5ENFA

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with fragment-4 n10142 (sgc - diamond i04-1 fragment screening)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
123
structure length
123
Chain Sequence
SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords PH-interacting protein
publication title A poised fragment library enables rapid synthetic expansion yielding the first reported inhibitors of PHIP(2), an atypical bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5enfA00
2YEKA 5CS8A 4QEUA 2WP2A 5DW2A 4OUFA 4QSRA 5C89A 1JSPB 5H1VA 5FE5A 2L85A 5FE7A 4UIYA 5JWMA 4A9EA 5F36A 3P1FA 5F60A 5IGKA 4NRCA 5CP5A 1JM4B 4KV1A 3QZTA 3Q2FA 5ENEA 2RNYA 4J1PA 3U5LA 2R0SA 4IOOA 4A9MA 4UIVA 5CUEA 4PKLA 5A5OA 2RI7A 2YEMA 5F3AA 4QR4A 5EPBA 4HXMA 4Z1SA 5ENGA 4LDFA 4YYIA 2DWWA 5E0RA 4N4IA 4NR4A 4QYDA 4HXSA 5EICA 4QB3A 4UYDA 4NXJA 5EV9A 5CRZA 5LKTA 5ACYA 4QSXA 3LJWA 5KO4A 2FSAA 3Q2EA 4UITA 2WP1A 4CLBA 3DWYA 4QSVA 4HXPA 3P1CA 3LXJA 5E74A 5FB1A 3U5MA 3IU6A 5G4RA 4NR5A 4CFLA 2OSSA 5ENIA 4YYDA 4OGJA 4NUDA 5ETDA 3MUKA 5A83A 4UIZA 5HRXA 5EI4A 4YH4A 4UYFB 5F5ZA 5EK9A 3HMHA 4O75A 5D0CA 4KV4A 5CUGA 4YBTA 5EA1A 4BW2A 5CU8A 4LZSA 2I8NA 4QZSA 5DY7A 5HRWA 4TZ2A 5LUUA 3ONIA 5FG4A 2E7OA 4MR4A 2GRCA 4QSSA 4TT6A 5DX4A 5JI8A 4N3WA 4Z93A 1F68A 5DYXA 5E3DA 4HXKA 4ALGA 3FKMX 2F6JA 2KTBB 5IG6A 4HXNA 4UYGA 5CY9A 4QUUA 4QSWA 5DYAA 4J0RA 4GPJA 3UVYA 4YADA 4A9NA 5HM0A 5E73A 3MQMA 4XY9A 4QSPA 5A5RA 4NR7A 4UYEA 5HFRA 2DKWA 5DYUA 3MULA 5IGNA 5L8TA 2E7NA 4LYWA 4O74A 5HRVA 5CQ8A 5BT4A 5CQ5A 5D7XA 4RVRA 2RNWA 3QZVA 5C8GA 4ALHA 4NS5A 5G4SA 5EQ1A 5H85A 1EQFA 4UIXA 5D3SA 4WHWA 2R10A 4YYKA 5EPSA 4MR3A 5D3HA 4TT2A 3I3JA 4NYWA 5EISA 3UV4A 5H1TA 4YK0A 3RCWA 5CUAA 1X0JA 5FE1A 5A5QA 4QSQA 3JVKA 5D3NA 4Y03A 5EM3A 4N4GA 5TCMA 5EWWA 2DVRA 4BW1A 4YYJA 4YYMA 5E9LA 5E9KA 5DKDA 5FFYA 2R0VA 5CQ4A 4YYNA 4NQNA 4QEVA 5D24A 2H60A 5CUCA 5LKUA 5I7YA 5A5SA 4O71A 2DVSA 5A5PA 5LKXA 4F3IA 5HQ6A 4HXOA 2YW5A 4LRGA 5FFWA 4O76A 5CTLA 2L84A 5LJ2A 5KTWA 1WUMA 4LR6A 5FDZA 4TS8A 5FBXA 3U5OA 3JVLA 4CUQA 4MENA 3U5NA 5FG5A 5D25A 5FH7A 5I83A 5HFQA 4CL9A 5HCLA 5DFDA 1ZS5A 4O7AA 3UVXA 4CFKA 5CQ7A 5CQ3A 5D3RA 5A82A 3SVGA 4LYIA 5HEMA 3GG3A 5FE0A 2OO1A 2RO1A 2D9EA 5I40A 4NR9A 5K29A 4HXRA 4LZ2A 3UVWA 4YBSA 4J3IA 5ENFA 5ENHA 5FB0A 5I89A 5A7CA 4BW4A 5HQ5A 3AQAA 4IOQA 3P5OA 4NQMA 5F25A 3U5PA 3O36A 4Q0OA 4UYFA 2DVQA 5II2A 5E9MA 5EU1A 2G4AA 3O33A 3UW9A 3MXFA 4TZ8A 4O72A 4HBWA 2DVVA 4N4FA 4MEPA 5EPRA 5II1A 4A9LA 4O78A 5EWHA 4QSTA 5I1QA 4WIVA 5EGUA 4QSUA 5FG6A 4A9OA 5C85A 2F6NA 2I7KA 5EP7A 5CFWA 4QBMA 3UV5A 4IR3A 4PY6A 5LJ1A 5KTUA 4BHWA 5FE6A 2R0YA 4ZW1A 5CQTA 4NUCA 5L97A 5A5NA 3O35A 4A9HA 5AMEA 4O70A 5E9VA 3SVFA 3QZSA 5BT3A 4Z1QA 5FH8A 3UV2A 4BW3A 4KCXA 5FH6A 3LQHA 5KHMA 5DYCA 4O77A 5L96A 2D82A 5AD3A 4A9KA 3IU5A 4TQNA 4QYLA 5J0DA 4HBYA 5DFCA 5CUDA 5C4QA 4QR3A 4YABA 3S92A 4QY4A 5DLZA 3S91A 3NXBA 5EWDA 4A9JA 3K2JA 4CUPA 5LVRA 5LVQA 3O37A 4E96A 3HMEA 4Z6IA 4WHUA 5HQ7A 5A85A 4QR5A 4C67A 4UIUA 3MB3A 5ENJA 2E3KA 4NRBA 4LC2A 5CUBA 4QNSA 1WUGA 5D3LA 3SVHA 4O7FA 4C66A 4QC1A 5CQAA 5IIDA 1E6IA 2YQDA 4QEWA 4CURA 3P1EA 4A9FA 5DKHA 5KTXA 4O7CA 5L8UA 5HENA 4CUSA 5F63A 4TYLA 2OUOA 3MB4A 5C7NA 4O7EA 4UIWA 4NR8A 4ZQLA 5COIA 5F1LA 5ENCA 5E3GA 3HMFA 4NYXA 4MEOA 4XUAA 5IGMA 5I29A 4J0SA 3UVDA 5IBNA 5EWCA 5E7DA 4XYAA 4HBXA 4CUUA 5CRMA 5F61A 5I7XA 4YH3A 4IORA 2RNXA 5BT5A 5D3PA 1N72A 5DW1A 3G0LA 5E9IA 5AD2A 4OGIA 4PCEA 2N9GA 5E9YA 3ZYUA 3U5JA 4IR5A 5HJCA 5KU3A 5L99A 4ZC9A 4YBMA 5ETBA 4YC9A 2RS9B 4LYSA 