2YEMA

Crystal structure of the second bromodomain of human brd4 with the inhibitor gw841819x
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
110
structure length
110
Chain Sequence
KVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 4
publication title Discovery and Characterization of Small Molecule Inhibitors of the Bet Family Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2yemA00
5FE0A 5LKUA 4WHWA 4UYFA 5FE2A 5IGMA 3GG3A 5C8GA 4A9MA 4UYDA 5E9MA 5EM3A 3ONIA 3ZYUA 5LJ1A 4HBWA 5II2A 4NUEA 4O71A 5CGPA 3U5KA 3I3JA 4LYWA 5CQTA 5FFYA 5D26A 3TLPA 4NRBA 4Z6HA 4CFLA 4O7FA 5D3JA 4MEQA 1N72A 5G4SA 3MQMA 5D3RA 3SVFA 4A9KA 4KV4A 5HRVA 4YH4A 2NXBA 5LVQA 2DVVA 5FE6A 5I1QA 5CQ4A 3U5LA 4KCXA 4Z1QA 3U5MA 5G4RA 5DYCA 4O77A 4ZQLA 4CUPA 5FE8A 4TZ8A 4IR4A 4Q0NA 4QUTA 2YELA 4UIWA 5C85A 4LDFA 4QSUA 4O7EA 4IR3A 4ZC9A 5KU3A 3RCWA 2DVSA 5JWMA 5CQ7A 3JVMA 2D9EA 4QR3A 3P1FA 4NR8A 5E7DA 3Q2EA 4YYGA 5CQAA 4QSVA 3UW9A 3MULA 5DY7A 3O37A 5F1HA 5HJCA 3NXBA 5L98A 5HLSA 4BJXA 5LJ0A 4N3WA 4YY4A 4A9JA 4PKLA 4PY6A 5DLZA 2RS9B 2OSSA 2OO1A 5D3TA 5H85A 4O7AA 3QZTA 5EWDA 5HENA 4BW2A 3P1EA 4NR6A 2E3KA 4ZW1A 5EPRA 5FFWA 5I7XA 5ETDA 4CUSA 4E96A 4HXRA 5IBNA 4HXPA 5EI4A 3P1DA 5I29A 4MR5A 5DFDA 5ENIA 4BW3A 2RI7A 4UIZA 5EP7A 4XUAA 5F60A 5DW1A 5HQ6A 4YYIA 5FE3A 5AD3A 5HEMA 4CUQA 3LQJA 3Q2FA 5E73A 5E9LA 3MXFA 1F68A 2I7KA 4O78A 4PCEA 5LUUA 3S92A 5LKZA 4HXNA 2RO1A 4KV1A 3U5OA 4A9NA 3K2JA 5EK9A 3D7CA 5I89A 4O70A 4YK0A 5L8UA 4A9EA 5FG6A 4BW1A 5A5QA 5E9IA 4YYDA 4MR6A 5F36A 4TT2A 5F25A 5C89A 5EPSA 4UITA 5AMEA 5HM0A 4PS5A 4QY4A 4NUCA 5CZGA 2WP1A 2YW5A 5FE1A 5A85A 3QZVA 5CUEA 2WP2A 3LXJA 2OUOA 5D0CA 4CURA 5DKDA 4XY8A 4YYJA 5A5PA 5D3NA 4Y03A 5A5RA 4YC9A 4QEUA 5F2PA 5FE7A 4MEPA 4PTBA 5I80A 3UV5A 4OUFA 2L5EA 3UVXA 3O34A 3DWYA 4PCIA 5F3AA 4YYNA 3IU5A 3G0JA 4TU6A 4IOQA 3JVKA 5HFRA 5EA1A 4YBSA 4LYSA 5EWHA 5FE9A 4NRAA 2MJVB 4YBTA 5A83A 