4UYF B;  5FH6 A;  4QSX A;  4FLP A;  4YYN A;  5TB6 A;  3LQH A;  5DW1 A;  4LRG A;  2RO1 A;  1F68 A;  5D3L A;  5CTL A;  4ZW1 A;  2LSP B;  4Q0N A;  5LKX A;  4QC1 A;  4QUT A;  5ENB A;  5EPS A;  4Z93 A;  4A9H A;  2DVS A;  5LKT A;  5FE9 A;  4QBM A;  5D3J A;  4HXS A;  5KU3 A;  4HXL A;  4LYS A;  4IOO A;  4UYE A;  4PCE A;  3LQI A;  3S91 A;  2RNY A;  2R0Y A;  4AKI A;  4O7B A;  5ENJ A;  4CUR A;  4TZ8 A;  2D9E A;  2F6N A;  4Z1S A;  5IBN A;  2RFJ A;  4CUU A;  4OGJ A;  5EIS A;  4UIV A;  4CL9 A;  5HQ5 A;  3SVH A;  3LJW A;  4QSU A;  5CQ4 A;  3UVX A;  3TLP A;  5F36 A;  5A5N A;  3MB4 A;  3U5K A;  5FE1 A;  2WP1 A;  4TT2 A;  4XUB A;  5FBX A;  5FE4 A;  2R10 A;  5DFD A;  4O71 A;  5H1T A;  5F25 A;  2E7O A;  2KTB B;  1JM4 B;  5ENF A;  5ETD A;  5EIC A;  2RNW A;  4YYJ A;  3QZS A;  4XY8 A;  2F6J A;  5D24 A;  1X0J A;  4O74 A;  5EV9 A;  5F61 A;  4KV4 A;  4QB3 A;  5F1H A;  4MEQ A;  4N4I A;  5COI A;  4X2I A;  3U5P A;  4UYH A;  5D25 A;  5L99 A;  4N3W A;  5EWV A;  2YEM A;  3HME A;  4N4H A;  5KTX A;  5CPE A;  3VKH A;  5DYX A;  5LVR A;  4UIU A;  5CUG A;  3MB3 A;  4CUT A;  4J0R A;  3P1F A;  4YYI A;  4QSW A;  5HCL A;  4TYL A;  4QSQ A;  4O76 A;  4Z6H A;  4NRB A;  4QEU A;  3UV4 A;  5KO4 A;  2MJV B;  4YAB A;  2FSA A;  5EA1 A;  5F1L A; 
#chains in the Genus database with same CATH homology
 2DWW A;  2YYN A;  3O36 A;  5IGN A;  5CY9 A;  5I80 A;  4MR3 A;  4IR5 A;  4HXK A;  4NUD A;  2H60 A;  2I8N A;  5II1 A;  4Z6I A;  4MR5 A;  5CUE A;  5L96 A;  5LVQ A;  3O33 A;  5EVA A;  4HBV A;  4YBM A;  3AQA A;  5EWH A;  5A82 A;  3JVM A;  5C85 A;  5I7Y A;  2L84 A;  4UIY A;  3LXJ A;  5HJC A;  5DYC A;  4NQN A;  5E0R A;  4TQN A;  5AD3 A;  4LZR A;  4O7F A;  5HEL A;  4ZQL A;  4PS5 A;  4TT4 A;  4O77 A;  3JVK A;  5CZG A;  5HFQ A;  4NR5 A;  5D3R A;  5CFW A;  5F60 A;  2YW5 A;  5A5S A;  5AMF A;  2DAT A;  3Q2F A;  3I3J A;  2R0S A;  5CGP A;  4YK0 A;  5D3P A;  5CUB A;  3U5O A;  5ENG A;  4QST A;  3P1D A;  4HXO A;  4QSS A;  4QZS A;  4NYV A;  4YAT A;  2GRC A;  4QYL A;  5A5O A;  5EPB A;  5A83 A;  4A9E A;  5HRW A;  4E96 A;  4A9O A;  4NR6 A;  5FE0 A;  3RCW A;  3NXB A;  4NUC A;  4A9M A;  5DLX A;  5F3A A;  5EI4 A;  5AME A;  4YH4 A;  5CUA A;  4YAD A;  4MEO A;  4KV1 A;  3DWY A;  4UYG A;  5LJ2 A;  4NUE A;  5AD2 