5FE8A 4BJXA 5DFBA 4MR6A 4O7BA 4TT4A 2NXBA 3P1DA 4HBVA 4YYGA 4AKNA 3JVJA 5D3TA 5ENBA 4Q0NA 5D3JA 5DLXA 4MEQA 3AADA 4FLPA 4YAXA 5L98A 2RFJA 4DONA 4LZRA 5TB6A 4CUTA 4QUTA 4NYVA 5A81A 5FE2A 5LKZA 5CQ6A 5LJ0A 5AMFA 2YYNA 5CPEA 5D26A 5F1HA 5F62A 4PS5A 5FE4A 4NRAA 4A9IA 4MR5A 4YY6A 4YYHA 5EVAA 3JVMA 3LQIA 4TTEA 5DBMA 4IR6A 5DKCA 2LSPB 5CZGA 5HLSA 2YELA 4TU4A 2DATA 3DAIA 3TLPA 5FE9A 4XUBA 2YDWA 5F2PA 3D7CA 5I88A 2L5EA 4NR6A 4NUEA 4N4HA 5IGLA 4YATA 4IR4A 2MJVB 5FFVA 5I86A 4UYHA 4HXLA 4X2IA 5EWVA 4Z6HA 4QC3A 5HELA 5C87A 4YY4A 5CGPA 5I80A 3LQJA 3G0JA 3U5KA 4TU6A 5H1UA 4XY8A 5FE3A 4PTBA 4PCIA 3O34A
chains in the Genus database with same CATH superfamily
2YEKA 5CS8A 4QEUA 2WP2A 5DW2A 4OUFA 4QSRA 5C89A 1JSPB 5H1VA 5FE5A 2L85A 5FE7A 4UIYA 5JWMA 4A9EA 3ERRA 4AKGA 5F36A 3P1FA 5F60A 5IGKA 4NRCA 5CP5A 1JM4B 4KV1A 3QZTA 3Q2FA 5ENEA 2RNYA 4J1PA 3U5LA 2R0SA 4IOOA 4A9MA 4UIVA 5CUEA 4PKLA 5A5OA 2RI7A 2YEMA 5F3AA 4QR4A 5EPBA 4HXMA 4Z1SA 5ENGA 4LDFA 4YYIA 2DWWA 3VKHA 5E0RA 4N4IA 4NR4A 4QYDA 4HXSA 5EICA 4QB3A 4UYDA 4NXJA 5EV9A 5CRZA 5LKTA 5ACYA 4QSXA 3LJWA 5KO4A 2FSAA 3Q2EA 4UITA 2WP1A 4CLBA 3DWYA 4QSVA 4HXPA 3P1CA 3LXJA 5E74A 5FB1A 3U5MA 3IU6A 5G4RA 4NR5A 4CFLA 2OSSA 5ENIA 4YYDA 4OGJA 4NUDA 5ETDA 3MUKA 5A83A 4UIZA 5HRXA 5EI4A 4YH4A 4UYFB 5F5ZA 5EK9A 3HMHA 4O75A 5D0CA 4KV4A 5CUGA 4YBTA 5EA1A 4BW2A 5CU8A 4LZSA 2I8NA 4QZSA 5DY7A 5HRWA 4TZ2A 5LUUA 3ONIA 5FG4A 2E7OA 4MR4A 2EJNA 2GRCA 4QSSA 4TT6A 5DX4A 5JI8A 4N3WA 4Z93A 1F68A 5DYXA 5E3DA 4HXKA 4ALGA 3FKMX 2F6JA 2KTBB 3D1DA 5IG6A 4HXNA 4UYGA 5CY9A 4QUUA 4QSWA 5DYAA 4J0RA 4GPJA 3UVYA 4YADA 4A9NA 5HM0A 5E73A 3MQMA 4XY9A 4QSPA 5A5RA 4NR7A 4UYEA 5HFRA 2DKWA 5DYUA 3MULA 5IGNA 5L8TA 2E7NA 4LYWA 4O74A 5HRVA 5CQ8A 5BT4A 5CQ5A 5D7XA 4RVRA 2RNWA 3QZVA 5C8GA 4ALHA 4NS5A 5G4SA 5EQ1A 5H85A 1EQFA 4UIXA 5D3SA 4WHWA 2R10A 4YYKA 5EPSA 4MR3A 5D3HA 4TT2A 3I3JA 4NYWA 5EISA 3UV4A 5H1TA 4YK0A 3RCWA 5CUAA 1X0JA 5FE1A 5A5QA 4QSQA 3JVKA 5D3NA 4Y03A 5EM3A 4N4GA 5TCMA 5EWWA 2DVRA 4BW1A 4YYJA 4YYMA 5E9LA 5E9KA 5DKDA 5FFYA 2R0VA 5CQ4A 4YYNA 4NQNA 4QEVA 5D24A 2H60A 5CUCA 5LKUA 5I7YA 4AKIA 5A5SA 4O71A 2DVSA 5A5PA 5LKXA 4F3IA 5HQ6A 4HXOA 2YW5A 4LRGA 5FFWA 4O76A 5CTLA 2L84A 5LJ2A 5KTWA 1WUMA 4LR6A 5FDZA 4TS8A 5FBXA 3U5OA 3JVLA 4CUQA 4MENA 3U5NA 5FG5A 5D25A 5FH7A 5I83A 5HFQA 4CL9A 5HCLA 5DFDA 1ZS5A 4O7AA 3UVXA 4CFKA 5CQ7A 5CQ3A 5D3RA 5A82A 3SVGA 4LYIA 5HEMA 3GG3A 5FE0A 2OO1A 1PUOA 2RO1A 2D9EA 5I40A 4NR9A 5K29A 4HXRA 4LZ2A 3UVWA 4YBSA 4J3IA 5ENFA 5ENHA 5FB0A 5I89A 5A7CA 4BW4A 5HQ5A 3AQAA 4IOQA 3P5OA 4NQMA 5F25A 3U5PA 3O36A 4Q0OA 4UYFA 2DVQA 5II2A 5E9MA 5EU1A 2G4AA 3O33A 3UW9A 3MXFA 4TZ8A 4O72A 4HBWA 4AKHA 2DVVA 4N4FA 4MEPA 5EPRA 5II1A 4A9LA 4O78A 5EWHA 4QSTA 5I1QA 4WIVA 5EGUA 4QSUA 5FG6A 4A9OA 4AI6A 5C85A 2F6NA 2I7KA 5EP7A 5CFWA 4QBMA 3UV5A 4IR3A 4PY6A 5LJ1A 5KTUA 4BHWA 5FE6A 2R0YA 4ZW1A 5CQTA 4NUCA 5L97A 5A5NA 3O35A 4A9HA 5AMEA 4O70A 5E9VA 3SVFA 3QZSA 5BT3A 4Z1QA 5FH8A 3UV2A 4BW3A 4KCXA 5FH6A 3LQHA 5KHMA 5DYCA 4O77A 5L96A 2D82A 5AD3A 4A9KA 3IU5A 4TQNA 4QYLA 5J0DA 4HBYA 5DFCA 5CUDA 5C4QA 4QR3A 4YABA 3S92A 4QY4A 5DLZA 3S91A 3NXBA 5EWDA 4A9JA 3K2JA 4CUPA 5LVRA 5LVQA 3O37A 4E96A 3HMEA 4Z6IA 4WHUA 5HQ7A 5A85A 4QR5A 4C67A 4UIUA 3MB3A 5ENJA 2E3KA 4NRBA 4LC2A 5CUBA 4QNSA 1WUGA 5D3LA 3SVHA 4O7FA 4C66A 4QC1A 5CQAA 3VKGA 5IIDA 1E6IA 2YQDA 4QEWA 4CURA 3P1EA 4A9FA 5DKHA 5KTXA 4O7CA 5L8UA 5HENA 4CUSA 5F63A 4TYLA 2OUOA 3MB4A 5C7NA 4O7EA 4UIWA 4NR8A 4ZQLA 5COIA 5F1LA 5ENCA 5E3GA 3HMFA 4NYXA 4MEOA 4XUAA 5IGMA 5I29A 4J0SA 3UVDA 5IBNA 