3DAIA 5KHMA 2I8NA 4IORA 2DWWA 4UIXA 5HQ5A 3AADA 5FFVA 4A9HA 4LR6A 4J1PA 4NQMA 5HRWA 5CS8A 5DFCA 5CRMA 4Z1SA 5EVAA 5D3LA 4QEVA 4NYXA 5DKCA 5FDZA 5D25A 5CQ6A 5FE4A 2DVRA 4QC1A 4HBYA 4QSWA 4QZSA 5FBXA 4IR5A 5I88A 4QSPA 4QB3A 5LKTA 5E0RA 4A9IA 2FSAA 5HQ7A 5CUAA 5A5SA 5DYUA 4QSRA 5DW2A 3UVWA 4OGIA 5EICA 4QNSA 4A9FA 5IGLA 5CUBA 4QUUA 4NR7A 4NYWA 4MENA 5I7YA 5ENFA 4ALHA 5ENJA 5L99A 5IG6A 5E9VA 4N4IA 4RVRA 5DX4A 3P1CA 4GPJA 5D24A 5EWCA 4X2IA 4QBMA 5A81A 2YYNA 2RNWA 5H1UA 2D82A 2R0YA 4O76A 5CPEA 4F3IA 5KTXA 4TZ2A 2R0VA 3P5OA 5KO4A 5CRZA 4QYDA 4NQNA 1EQFA 3U5PA 2E7OA 4UIYA 5BT5A 4CL9A 5A82A 5HRXA 4LZRA 5ETBA 4MR3A 5FB0A 2L84A 5C4QA 5COIA 4FLPA 4O72A 3U5JA 5I40A 4YYMA 1X0JA 5AD2A 2R0SA 5E74A 3JVJA 2RFJA 5CP5A 5EISA 4NXJA 5KTUA 5KTWA 5EV9A 4CUUA 4QSXA 5A7CA 5FG5A 5CQ5A 5CUGA 4O7BA 5CQ8A 5DYXA 5F62A 4NYVA 5CTLA 5E9YA 2F6JA 3HMFA 4UYHA 3G0LA 4CUTA 4HXMA 3JVLA 5ENGA 4HBVA 4O74A 5CU8A 5H1VA 5EWWA 3O33A 2YEKA 4YATA 4Z93A 5L97A 3LJWA 2RNXA 5JI8A 4QEWA 2RNYA 2N9GA 5FH6A 4O75A 4YYHA 4NUDA 2H60A 5D3SA 5EQ1A 4YY6A 5DLXA 5AMFA 5FH8A 4LZ2A 2YEMA 4C66A 2L85A 5EGUA 2G4AA 3S91A 4LC2A 4UIVA 2DVQA 5ENHA 5F5ZA 5A5OA 4YAXA 5ENCA 2E7NA 3O35A 4HXKA 4QR4A 5H1TA 4Q0OA 4XY9A 5CQ3A 4NR4A 5C7NA 3SVGA 5DBMA 4LZSA 4OGJA 5D3HA 5L8TA 3LQIA 4QSQA 4CFKA 4J0SA 2YDWA 3FKMX 1WUGA 4YADA 4IOOA 4NR9A 5CUDA 2DKWA 5CUCA 4WHUA 3HMEA 4O7CA 5DFBA 4J3IA 3IU6A 3HMHA 1WUMA 4TU4A 5EWVA 5E3DA 5ACYA 5FB1A 5LJ2A 4Z6IA 5FH7A 4TQNA 5LVRA 5F63A 4HXSA 5HCLA 4QR5A 4LRGA 4NR5A 5II1A 4DONA 5BT4A 1JSPB 4LYIA 5IIDA 4BW4A 5FG4A 5K29A 4QSSA 5F1LA 4MR4A 5E9KA 4N4GA 5HFQA 5HELA 3UV4A 4XYAA 3MB3A 4IR6A 5LKXA 5C87A 4TT6A 3MUKA 4QSTA 4WIVA 5A5NA 5J0DA 4YBMA 5L96A 4A9LA 4N4HA 5DKHA 4HXLA 4UYGA 4UYEA 4A9OA 5CY9A 4N4FA 3UVYA 3AQAA 4ALGA 4HBXA 4C67A 4TS8A 5EU1A 5DYAA 5ENBA 5I86A 4TYLA 3O36A 5TB6A 2F6NA 2GRCA 4NRCA 4UIUA 5D7XA 3UV2A 5ENEA 2LSPB 1ZS5A 5IGNA 4QC3A 3LQHA 2KTBB 2R10A 4TT4A 5F61A 4CLBA 4J0RA 5E3GA 1E6IA 4XUBA 5IGKA 4YYKA 3MB4A 5FE5A 4HXOA 5BT3A 1JM4B 5EPBA 4YH3A 5I83A 4AKNA 2DATA 4MEOA 3SVHA 2YQDA 3QZSA 4UYFB 5TCMA 4YABA 5CFWA 4QYLA 5D3PA 4BHWA 4TTEA 4NS5A 3UVDA 3U5NA