A;  4NR9 A;  4J3I A;  4LYW A;  5E9V A;  2G4A A;  4UIZ A;  5CQ7 A;  4YC9 A;  4BHW A;  3P1C A;  4UYF A;  5FE2 A;  5CQ6 A;  3K2J A;  3FKM X;  4BW3 A;  4ALH A;  5L97 A;  5FFV A;  5D26 A;  2DKW A;  4GPJ A;  4YH3 A;  3Q2E A;  3U5L A;  4NXJ A;  5BT3 A;  4TS8 A;  4TT6 A;  4Z1Q A;  4TTE A;  5HRX A;  4UIT A;  5ENH A;  3ONI A;  2WP2 A;  4O7E A;  4A9L A;  2E7N A;  4WIV A;  5EM3 A;  2N9G A;  5DKH A;  5FH8 A;  3HMH A;  5LJ0 A;  5HQ7 A;  4HXM A;  5FB1 A;  4PCI A;  5KHM A;  2D82 A;  5LJ1 A;  5E9K A;  2OO1 A;  4Y03 A;  5D3N A;  5G4R A;  5IID A;  4LDF A;  2RNX A;  5DYA A;  5FDZ A;  4BW2 A;  5FH7 A;  4QY4 A;  3MUL A;  5EPR A;  4IR4 A;  4NR4 A;  5CUC A;  2YDW A;  4DON A;  3ZYU A;  5A5P A;  4NR7 A;  3DAI A;  5LKZ A;  4UYD A;  3U5J A;  4HBX A;  2L85 A;  4NYW A;  5E9L A;  3UVY A;  5ENI A;  5KTW A;  1ZS5 A;  2DVV A;  1JSP B;  5H1V A;  4A9J A;  5CP5 A;  4BW4 A;  5E3D A;  5D3T A;  4PY6 A;  5EP7 A;  5HEN A;  3IU6 A;  5EQ1 A;  3UV2 A;  5DYU A;  3JVL A;  4QSR A;  5EWC A;  5BT5 A;  5L98 A;  2DVR A;  3O34 A;  5C7N A;  4BJX A;  5A5R A;  4O7C A;  4Q0O A;  5HM0 A;  4XY9 A;  5E7D A;  5I40 A;  1EQF A;  3G0L A;  4QSV A;  2YEK A;  3SVG A;  4HXN A;  4RVR A;  4O72 A;  4YYH A;  4A9K A;  5ACY A;  2YQD A;  4IOQ A;  5A85 A;  3O35 A;  5IGL A;  5E9Y A;  4KCX A;  5C87 A;  5D3H A;  5H1U A;  4HBY A;  4AKN A;  3SVF A;  4NS5 A;  4UIW A;  5DW2 A;  5EWW A;  2L5E A;  5L8U A;  4YBS A;  4IR6 A;  5JWM A;  5D3S A;  4NYX A;  4CUP A;  4TU4 A;  5FE3 A;  1WUG A;  5EK9 A;  3QZT A;  2R0V A;  4HXP A;  4LZS A;  4MR4 A;  5IG6 A;  4QR3 A;  5HLS A;  4MR6 A;  5K29 A;  4WHW A;  4O75 A;  2OSS A;  5F2P A;  4OUF A;  5FFW A;  4CFK A;  5FE8 A;  1E6I A;  4QR5 A;  3UV5 A;  2E3K A;  4XUA A;  4F3I A;  4O7A A;  5CRZ A;  5ENC A;  4QSP A;  5IGK A;  5I1Q A;  3S92 A;  5L8T A;  4YYD A;  5ENE A;  5JI8 A;  5F5Z A;  5FE5 A;  4MEP A;  4QNS A;  5I29 A;  5CUD A;  5FB0 A;  4LR6 A;  5C4Q A;  3G0J A;  3QZV A;  4HBW A;  5I7X A;  3MUK A;  5DKC A;  4A9I A;  5FG6 A;  5F63 A;  4O78 A;  3HMF A;  4LZ2 A;  5EGU A;  5CQA A;  4CLB A;  3U5N A;  5I86 A;  5C89 A;  5G4S A;  5FE6 A;  3UVD A;  5FG5 A;  4BW1 A;  5E73 A;  5HFR A;  5CU8 A;  5FFY A;  5E74 A;  5H85 A;  5DKD A;  4N4F A;  4CUQ A;  4ALG A;  5E9I A;  4IOR A;  5CQ8 A;  4WHU A;  