5EWCA 5E7DA 4XYAA 4HBXA 4CUUA 5CRMA 5F61A 5I7XA 4YH3A 4IORA 2RNXA 5BT5A 5D3PA 1N72A 5DW1A 3G0LA 5E9IA 5AD2A 4OGIA 4PCEA 2N9GA 5E9YA 3ZYUA 3U5JA 4IR5A 5HJCA 5KU3A 5L99A 4ZC9A 3D1BA 5ETBA 4YBMA 4YC9A 2RS9B 4LYSA 5FE8A 4BJXA 5DFBA 4MR6A 4O7BA 4TT4A 2NXBA 3P1DA 4HBVA 4YYGA 4AKNA 3JVJA 5D3TA 5ENBA 4Q0NA 5D3JA 5DLXA 4MEQA 3AADA 4FLPA 4YAXA 5L98A 2RFJA 4DONA 4LZRA 5TB6A 4CUTA 4QUTA 4NYVA 5A81A 5FE2A 5LKZA 5CQ6A 5LJ0A 5AMFA 2YYNA 5CPEA 5D26A 5F1HA 5F62A 4PS5A 5FE4A 4NRAA 4A9IA 4MR5A 1ZKRA 4YY6A 4YYHA 5EVAA 3JVMA 3LQIA 4TTEA 5DBMA 4IR6A 5DKCA 2LSPB 5CZGA 5HLSA 2YELA 4TU4A 2DATA 3DAIA 3TLPA 5FE9A 4XUBA 2YDWA 5F2PA 3D7CA 5I88A 2L5EA 4NR6A 4NUEA 4N4HA 5IGLA 4YATA 4IR4A 2MJVB 5FFVA 5I86A 4UYHA 4HXLA 4X2IA 5EWVA 4Z6HA 4QC3A 5HELA 5C87A 4YY4A 5CGPA 5I80A 3LQJA 3G0JA 3U5KA 4TU6A 5H1UA 4XY8A 5FE3A 4PTBA 4PCIA 3O34A
chains in the Genus database with same CATH topology
2YEKA 5CS8A 4QEUA 2WP2A 5DW2A 4OUFA 4QSRA 5C89A 1JSPB 5H1VA 5FE5A 2L85A 5FE7A 4UIYA 5JWMA 4A9EA 5F36A 3P1FA 5F60A 5IGKA 4NRCA 5CP5A 1JM4B 4KV1A 3QZTA 3Q2FA 5ENEA 2RNYA 4J1PA 3U5LA 2R0SA 4IOOA 4A9MA 4UIVA 5CUEA 4PKLA 5A5OA 2RI7A 2YEMA 5F3AA 4QR4A 5EPBA 4HXMA 4Z1SA 5ENGA 4LDFA 4YYIA 2DWWA 5E0RA 4N4IA 4NR4A 4QYDA 4HXSA 5EICA 4QB3A 4UYDA 4NXJA 5EV9A 5CRZA 5LKTA 5ACYA 4QSXA 3LJWA 5KO4A 2FSAA 3Q2EA 4UITA 2WP1A 4CLBA 3DWYA 4QSVA 4HXPA 3P1CA 3LXJA 5E74A 5FB1A 3U5MA 3IU6A 5G4RA 4NR5A 4CFLA 2OSSA 5ENIA 4YYDA 4OGJA 4NUDA 5ETDA 3MUKA 5A83A 4UIZA 5HRXA 5EI4A 4YH4A 4UYFB 5F5ZA 5EK9A 3HMHA 4O75A 5D0CA 4KV4A 5CUGA 4YBTA 5EA1A 4BW2A 5CU8A 4LZSA 2I8NA 4QZSA 5DY7A 5HRWA 4TZ2A 5LUUA 3ONIA 5FG4A 2E7OA 4MR4A 2GRCA 4QSSA 4TT6A 5DX4A 5JI8A 4N3WA 4Z93A 1F68A 5DYXA 5E3DA 4HXKA 4ALGA 3FKMX 2F6JA 2KTBB 5IG6A 4HXNA 4UYGA 5CY9A 4QUUA 4QSWA 5DYAA 4J0RA 4GPJA 3UVYA 4YADA 4A9NA 5HM0A 5E73A 3MQMA 4XY9A 4QSPA 5A5RA 4NR7A 4UYEA 5HFRA 2DKWA 5DYUA 3MULA 5IGNA 5L8TA 2E7NA 4LYWA 4O74A 5HRVA 5CQ8A 5BT4A 5CQ5A 5D7XA 4RVRA 2RNWA 3QZVA 5C8GA 4ALHA 4NS5A 5G4SA 5EQ1A 5H85A 1EQFA 4UIXA 5D3SA 4WHWA 2R10A 4YYKA 5EPSA 4MR3A 5D3HA 4TT2A 3I3JA 4NYWA 5EISA 3UV4A 5H1TA 4YK0A 3RCWA 5CUAA 1X0JA 5FE1A 5A5QA 4QSQA 3JVKA 5D3NA 4Y03A 5EM3A 4N4GA 5TCMA 5EWWA 2DVRA 4BW1A 4YYJA 4YYMA 5E9LA 5E9KA 5DKDA 5FFYA 2R0VA 5CQ4A 4YYNA 4NQNA 4QEVA 5D24A 2H60A 5CUCA 5LKUA 5I7YA 5A5SA 4O71A 2DVSA 5A5PA 5LKXA 4F3IA 5HQ6A 4HXOA 2YW5A 4LRGA 5FFWA 4O76A 5CTLA 2L84A 5LJ2A 5KTWA 1WUMA 4LR6A 5FDZA 4TS8A 5FBXA 3U5OA 3JVLA 4CUQA 4MENA 3U5NA 5FG5A 5D25A 5FH7A 5I83A 5HFQA 4CL9A 5HCLA 5DFDA 1ZS5A 4O7AA 3UVXA 4CFKA 5CQ7A 5CQ3A 5D3RA 5A82A 3SVGA 4LYIA 5HEMA 3GG3A 5FE0A 2OO1A 2RO1A 2D9EA 5I40A 4NR9A 5K29A 4HXRA 4LZ2A 3UVWA 4YBSA 4J3IA 5ENFA 5ENHA 5FB0A 5I89A 5A7CA 4BW4A 5HQ5A 3AQAA 4IOQA 3P5OA 4NQMA 5F25A 3U5PA 3O36A 4Q0OA 4UYFA 2DVQA 5II2A 5E9MA 5EU1A 2G4AA 3O33A 3UW9A 3MXFA 4TZ8A 4O72A 4HBWA 2DVVA 4N4FA 4MEPA 5EPRA 5II1A 4A9LA 4O78A 5EWHA 4QSTA 5I1QA 4WIVA 5EGUA 4QSUA 5FG6A 4A9OA 5C85A 2F6NA 2I7KA 5EP7A 5CFWA 4QBMA 3UV5A 4IR3A 4PY6A 5LJ1A 5KTUA 4BHWA 5FE6A 2R0YA 4ZW1A 5CQTA 4NUCA 5L97A 5A5NA 3O35A 4A9HA 5AMEA 4O70A 5E9VA 3SVFA 3QZSA 5BT3A 4Z1QA 5FH8A 3UV2A 4BW3A 4KCXA 5FH6A 3LQHA 5KHMA 5DYCA 4O77A 5L96A 2D82A 5AD3A 4A9KA 3IU5A 4TQNA 4QYLA 5J0DA 4HBYA 5DFCA 5CUDA 5C4QA 4QR3A 4YABA 3S92A 4QY4A 5DLZA 3S91A 3NXBA 5EWDA 4A9JA 3K2JA 4CUPA 5LVRA 5LVQA 3O37A 4E96A 3HMEA 4Z6IA 4WHUA 5HQ7A 5A85A 4QR5A 4C67A 4UIUA 3MB3A 5ENJA 2E3KA 4NRBA 4LC2A 5CUBA 4QNSA 1WUGA 5D3LA 3SVHA 4O7FA 4C66A 4QC1A 5CQAA 5IIDA 1E6IA 2YQDA 4QEWA 4CURA 3P1EA 4A9FA 5DKHA 5KTXA 