chains in the Genus database with same CATH superfamily
5FE0A 5LKUA 4WHWA 4UYFA 5FE2A 5IGMA 3GG3A 5C8GA 4A9MA 4UYDA 5E9MA 5EM3A 3ONIA 3ZYUA 5LJ1A 4HBWA 5II2A 3VKGA 4NUEA 4O71A 5CGPA 3U5KA 3I3JA 4LYWA 5CQTA 5FFYA 5D26A 3TLPA 4NRBA 4Z6HA 4CFLA 4O7FA 5D3JA 4MEQA 1N72A 5G4SA 3MQMA 5D3RA 3SVFA 4A9KA 4KV4A 5HRVA 4YH4A 2NXBA 5LVQA 2DVVA 5FE6A 5I1QA 5CQ4A 3U5LA 4KCXA 4Z1QA 3U5MA 5G4RA 5DYCA 4O77A 4ZQLA 4CUPA 5FE8A 4TZ8A 4IR4A 4Q0NA 4QUTA 2YELA 4UIWA 5C85A 4LDFA 4QSUA 4O7EA 4IR3A 4ZC9A 5KU3A 3RCWA 2DVSA 5JWMA 5CQ7A 3JVMA 2D9EA 4QR3A 3P1FA 4NR8A 5E7DA 3Q2EA 4YYGA 5CQAA 3D1BA 4QSVA 3UW9A 4AKGA 3MULA 5DY7A 3O37A 5F1HA 5HJCA 3NXBA 5L98A 5HLSA 4BJXA 5LJ0A 4N3WA 4YY4A 4A9JA 4PKLA 4PY6A 5DLZA 2RS9B 2OSSA 2OO1A 5D3TA 5H85A 4O7AA 3QZTA 5EWDA 5HENA 4BW2A 3P1EA 4NR6A 2E3KA 4ZW1A 5EPRA 5FFWA 5I7XA 5ETDA 4CUSA 4E96A 4HXRA 5IBNA 4HXPA 5EI4A 3P1DA 5I29A 4MR5A 5DFDA 5ENIA 4BW3A 2RI7A 4UIZA 5EP7A 4XUAA 5F60A 5DW1A 5HQ6A 4YYIA 5FE3A 5AD3A 5HEMA 4CUQA 3LQJA 3Q2FA 5E73A 5E9LA 3MXFA 1F68A 2I7KA 4O78A 4PCEA 5LUUA 3S92A 5LKZA 4HXNA 2RO1A 4KV1A 3U5OA 4A9NA 4AKIA 3K2JA 5EK9A 3D7CA 5I89A 4O70A 4YK0A 5L8UA 4A9EA 5FG6A 4BW1A 5A5QA 5E9IA 4YYDA 4MR6A 5F36A 4TT2A 5F25A 5C89A 5EPSA 4UITA 5AMEA 5HM0A 4PS5A 4QY4A 4NUCA 5CZGA 2WP1A 2YW5A 5FE1A 5A85A 3QZVA 5CUEA 2WP2A 3LXJA 2OUOA 5D0CA 4CURA 5DKDA 4XY8A 4YYJA 2EJNA 5D3NA 5A5PA 4Y03A 5A5RA 4YC9A 4QEUA 5F2PA 5FE7A 4MEPA 4PTBA 5I80A 3UV5A 4OUFA 2L5EA 3UVXA 3O34A 3DWYA 4PCIA 5F3AA 4YYNA 3IU5A 3G0JA 4TU6A 4IOQA 3JVKA 5HFRA 5EA1A 4YBSA 4LYSA 5EWHA 5FE9A 4NRAA 2MJVB 4YBTA 5A83A 3DAIA 5KHMA 2I8NA 4IORA 2DWWA 4UIXA 5HQ5A 3AADA 5FFVA 4A9HA 4LR6A 4J1PA 4NQMA 5HRWA 5CS8A 5DFCA 5CRMA 