5FG4 A;  5DLZ A;  5DY7 A;  4YYK A;  5CRM A;  5LUU A;  3UVW A;  5CQ5 A;  4QC3 A;  4NQM A;  5I83 A;  5DFB A;  3P5O A;  4J0S A;  4YAX A;  4YYG A;  4CFL A;  3D7C A;  5EWD A;  5ETB A;  4YY4 A;  5C8G A;  4ZC9 A;  4QUU A;  4HXR A;  4PKL A;  2I7K A;  5FE7 A;  3MXF A;  5E3G A;  4MEN A;  5BT4 A;  5HEM A;  4J1P A;  3P1E A;  4LYI A;  4N4G A;  4NRA A;  4TU6 A;  5LKU A;  4PTB A;  4C67 A;  3JVJ A;  4LC2 A;  3AAD A;  5DX4 A;  1N72 A;  5CS8 A;  5E9M A;  4TZ2 A;  3UW9 A;  2DVQ A;  4QYD A;  5EU1 A;  4NR8 A;  4OGI A;  4YBT A;  5D7X A;  5KTU A;  4A9N A;  4UIX A;  3GG3 A;  4YY6 A;  5A5Q A;  5D0C A;  5HQ6 A;  5F62 A;  5A81 A;  3IU5 A;  3LQJ A;  4YYM A;  5J0D A;  1WUM A;  5I89 A;  2RS9 B;  4O70 A;  4CUS A;  5II2 A;  4C66 A;  5I88 A;  2YEL A;  4QR4 A;  5HRV A;  5TCM A;  3MQM A;  5CQ3 A;  2OUO A;  5IGM A;  3U5M A;  5DBM A;  4QEW A;  4IR3 A;  4A9F A;  4QEV A;  5CQT A;  3O37 A;  4XYA A;  5DFC A;  4NRC A;  5A7C A;  2RI7 A;  2NXB A;  4UYF B;  5FH6 A;  4QSX A;  4FLP A;  4YYN A;  5TB6 A;  3LQH A;  5DW1 A;  4LRG A;  2RO1 A;  1F68 A;  5D3L A;  5CTL A;  4ZW1 A;  2LSP B;  4Q0N A;  5LKX A;  4QC1 A;  4QUT A;  5ENB A;  5EPS A;  4Z93 A;  4A9H A;  2DVS A;  5LKT A;  5FE9 A;  4QBM A;  5D3J A;  4HXS A;  5KU3 A;  4HXL A;  4LYS A;  4IOO A;  4UYE A;  4PCE A;  3LQI A;  3S91 A;  2RNY A;  2R0Y A;  4O7B A;  5ENJ A;  4CUR A;  4TZ8 A;  2D9E A;  2F6N A;  4Z1S A;  5IBN A;  2RFJ A;  4CUU A;  4OGJ A;  5EIS A;  4UIV A;  4CL9 A;  5HQ5 A;  3SVH A;  3LJW A;  4QSU A;  5CQ4 A;  3UVX A;  3TLP A;  5F36 A;  5A5N A;  3MB4 A;  3U5K A;  5FE1 A;  2WP1 A;  4TT2 A;  4XUB A;  5FBX A;  5FE4 A;  2R10 A;  5DFD A;  4O71 A;  5H1T A;  5F25 A;  2E7O A;  2KTB B;  1JM4 B;  5ENF A;  5ETD A;  5EIC A;  2RNW A;  4YYJ A;  3QZS A;  4XY8 A;  2F6J A;  5D24 A;  1X0J A;  4O74 A;  5EV9 A;  5F61 A;  4KV4 A;  4QB3 A;  5F1H A;  4MEQ A;  4N4I A;  5COI A;  4X2I A;  3U5P A;  4UYH A;  5D25 A;  5L99 A;  4N3W A;  5EWV A;  2YEM A;  3HME A;  4N4H A;  5KTX A;  5CPE A;  5DYX A;  5LVR A;  4UIU A;  5CUG A;  3MB3 A;  4CUT A;  4J0R A;  3P1F A;  4YYI A;  4QSW A;  5HCL A;  4TYL A;  4QSQ A;  4O76 A;  4Z6H A;  4NRB A;  4QEU A;  3UV4 A;  5KO4 A;  2MJV B;  4YAB A;  2FSA A;  5EA1 A;  5F1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...