4O7CA 5L8UA 5HENA 4CUSA 5F63A 4TYLA 2OUOA 3MB4A 5C7NA 4O7EA 4UIWA 4NR8A 4ZQLA 5COIA 5F1LA 5ENCA 5E3GA 3HMFA 4NYXA 4MEOA 4XUAA 5IGMA 5I29A 4J0SA 3UVDA 5IBNA 5EWCA 5E7DA 4XYAA 4HBXA 4CUUA 5CRMA 5F61A 5I7XA 4YH3A 4IORA 2RNXA 5BT5A 5D3PA 1N72A 5DW1A 3G0LA 5E9IA 5AD2A 4OGIA 4PCEA 2N9GA 5E9YA 3ZYUA 3U5JA 4IR5A 5HJCA 5KU3A 5L99A 4ZC9A 4YBMA 5ETBA 4YC9A 2RS9B 4LYSA 5FE8A 4BJXA 5DFBA 4MR6A 4O7BA 4TT4A 2NXBA 3P1DA 4HBVA 4YYGA 4AKNA 3JVJA 5D3TA 5ENBA 4Q0NA 5D3JA 5DLXA 4MEQA 3AADA 4FLPA 4YAXA 5L98A 2RFJA 4DONA 4LZRA 5TB6A 4CUTA 4QUTA 4NYVA 5A81A 5FE2A 5LKZA 5CQ6A 5LJ0A 5AMFA 2YYNA 5CPEA 5D26A 5F1HA 5F62A 4PS5A 5FE4A 4NRAA 4A9IA 4MR5A 4YY6A 4YYHA 5EVAA 3JVMA 3LQIA 4TTEA 5DBMA 4IR6A 5DKCA 2LSPB 5CZGA 5HLSA 2YELA 4TU4A 2DATA 3DAIA 3TLPA 5FE9A 4XUBA 2YDWA 5F2PA 3D7CA 5I88A 2L5EA 4NR6A 4NUEA 4N4HA 5IGLA 4YATA 4IR4A 2MJVB 5FFVA 5I86A 4UYHA 4HXLA 4X2IA 5EWVA 4Z6HA 4QC3A 5HELA 5C87A 4YY4A 5CGPA 5I80A 3LQJA 3G0JA 3U5KA 4TU6A 5H1UA 4XY8A 5FE3A 4PTBA 4PCIA 3O34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEK A;  5CS8 A;  4QEU A;  2WP2 A;  5DW2 A;  4OUF A;  4QSR A;  5C89 A;  1JSP B;  5H1V A;  5FE5 A;  2L85 A;  5FE7 A;  4UIY A;  5JWM A;  4A9E A;  5F36 A;  3P1F A;  5F60 A;  5IGK A;  4NRC A;  5CP5 A;  1JM4 B;  4KV1 A;  3QZT A;  3Q2F A;  5ENE A;  2RNY A;  4J1P A;  3U5L A;  2R0S A;  4IOO A;  4A9M A;  4UIV A;  5CUE A;  4PKL A;  5A5O A;  2RI7 A;  2YEM A;  5F3A A;  4QR4 A;  5EPB A;  4HXM A;  4Z1S A;  5ENG A;  4LDF A;  4YYI A;  2DWW A;  5E0R A;  4N4I A;  4NR4 A;  4QYD A;  4HXS A;  5EIC A;  4QB3 A;  4UYD A;  4NXJ A;  5EV9 A;  5CRZ A;  5LKT A;  5ACY A;  4QSX A;  3LJW A;  5KO4 A;  2FSA A;  3Q2E A;  4UIT A;  2WP1 A;  4CLB A;  3DWY A;  4QSV A;  4HXP A;  3P1C A;  3LXJ A;  5E74 A;  5FB1 A;  3U5M A;  3IU6 A;  5G4R A;  4NR5 A;  4CFL A;  2OSS A;  5ENI A;  4YYD A;  4OGJ A;  4NUD A;  5ETD A;  3MUK A;  5A83 A;  4UIZ A;  5HRX A;  5EI4 A;  4YH4 A;  4UYF B;  5F5Z A;  5EK9 A;  3HMH A;  4O75 A;  5D0C A;  4KV4 A;  5CUG A;  4YBT A;  5EA1 A;  4BW2 A;  5CU8 A;  4LZS A;  2I8N A;  4QZS A;  5DY7 A;  5HRW A;  4TZ2 A;  5LUU A;  3ONI A;  5FG4 A;  2E7O A;  4MR4 A;  2GRC A;  4QSS A;  4TT6 A;  5DX4 A;  5JI8 A;  4N3W A;  4Z93 A;  1F68 A;  5DYX A;  5E3D A;  4HXK A;  4ALG A;  3FKM X;  2F6J A;  2KTB B;  5IG6 A;  4HXN A;  4UYG A;  5CY9 A;  4QUU A;  4QSW A;  5DYA A;  4J0R A;  4GPJ A;  3UVY A;  4YAD A;  4A9N A;  5HM0 A;  5E73 A;  3MQM A;  4XY9 A;  4QSP A;  5A5R A;  4NR7 A;  4UYE A;  5HFR A;  2DKW A;  5DYU A;  3MUL A;  5IGN A;  5L8T A;  2E7N A;  4LYW A;  4O74 A;  5HRV A;  5CQ8 A;  5BT4 A;  5CQ5 A;  5D7X A;  4RVR A;  2RNW A;  3QZV A;  5C8G A;  4ALH A;  4NS5 A;  5G4S A;  5EQ1 A;  5H85 A;  1EQF A;  4UIX A;  5D3S A;  4WHW A;  2R10 A;  4YYK A;  5EPS A;  4MR3 A;  5D3H A;  4TT2 A;  3I3J A;  4NYW A;  5EIS A;  3UV4 A;  5H1T A;  4YK0 A;  3RCW A;  5CUA A;  1X0J A;  5FE1 A;  5A5Q A;  4QSQ A;  3JVK A;  5D3N A;  4Y03 A;  5EM3 A;  4N4G A;  5TCM A;  5EWW A;  2DVR A;  4BW1 A;  4YYJ A;  4YYM A;  5E9L A;  5E9K A;  5DKD A;  5FFY A;  2R0V A;  5CQ4 A;  4YYN A;  4NQN A;  4QEV A;  5D24 A;  2H60 A;  5CUC A;  5LKU A;  5I7Y A;  5A5S A;  4O71 A;  2DVS A;  5A5P A;  5LKX A;  4F3I A;  5HQ6 A;  4HXO A;  2YW5 A;  4LRG A;  5FFW A;  4O76 A;  5CTL A;  2L84 A;  5LJ2 A;  5KTW A;  1WUM A;  4LR6 A;  5FDZ A;  4TS8 A;  5FBX A;  3U5O A;  3JVL A;  4CUQ A;  4MEN A;  3U5N A;  5FG5 A;  5D25 A;  5FH7 A;  5I83 A;  5HFQ A;  4CL9 A;  5HCL A;  5DFD A;  1ZS5 A;  4O7A A;  3UVX A;  4CFK A;  5CQ7 A;  5CQ3 A;  5D3R