4Z1SA 5EVAA 5D3LA 4QEVA 4NYXA 5DKCA 5FDZA 5D25A 5CQ6A 5FE4A 2DVRA 4QC1A 4HBYA 4QSWA 4QZSA 5FBXA 4IR5A 5I88A 4QSPA 4QB3A 5LKTA 5E0RA 4A9IA 2FSAA 5HQ7A 5CUAA 5A5SA 5DYUA 4QSRA 5DW2A 3UVWA 4OGIA 5EICA 4QNSA 4A9FA 5IGLA 5CUBA 4QUUA 4NR7A 4NYWA 4MENA 5I7YA 5ENFA 4ALHA 5ENJA 5L99A 5IG6A 5E9VA 4N4IA 4RVRA 5DX4A 3P1CA 4GPJA 5D24A 5EWCA 4X2IA 4QBMA 5A81A 2YYNA 2RNWA 5H1UA 2D82A 2R0YA 4O76A 5CPEA 4F3IA 5KTXA 4TZ2A 2R0VA 3P5OA 1PUOA 5KO4A 5CRZA 4QYDA 4NQNA 1EQFA 3U5PA 2E7OA 4UIYA 5BT5A 4CL9A 5A82A 5HRXA 4LZRA 5ETBA 4MR3A 5FB0A 2L84A 5C4QA 5COIA 4FLPA 4O72A 3U5JA 5I40A 4YYMA 1X0JA 5AD2A 2R0SA 5E74A 3JVJA 2RFJA 5CP5A 5EISA 4NXJA 5KTUA 5KTWA 5EV9A 4CUUA 4QSXA 5A7CA 5FG5A 5CQ5A 5CUGA 4O7BA 5CQ8A 5DYXA 5F62A 4NYVA 5CTLA 5E9YA 2F6JA 3HMFA 4UYHA 3G0LA 4CUTA 4HXMA 3JVLA 5ENGA 4HBVA 4O74A 3ERRA 5CU8A 5H1VA 5EWWA 3O33A 2YEKA 4YATA 4Z93A 5L97A 3LJWA 2RNXA 5JI8A 4QEWA 2RNYA 2N9GA 5FH6A 4O75A 4YYHA 4NUDA 2H60A 5D3SA 5EQ1A 4YY6A 5DLXA 5AMFA 5FH8A 4LZ2A 2YEMA 4C66A 4AI6A 2L85A 5EGUA 2G4AA 3S91A 4LC2A 4UIVA 2DVQA 5ENHA 5F5ZA 5A5OA 4YAXA 5ENCA 2E7NA 3O35A 4HXKA 4QR4A 5H1TA 4Q0OA 4XY9A 5CQ3A 4NR4A 5C7NA 3SVGA 5DBMA 4LZSA 4OGJA 5D3HA 5L8TA 3LQIA 3VKHA 4AKHA 4QSQA 4CFKA 4J0SA 2YDWA 3FKMX 1WUGA 4YADA 4IOOA 4NR9A 5CUDA 2DKWA 5CUCA 4WHUA 3HMEA 4O7CA 5DFBA 4J3IA 3IU6A 3HMHA 1WUMA 4TU4A 5EWVA 5E3DA 5ACYA 5FB1A 5LJ2A 4Z6IA 1ZKRA 5FH7A 4TQNA 5LVRA 5F63A 4HXSA 5HCLA 4QR5A 4LRGA 4NR5A 5II1A 4DONA 5BT4A 1JSPB 4LYIA 5IIDA 4BW4A 5FG4A 5K29A 4QSSA 5F1LA 4MR4A 5E9KA 4N4GA 5HFQA 5HELA 3UV4A 4XYAA 3MB3A 4IR6A 5LKXA 5C87A 4TT6A 3MUKA 4QSTA 4WIVA 5A5NA 5J0DA 4YBMA 5L96A 4A9LA 4N4HA 5DKHA 4HXLA 4UYGA 4UYEA 4A9OA 5CY9A 4N4FA 3UVYA 3AQAA 4ALGA 4HBXA 4C67A 4TS8A 5EU1A 5DYAA 5ENBA 5I86A 4TYLA 3D1DA 3O36A 5TB6A 2F6NA 2GRCA 4NRCA 4UIUA 5D7XA 3UV2A 5ENEA 2LSPB 1ZS5A 5IGNA 4QC3A 3LQHA 2KTBB 2R10A 4TT4A 5F61A 4CLBA 4J0RA 5E3GA 1E6IA 4XUBA 5IGKA 4YYKA 3MB4A 5FE5A 4HXOA 5BT3A 1JM4B 5EPBA 4YH3A 5I83A 4AKNA 2DATA 4MEOA 3SVHA 2YQDA 3QZSA 4UYFB 5TCMA 4YABA 5CFWA 4QYLA 5D3PA 4BHWA 4TTEA 4NS5A 3UVDA 3U5NA