A;  5A82 A;  3SVG A;  4LYI A;  5HEM A;  3GG3 A;  5FE0 A;  2OO1 A;  2RO1 A;  2D9E A;  5I40 A;  4NR9 A;  5K29 A;  4HXR A;  4LZ2 A;  3UVW A;  4YBS A;  4J3I A;  5ENF A;  5ENH A;  5FB0 A;  5I89 A;  5A7C A;  4BW4 A;  5HQ5 A;  3AQA A;  4IOQ A;  3P5O A;  4NQM A;  5F25 A;  3U5P A;  3O36 A;  4Q0O A;  4UYF A;  2DVQ A;  5II2 A;  5E9M A;  5EU1 A;  2G4A A;  3O33 A;  3UW9 A;  3MXF A;  4TZ8 A;  4O72 A;  4HBW A;  2DVV A;  4N4F A;  4MEP A;  5EPR A;  5II1 A;  4A9L A;  4O78 A;  5EWH A;  4QST A;  5I1Q A;  4WIV A;  5EGU A;  4QSU A;  5FG6 A;  4A9O A;  5C85 A;  2F6N A;  2I7K A;  5EP7 A;  5CFW A;  4QBM A;  3UV5 A;  4IR3 A;  4PY6 A;  5LJ1 A;  5KTU A;  4BHW A;  5FE6 A;  2R0Y A;  4ZW1 A;  5CQT A;  4NUC A;  5L97 A;  5A5N A;  3O35 A;  4A9H A;  5AME A;  4O70 A;  5E9V A;  3SVF A;  3QZS A;  5BT3 A;  4Z1Q A;  5FH8 A;  3UV2 A;  4BW3 A;  4KCX A;  5FH6 A;  3LQH A;  5KHM A;  5DYC A;  4O77 A;  5L96 A;  2D82 A;  5AD3 A;  4A9K A;  3IU5 A;  4TQN A;  4QYL A;  5J0D A;  4HBY A;  5DFC A;  5CUD A;  5C4Q A;  4QR3 A;  4YAB A;  3S92 A;  4QY4 A;  5DLZ A;  3S91 A;  3NXB A;  5EWD A;  4A9J A;  3K2J A;  4CUP A;  5LVR A;  5LVQ A;  3O37 A;  4E96 A;  3HME A;  4Z6I A;  4WHU A;  5HQ7 A;  5A85 A;  4QR5 A;  4C67 A;  4UIU A;  3MB3 A;  5ENJ A;  2E3K A;  4NRB A;  4LC2 A;  5CUB A;  4QNS A;  1WUG A;  5D3L A;  3SVH A;  4O7F A;  4C66 A;  4QC1 A;  5CQA A;  5IID A;  1E6I A;  2YQD A;  4QEW A;  4CUR A;  3P1E A;  4A9F A;  5DKH A;  5KTX A;  4O7C A;  5L8U A;  5HEN A;  4CUS A;  5F63 A;  4TYL A;  2OUO A;  3MB4 A;  5C7N A;  4O7E A;  4UIW A;  4NR8 A;  4ZQL A;  5COI A;  5F1L A;  5ENC A;  5E3G A;  3HMF A;  4NYX A;  4MEO A;  4XUA A;  5IGM A;  5I29 A;  4J0S A;  3UVD A;  5IBN A;  5EWC A;  5E7D A;  4XYA A;  4HBX A;  4CUU A;  5CRM A;  5F61 A;  5I7X A;  4YH3 A;  4IOR A;  2RNX A;  5BT5 A;  5D3P A;  1N72 A;  5DW1 A;  3G0L A;  5E9I A;  5AD2 A;  4OGI A;  4PCE A;  2N9G A;  5E9Y A;  3ZYU A;  3U5J A;  4IR5 A;  5HJC A;  5KU3 A;  5L99 A;  4ZC9 A;  4YBM A;  5ETB A;  4YC9 A;  2RS9 B;  4LYS A;  5FE8 A;  4BJX A;  5DFB A;  4MR6 A;  4O7B A;  4TT4 A;  2NXB A;  3P1D A;  4HBV A;  4YYG A;  4AKN A;  3JVJ A;  5D3T A;  5ENB A;  4Q0N A;  5D3J A;  5DLX A;  4MEQ A;  3AAD A;  4FLP A;  4YAX A;  5L98 A;  2RFJ A;  4DON A;  4LZR A;  5TB6 A;  4CUT A;  4QUT A;  4NYV A;  5A81 A;  5FE2 A;  5LKZ A;  5CQ6 A;  5LJ0 A;  5AMF A;  2YYN A;  5CPE A;  5D26 A;  5F1H A;  5F62 A;  4PS5 A;  5FE4 A;  4NRA A;  4A9I A;  4MR5 A;  4YY6 A;  4YYH A;  5EVA A;  3JVM A;  3LQI A;  4TTE A;  5DBM A;  4IR6 A;  5DKC A;  2LSP B;  5CZG A;  5HLS A;  2YEL A;  4TU4 A;  2DAT A;  3DAI A;  3TLP A;  5FE9 A;  4XUB A;  2YDW A;  5F2P A;  3D7C A;  5I88 A;  2L5E A;  4NR6 A;  4NUE A;  4N4H A;  5IGL A;  4YAT A;  4IR4 A;  2MJV B;  5FFV A;  5I86 A;  4UYH A;  4HXL A;  4X2I A;  5EWV A;  4Z6H A;  4QC3 A;  5HEL A;  5C87 A;  4YY4 A;  5CGP A;  5I80 A;  3LQJ A;  3G0J A;  3U5K A;  4TU6 A;  5H1U A;  4XY8 A;  5FE3 A;  4PTB A;  4PCI A;  3O34 A; 
#chains in the Genus database with same CATH topology
 2YEK A;  5CS8 A;  4QEU A;  2WP2 A;  5DW2 A;  4OUF A;  4QSR A;  5C89 A;  1JSP B;  5H1V A;  5FE5 A;  2L85 A;  5FE7 A;  4UIY A;  5JWM A;  4A9E A;  3ERR A;  4AKG A;  5F36 A;  3P1F A;  5F60 A;  5IGK A;  4NRC A;  5CP5 A;  1JM4 B;  4KV1 A;  3QZT A;  3Q2F A;  5ENE A;  2RNY A;  4J1P A;  3U5L A;  2R0S A;  4IOO A;  4A9M A;  4UIV A;  5CUE A;  4PKL A;  5A5O A;  2RI7 A;  2YEM A;  5F3A A;  4QR4 A;  5EPB A;  4HXM A;  4Z1S A;  5ENG A;  4LDF A;  4YYI A;  2DWW A;  3VKH A;  5E0R A;  4N4I A;  4NR4 A;  4QYD A;  4HXS A;  5EIC A;  4QB3 A;  4UYD A;  4NXJ A;  5EV9 A;  5CRZ A;  5LKT A;  5ACY A;  4QSX A;  3LJW A;  5KO4 A;  2FSA A;  3Q2E A;  4UIT A;  2WP1 A;  4CLB A;  3DWY A;  4QSV A;  4HXP A;  3P1C A;  3LXJ A;  5E74 A;  5FB1 A;  3U5M A;  3IU6 A;  5G4R A;  4NR5 A;  4CFL A;  2OSS A;  5ENI A;  4YYD A;  4OGJ A;  4NUD A;  5ETD A;  3MUK A;  5A83 A;  4UIZ A;  5HRX A;  5EI4 A;  4YH4 A;  4UYF B;  5F5Z A;  5EK9 A;  3HMH A;  4O75 A;  5D0C A;  4KV4 A;  5CUG A;  4YBT A;  5EA1 A;  4BW2 A;  5CU8 A;  4LZS A;  2I8N A;  4QZS A;  5DY7 A;  5HRW A;  4TZ2 A;  5LUU A;  3ONI A;  5FG4 A;  2E7O A;  4MR4 A;  2EJN A;  2GRC A;  4QSS A;  4TT6 A;  5DX4 A;  5JI8 A;  4N3W A;  4Z93 A;  1F68 A;  5DYX A;  5E3D A;  4HXK A;  4ALG A;  3FKM X;  2F6J A;  2KTB B;  3D1D A;  5IG6 A;  4HXN A;  4UYG A;  5CY9 A;  4QUU A;  4QSW A;  5DYA A;  4J0R A;  4GPJ A;  3UVY A;  4YAD A;  4A9N A;  5HM0 A;  5E73 A;  3MQM A;  4XY9 A;  4QSP A;  5A5R A;  4NR7 A;  4UYE A;  5HFR A;  2DKW A;  5DYU A;  3MUL A;  5IGN A;  5L8T A;  2E7N A;  4LYW A;  4O74 A;  5HRV A;  5CQ8 A;  5BT4 A;  5CQ5 A;  5D7X A;  4RVR A;  2RNW A;  3QZV A;  5C8G A;  4ALH A;  4NS5 A;  5G4S A;  5EQ1 A;  5H85 A;  1EQF A;  4UIX A;  5D3S A;  4WHW A;  2R10 A;  4YYK A;  5EPS A;  4MR3 A;  5D3H A;  4TT2 A;  3I3J A;  4NYW A;  5EIS A;  3UV4 A;  5H1T A;  4YK0 A;  3RCW A;  5CUA A;  1X0J A;  5FE1 A;  5A5Q A;  4QSQ A;  3JVK A;  5D3N A;  4Y03 A;  5EM3 A;  4N4G A;  5TCM A;  5EWW A;  2DVR A;  4BW1 A;  4YYJ A;  4YYM A;  5E9L A;  5E9K A;  5DKD A;  5FFY A;  2R0V A;  5CQ4 A;  4YYN A;  4NQN A;  4QEV A;  5D24 A;  2H60 A;  5CUC A;  5LKU A;  5I7Y A;  4AKI A;  5A5S A;  4O71 A;  2DVS A;  5A5P A;  5LKX A;  4F3I A;  5HQ6 A;  4HXO A;  2YW5 A;  4LRG A;  5FFW A;  4O76 A;  5CTL A;  2L84 A;  5LJ2 A;  5KTW A;  1WUM A;  4LR6 A;  5FDZ A;  4TS8 A;  5FBX A;  3U5O A;  3JVL A;  4CUQ A;  4MEN A;  3U5N A;  5FG5 A;  5D25 A;  5FH7 A;  5I83 A;  5HFQ A;  4CL9 A;  5HCL A;  5DFD A;  1ZS5 A;  4O7A A;  3UVX A;  4CFK A;  5CQ7 A;  5CQ3 A;  5D3R A;  5A82 A;  3SVG A;  4LYI A;  5HEM A;  3GG3 A;  5FE0 A;  2OO1 A;  1PUO A;  2RO1 A;  2D9E A;  5I40 A;  4NR9 A;  5K29 A;  4HXR A;  4LZ2 A;  3UVW A;  4YBS A;  4J3I A;  5ENF A;  5ENH A;  5FB0 A;  5I89 A;  5A7C A;  4BW4 A;  5HQ5 A;  3AQA A;  4IOQ A;  3P5O A;  4NQM A;  5F25 A;  3U5P A;  3O36 A;  4Q0O A;  4UYF A;  2DVQ A;  5II2 A;  5E9M A;  5EU1 A;  2G4A A;  3O33 A;  3UW9 A;  3MXF A;  4TZ8 A;  4O72 A;  4HBW A;  4AKH A;  2DVV A;  4N4F A;  4MEP A;  5EPR A;  5II1 A;  4A9L A;  4O78 A;  5EWH A;  4QST A;  5I1Q A;  4WIV A;  5EGU A;  4QSU A;  5FG6 A;  4A9O A;  4AI6 A;  5C85 A;  2F6N A;  2I7K A;  5EP7 A;  5CFW A;  4QBM A;  3UV5 A;  4IR3 A;  4PY6 A;  5LJ1 A;  5KTU A;  4BHW A;  5FE6 A;  2R0Y A;  4ZW1 A;  5CQT A;  4NUC A;  5L97 A;  5A5N A;  3O35 A;  4A9H A;  5AME A;  4O70 A;  5E9V A;  3SVF A;  3QZS A;  5BT3 A;  4Z1Q A;  5FH8 A;  3UV2 A;  4BW3 A;  4KCX A;  5FH6 A;  3LQH A;  5KHM A;  5DYC A;  4O77 A;  5L96 A;  2D82 A;  5AD3 A;  4A9K A;  3IU5 A;  4TQN A;  4QYL A;  5J0D A;  4HBY A;  5DFC A;  5CUD A;  5C4Q A;  4QR3 A;  4YAB A;  3S92 A;  4QY4 A;  5DLZ A;  3S91 A;  3NXB A;  5EWD A;  4A9J A;  3K2J A;  4CUP A;  5LVR A;  5LVQ A;  3O37 A;  4E96 A;  3HME A;  4Z6I A;  4WHU A;  5HQ7 A;  5A85 A;  4QR5 A;  4C67 A;  4UIU A;  3MB3 A;  5ENJ A;  2E3K A;  4NRB A;  4LC2 A;  5CUB A;  4QNS A;  1WUG A;  5D3L A;  3SVH A;  4O7F A;  4C66 A;  4QC1 A;  5CQA A;  3VKG A;  5IID A;  1E6I A;  2YQD A;  4QEW A;  4CUR A;  3P1E A;  4A9F A;  5DKH A;  5KTX A;  4O7C A;  