chains in the Genus database with same CATH topology
5FE0A 5LKUA 4WHWA 4UYFA 5FE2A 5IGMA 3GG3A 5C8GA 4A9MA 4UYDA 5E9MA 5EM3A 3ONIA 3ZYUA 5LJ1A 4HBWA 5II2A 4NUEA 4O71A 5CGPA 3U5KA 3I3JA 4LYWA 5CQTA 5FFYA 5D26A 3TLPA 4NRBA 4Z6HA 4CFLA 4O7FA 5D3JA 4MEQA 1N72A 5G4SA 3MQMA 5D3RA 3SVFA 4A9KA 4KV4A 5HRVA 4YH4A 2NXBA 5LVQA 2DVVA 5FE6A 5I1QA 5CQ4A 3U5LA 4KCXA 4Z1QA 3U5MA 5G4RA 5DYCA 4O77A 4ZQLA 4CUPA 5FE8A 4TZ8A 4IR4A 4Q0NA 4QUTA 2YELA 4UIWA 5C85A 4LDFA 4QSUA 4O7EA 4IR3A 4ZC9A 5KU3A 3RCWA 2DVSA 5JWMA 5CQ7A 3JVMA 2D9EA 4QR3A 3P1FA 4NR8A 5E7DA 3Q2EA 4YYGA 5CQAA 4QSVA 3UW9A 3MULA 5DY7A 3O37A 5F1HA 5HJCA 3NXBA 5L98A 5HLSA 4BJXA 5LJ0A 4N3WA 4YY4A 4A9JA 4PKLA 4PY6A 5DLZA 2RS9B 2OSSA 2OO1A 5D3TA 5H85A 4O7AA 3QZTA 5EWDA 5HENA 4BW2A 3P1EA 4NR6A 2E3KA 4ZW1A 5EPRA 5FFWA 5I7XA 5ETDA 4CUSA 4E96A 4HXRA 5IBNA 4HXPA 5EI4A 3P1DA 5I29A 4MR5A 5DFDA 5ENIA 4BW3A 2RI7A 4UIZA 5EP7A 4XUAA 5F60A 5DW1A 5HQ6A 4YYIA 5FE3A 5AD3A 5HEMA 4CUQA 3LQJA 3Q2FA 5E73A 5E9LA 3MXFA 1F68A 2I7KA 4O78A 4PCEA 5LUUA 3S92A 5LKZA 4HXNA 2RO1A 4KV1A 3U5OA 4A9NA 3K2JA 5EK9A 3D7CA 5I89A 4O70A 4YK0A 5L8UA 4A9EA 5FG6A 4BW1A 5A5QA 5E9IA 4YYDA 4MR6A 5F36A 4TT2A 5F25A 5C89A 5EPSA 4UITA 5AMEA 5HM0A 4PS5A 4QY4A 4NUCA 5CZGA 2WP1A 2YW5A 5FE1A 5A85A 3QZVA 5CUEA 2WP2A 3LXJA 2OUOA 5D0CA 4CURA 5DKDA 4XY8A 4YYJA 5A5PA 5D3NA 4Y03A 5A5RA 4YC9A 4QEUA 5F2PA 5FE7A 4MEPA 4PTBA 5I80A 3UV5A 4OUFA 2L5EA 3UVXA 3O34A 3DWYA 4PCIA 5F3AA 4YYNA 3IU5A 3G0JA 4TU6A 4IOQA 3JVKA 5HFRA 5EA1A 4YBSA 4LYSA 5EWHA 5FE9A 4NRAA 2MJVB 4YBTA 5A83A 3DAIA 5KHMA 2I8NA 4IORA 2DWWA 4UIXA 5HQ5A 3AADA 5FFVA 4A9HA 4LR6A 4J1PA 4NQMA 5HRWA 5CS8A 5DFCA 5CRMA 4Z1SA 5EVAA 5D3LA 4QEVA 4NYXA 5DKCA 5FDZA 5D25A 5CQ6A 5FE4A 2DVRA 4QC1A 4HBYA 4QSWA 4QZSA 