5L8U A;  5HEN A;  4CUS A;  5F63 A;  4TYL A;  2OUO A;  3MB4 A;  5C7N A;  4O7E A;  4UIW A;  4NR8 A;  4ZQL A;  5COI A;  5F1L A;  5ENC A;  5E3G A;  3HMF A;  4NYX A;  4MEO A;  4XUA A;  5IGM A;  5I29 A;  4J0S A;  3UVD A;  5IBN A;  5EWC A;  5E7D A;  4XYA A;  4HBX A;  4CUU A;  5CRM A;  5F61 A;  5I7X A;  4YH3 A;  4IOR A;  2RNX A;  5BT5 A;  5D3P A;  1N72 A;  5DW1 A;  3G0L A;  5E9I A;  5AD2 A;  4OGI A;  4PCE A;  2N9G A;  5E9Y A;  3ZYU A;  3U5J A;  4IR5 A;  5HJC A;  5KU3 A;  5L99 A;  4ZC9 A;  3D1B A;  5ETB A;  4YBM A;  4YC9 A;  2RS9 B;  4LYS A;  5FE8 A;  4BJX A;  5DFB A;  4MR6 A;  4O7B A;  4TT4 A;  2NXB A;  3P1D A;  4HBV A;  4YYG A;  4AKN A;  3JVJ A;  5D3T A;  5ENB A;  4Q0N A;  5D3J A;  5DLX A;  4MEQ A;  3AAD A;  4FLP A;  4YAX A;  5L98 A;  2RFJ A;  4DON A;  4LZR A;  5TB6 A;  4CUT A;  4QUT A;  4NYV A;  5A81 A;  5FE2 A;  5LKZ A;  5CQ6 A;  5LJ0 A;  5AMF A;  2YYN A;  5CPE A;  5D26 A;  5F1H A;  5F62 A;  4PS5 A;  5FE4 A;  4NRA A;  4A9I A;  4MR5 A;  1ZKR A;  4YY6 A;  4YYH A;  5EVA A;  3JVM A;  3LQI A;  4TTE A;  5DBM A;  4IR6 A;  5DKC A;  2LSP B;  5CZG A;  5HLS A;  2YEL A;  4TU4 A;  2DAT A;  3DAI A;  3TLP A;  5FE9 A;  4XUB A;  2YDW A;  5F2P A;  3D7C A;  5I88 A;  2L5E A;  4NR6 A;  4NUE A;  4N4H A;  5IGL A;  4YAT A;  4IR4 A;  2MJV B;  5FFV A;  5I86 A;  4UYH A;  4HXL A;  4X2I A;  5EWV A;  4Z6H A;  4QC3 A;  5HEL A;  5C87 A;  4YY4 A;  5CGP A;  5I80 A;  3LQJ A;  3G0J A;  3U5K A;  4TU6 A;  5H1U A;  4XY8 A;  5FE3 A;  4PTB A;  4PCI A;  3O34 A; 
#chains in the Genus database with same CATH homology
 2YEK A;  5CS8 A;  4QEU A;  2WP2 A;  5DW2 A;  4OUF A;  4QSR A;  5C89 A;  1JSP B;  5H1V A;  5FE5 A;  2L85 A;  5FE7 A;  4UIY A;  5JWM A;  4A9E A;  5F36 A;  3P1F A;  5F60 A;  5IGK A;  4NRC A;  5CP5 A;  1JM4 B;  4KV1 A;  3QZT A;  3Q2F A;  5ENE A;  2RNY A;  4J1P A;  3U5L A;  2R0S A;  4IOO A;  4A9M A;  4UIV A;  5CUE A;  4PKL A;  5A5O A;  2RI7 A;  2YEM A;  5F3A A;  4QR4 A;  5EPB A;  4HXM A;  4Z1S A;  5ENG A;  4LDF A;  4YYI A;  2DWW A;  5E0R A;  4N4I A;  4NR4 A;  4QYD A;  4HXS A;  5EIC A;  4QB3 A;  4UYD A;  4NXJ A;  5EV9 A;  5CRZ A;  5LKT A;  5ACY A;  4QSX A;  3LJW A;  5KO4 A;  2FSA A;  3Q2E A;  4UIT A;  2WP1 A;  4CLB A;  3DWY A;  4QSV A;  4HXP A;  3P1C A;  3LXJ A;  5E74 A;  5FB1 A;  3U5M A;  3IU6 A;  5G4R A;  4NR5 A;  4CFL A;  2OSS A;  5ENI A;  4YYD A;  4OGJ A;  4NUD A;  5ETD A;  3MUK A;  5A83 A;  4UIZ A;  5HRX A;  5EI4 A;  4YH4 A;  4UYF B;  5F5Z A;  5EK9 A;  3HMH A;  4O75 A;  5D0C A;  4KV4 A;  5CUG A;  4YBT A;  5EA1 A;  4BW2 A;  5CU8 A;  4LZS A;  2I8N A;  4QZS A;  5DY7 A;  5HRW A;  4TZ2 A;  5LUU A;  3ONI A;  5FG4 A;  2E7O A;  4MR4 A;  2GRC A;  4QSS A;  4TT6 A;  5DX4 A;  5JI8 A;  4N3W A;  4Z93 A;  1F68 A;  5DYX A;  5E3D A;  4HXK A;  4ALG A;  3FKM X;  2F6J A;  2KTB B;  5IG6 A;  4HXN A;  4UYG A;  5CY9 A;  4QUU A;  4QSW A;  5DYA A;  4J0R A;  4GPJ A;  3UVY A;  4YAD A;  4A9N A;  5HM0 A;  5E73 A;  3MQM A;  4XY9 A;  4QSP A;  5A5R A;  4NR7 A;  4UYE A;  5HFR A;  2DKW A;  5DYU A;  3MUL A;  5IGN A;  5L8T A;  2E7N A;  4LYW A;  4O74 A;  5HRV A;  5CQ8 A;  5BT4 A;  5CQ5 A;  5D7X A;  4RVR A;  2RNW A;  3QZV A;  5C8G A;  4ALH A;  4NS5 A;  5G4S A;  5EQ1 A;  5H85 A;  1EQF A;  4UIX A;  5D3S A;  4WHW A;  2R10 A;  4YYK A;  5EPS A;  4MR3 A;  5D3H A;  4TT2 A;  3I3J A;  4NYW A;  5EIS A;  3UV4 A;  5H1T A;  4YK0 A;  3RCW A;  5CUA A;  1X0J A;  5FE1 A;  5A5Q A;  4QSQ A;  3JVK A;  5D3N A;  4Y03 A;  5EM3 A;  4N4G A;  5TCM A;  5EWW A;  2DVR A;  4BW1 A;  4YYJ A;  4YYM A;  5E9L