5FBXA 4IR5A 5I88A 4QSPA 4QB3A 5LKTA 5E0RA 4A9IA 2FSAA 5HQ7A 5CUAA 5A5SA 5DYUA 4QSRA 5DW2A 3UVWA 4OGIA 5EICA 4QNSA 4A9FA 5IGLA 5CUBA 4QUUA 4NR7A 4NYWA 4MENA 5I7YA 5ENFA 4ALHA 5ENJA 5L99A 5IG6A 5E9VA 4N4IA 4RVRA 5DX4A 3P1CA 4GPJA 5D24A 5EWCA 4X2IA 4QBMA 5A81A 2YYNA 2RNWA 5H1UA 2D82A 2R0YA 4O76A 5CPEA 4F3IA 5KTXA 4TZ2A 2R0VA 3P5OA 5KO4A 5CRZA 4QYDA 4NQNA 1EQFA 3U5PA 2E7OA 4UIYA 5BT5A 4CL9A 5A82A 5HRXA 4LZRA 5ETBA 4MR3A 5FB0A 2L84A 5C4QA 5COIA 4FLPA 4O72A 3U5JA 5I40A 4YYMA 1X0JA 5AD2A 2R0SA 5E74A 3JVJA 2RFJA 5CP5A 5EISA 4NXJA 5KTUA 5KTWA 5EV9A 4CUUA 4QSXA 5A7CA 5FG5A 5CQ5A 5CUGA 4O7BA 5CQ8A 5DYXA 5F62A 4NYVA 5CTLA 5E9YA 2F6JA 3HMFA 4UYHA 3G0LA 4CUTA 4HXMA 3JVLA 5ENGA 4HBVA 4O74A 5CU8A 5H1VA 5EWWA 3O33A 2YEKA 4YATA 4Z93A 5L97A 3LJWA 2RNXA 5JI8A 4QEWA 2RNYA 2N9GA 5FH6A 4O75A 4YYHA 4NUDA 2H60A 5D3SA 5EQ1A 4YY6A 5DLXA 5AMFA 5FH8A 4LZ2A 2YEMA 4C66A 2L85A 5EGUA 2G4AA 3S91A 4LC2A 4UIVA 2DVQA 5ENHA 5F5ZA 5A5OA 4YAXA 5ENCA 2E7NA 3O35A 4HXKA 4QR4A 5H1TA 4Q0OA 4XY9A 5CQ3A 4NR4A 5C7NA 3SVGA 5DBMA 4LZSA 4OGJA 5D3HA 5L8TA 3LQIA 4QSQA 4CFKA 4J0SA 2YDWA 3FKMX 1WUGA 4YADA 4IOOA 4NR9A 5CUDA 2DKWA 5CUCA 4WHUA 3HMEA 4O7CA 5DFBA 4J3IA 3IU6A 3HMHA 1WUMA 4TU4A 5EWVA 5E3DA 5ACYA 5FB1A 5LJ2A 4Z6IA 5FH7A 4TQNA 5LVRA 5F63A 4HXSA 5HCLA 4QR5A 4LRGA 4NR5A 5II1A 4DONA 5BT4A 1JSPB 4LYIA 5IIDA 4BW4A 5FG4A 5K29A 4QSSA 5F1LA 4MR4A 5E9KA 4N4GA 5HFQA 5HELA 3UV4A 4XYAA 3MB3A 4IR6A 5LKXA 5C87A 4TT6A 3MUKA 4QSTA 4WIVA 5A5NA 5J0DA 4YBMA 5L96A 4A9LA 4N4HA 5DKHA 4HXLA 4UYGA 4UYEA 4A9OA 5CY9A 4N4FA 3UVYA 3AQAA 4ALGA 4HBXA 4C67A 4TS8A 5EU1A 5DYAA 5ENBA 5I86A 4TYLA 3O36A 5TB6A 2F6NA 2GRCA 4NRCA 4UIUA 5D7XA 3UV2A 5ENEA 2LSPB 1ZS5A 5IGNA 4QC3A 3LQHA 2KTBB 2R10A 4TT4A 5F61A 4CLBA 4J0RA 5E3GA 1E6IA 4XUBA 5IGKA 4YYKA 3MB4A 5FE5A 4HXOA 5BT3A 1JM4B 5EPBA 4YH3A 5I83A 4AKNA 2DATA 4MEOA 3SVHA 2YQDA 3QZSA 4UYFB 5TCMA 4YABA 5CFWA 4QYLA 5D3PA 4BHWA 4TTEA 