A;  5E9K A;  5DKD A;  5FFY A;  2R0V A;  5CQ4 A;  4YYN A;  4NQN A;  4QEV A;  5D24 A;  2H60 A;  5CUC A;  5LKU A;  5I7Y A;  5A5S A;  4O71 A;  2DVS A;  5A5P A;  5LKX A;  4F3I A;  5HQ6 A;  4HXO A;  2YW5 A;  4LRG A;  5FFW A;  4O76 A;  5CTL A;  2L84 A;  5LJ2 A;  5KTW A;  1WUM A;  4LR6 A;  5FDZ A;  4TS8 A;  5FBX A;  3U5O A;  3JVL A;  4CUQ A;  4MEN A;  3U5N A;  5FG5 A;  5D25 A;  5FH7 A;  5I83 A;  5HFQ A;  4CL9 A;  5HCL A;  5DFD A;  1ZS5 A;  4O7A A;  3UVX A;  4CFK A;  5CQ7 A;  5CQ3 A;  5D3R A;  5A82 A;  3SVG A;  4LYI A;  5HEM A;  3GG3 A;  5FE0 A;  2OO1 A;  2RO1 A;  2D9E A;  5I40 A;  4NR9 A;  5K29 A;  4HXR A;  4LZ2 A;  3UVW A;  4YBS A;  4J3I A;  5ENF A;  5ENH A;  5FB0 A;  5I89 A;  5A7C A;  4BW4 A;  5HQ5 A;  3AQA A;  4IOQ A;  3P5O A;  4NQM A;  5F25 A;  3U5P A;  3O36 A;  4Q0O A;  4UYF A;  2DVQ A;  5II2 A;  5E9M A;  5EU1 A;  2G4A A;  3O33 A;  3UW9 A;  3MXF A;  4TZ8 A;  4O72 A;  4HBW A;  2DVV A;  4N4F A;  4MEP A;  5EPR A;  5II1 A;  4A9L A;  4O78 A;  5EWH A;  4QST A;  5I1Q A;  4WIV A;  5EGU A;  4QSU A;  5FG6 A;  4A9O A;  5C85 A;  2F6N A;  2I7K A;  5EP7 A;  5CFW A;  4QBM A;  3UV5 A;  4IR3 A;  4PY6 A;  5LJ1 A;  5KTU A;  4BHW A;  5FE6 A;  2R0Y A;  4ZW1 A;  5CQT A;  4NUC A;  5L97 A;  5A5N A;  3O35 A;  4A9H A;  5AME A;  4O70 A;  5E9V A;  3SVF A;  3QZS A;  5BT3 A;  4Z1Q A;  5FH8 A;  3UV2 A;  4BW3 A;  4KCX A;  5FH6 A;  3LQH A;  5KHM A;  5DYC A;  4O77 A;  5L96 A;  2D82 A;  5AD3 A;  4A9K A;  3IU5 A;  4TQN A;  4QYL A;  5J0D A;  4HBY A;  5DFC A;  5CUD A;  5C4Q A;  4QR3 A;  4YAB A;  3S92 A;  4QY4 A;  5DLZ A;  3S91 A;  3NXB A;  5EWD A;  4A9J A;  3K2J A;  4CUP A;  5LVR A;  5LVQ A;  3O37 A;  4E96 A;  3HME A;  4Z6I A;  4WHU A;  5HQ7 A;  5A85 A;  4QR5 A;  4C67 A;  4UIU A;  3MB3 A;  5ENJ A;  2E3K A;  4NRB A;  4LC2 A;  5CUB A;  4QNS A;  1WUG A;  5D3L A;  3SVH A;  4O7F A;  4C66 A;  4QC1 A;  5CQA A;  5IID A;  1E6I A;  2YQD A;  4QEW A;  4CUR A;  3P1E A;  4A9F A;  5DKH A;  5KTX A;  4O7C A;  5L8U A;  5HEN A;  4CUS A;  5F63 A;  4TYL A;  2OUO A;  3MB4 A;  5C7N A;  4O7E A;  4UIW A;  4NR8 A;  4ZQL A;  5COI A;  5F1L A;  5ENC A;  5E3G A;  3HMF A;  4NYX A;  4MEO A;  4XUA A;  5IGM A;  5I29 A;  4J0S A;  3UVD A;  5IBN A;  5EWC A;  5E7D A;  4XYA A;  4HBX A;  4CUU A;  5CRM A;  5F61 A;  5I7X A;  4YH3 A;  4IOR A;  2RNX A;  5BT5 A;  5D3P A;  1N72 A;  5DW1 A;  3G0L A;  5E9I A;  5AD2 A;  4OGI A;  4PCE A;  2N9G A;  5E9Y A;  3ZYU A;  3U5J A;  4IR5 A;  5HJC A;  5KU3 A;  5L99 A;  4ZC9 A;  4YBM A;  5ETB A;  4YC9 A;  2RS9 B;  4LYS A;  5FE8 A;  4BJX A;  5DFB A;  4MR6 A;  4O7B A;  4TT4 A;  2NXB A;  3P1D A;  4HBV A;  4YYG A;  4AKN A;  3JVJ A;  5D3T A;  5ENB A;  4Q0N A;  5D3J A;  5DLX A;  4MEQ A;  3AAD A;  4FLP A;  4YAX A;  5L98 A;  2RFJ A;  4DON A;  4LZR A;  5TB6 A;  4CUT A;  4QUT A;  4NYV A;  5A81 A;  5FE2 A;  5LKZ A;  5CQ6 A;  5LJ0 A;  5AMF A;  2YYN A;  5CPE A;  5D26 A;  5F1H A;  5F62 A;  4PS5 A;  5FE4 A;  4NRA A;  4A9I A;  4MR5 A;  4YY6 A;  4YYH A;  5EVA A;  3JVM A;  3LQI A;  4TTE A;  5DBM A;  4IR6 A;  5DKC A;  2LSP B;  5CZG A;  5HLS A;  2YEL A;  4TU4 A;  2DAT A;  3DAI A;  3TLP A;  5FE9 A;  4XUB A;  2YDW A;  5F2P A;  3D7C A;  5I88 A;  2L5E A;  4NR6 A;  4NUE A;  4N4H A;  5IGL A;  4YAT A;  4IR4 A;  2MJV B;  5FFV A;  5I86 A;  4UYH A;  4HXL A;  4X2I A;  5EWV A;  4Z6H A;  4QC3 A;  5HEL A;  5C87 A;  4YY4 A;  5CGP A;  5I80 A;  3LQJ A;  3G0J A;  3U5K A;  4TU6 A;  5H1U A;  4XY8 A;  5FE3 A;  4PTB A;  4PCI A;  3O34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...