4NS5A 3UVDA 3U5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FE0 A;  5LKU A;  4WHW A;  4UYF A;  5FE2 A;  5IGM A;  3GG3 A;  5C8G A;  4A9M A;  4UYD A;  5E9M A;  5EM3 A;  3ONI A;  3ZYU A;  5LJ1 A;  4HBW A;  5II2 A;  4NUE A;  4O71 A;  5CGP A;  3U5K A;  3I3J A;  4LYW A;  5CQT A;  5FFY A;  5D26 A;  3TLP A;  4NRB A;  4Z6H A;  4CFL A;  4O7F A;  5D3J A;  4MEQ A;  1N72 A;  5G4S A;  3MQM A;  5D3R A;  3SVF A;  4A9K A;  4KV4 A;  5HRV A;  4YH4 A;  2NXB A;  5LVQ A;  2DVV A;  5FE6 A;  5I1Q A;  5CQ4 A;  3U5L A;  4KCX A;  4Z1Q A;  3U5M A;  5G4R A;  5DYC A;  4O77 A;  4ZQL A;  4CUP A;  5FE8 A;  4TZ8 A;  4IR4 A;  4Q0N A;  4QUT A;  2YEL A;  4UIW A;  5C85 A;  4LDF A;  4QSU A;  4O7E A;  4IR3 A;  4ZC9 A;  5KU3 A;  3RCW A;  2DVS A;  5JWM A;  5CQ7 A;  3JVM A;  2D9E A;  4QR3 A;  3P1F A;  4NR8 A;  5E7D A;  3Q2E A;  4YYG A;  5CQA A;  4QSV A;  3UW9 A;  3MUL A;  5DY7 A;  3O37 A;  5F1H A;  5HJC A;  3NXB A;  5L98 A;  5HLS A;  4BJX A;  5LJ0 A;  4N3W A;  4YY4 A;  4A9J A;  4PKL A;  4PY6 A;  5DLZ A;  2RS9 B;  2OSS A;  2OO1 A;  5D3T A;  5H85 A;  4O7A A;  3QZT A;  5EWD A;  5HEN A;  4BW2 A;  3P1E A;  4NR6 A;  2E3K A;  4ZW1 A;  5EPR A;  5FFW A;  5I7X A;  5ETD A;  4CUS A;  4E96 A;  4HXR A;  5IBN A;  4HXP A;  5EI4 A;  3P1D A;  5I29 A;  4MR5 A;  5DFD A;  5ENI A;  4BW3 A;  2RI7 A;  4UIZ A;  5EP7 A;  4XUA A;  5F60 A;  5DW1 A;  5HQ6 A;  4YYI A;  5FE3 A;  5AD3 A;  5HEM A;  4CUQ A;  3LQJ A;  3Q2F A;  5E73 A;  5E9L A;  3MXF A;  1F68 A;  2I7K A;  4O78 A;  4PCE A;  5LUU A;  3S92 A;  5LKZ A;  4HXN A;  2RO1 A;  4KV1 A;  3U5O A;  4A9N A;  3K2J A;  5EK9 A;  3D7C A;  5I89 A;  4O70 A;  4YK0 A;  5L8U A;  4A9E A;  5FG6 A;  4BW1 A;  5A5Q A;  5E9I A;  4YYD A;  4MR6 A;  5F36 A;  4TT2 A;  5F25 A;  5C89 A;  5EPS A;  4UIT A;  5AME A;  5HM0 A;  4PS5 A;  4QY4 A;  4NUC A;  5CZG A;  2WP1 A;  2YW5 A;  5FE1 A;  5A85 A;  3QZV A;  5CUE A;  2WP2 A;  3LXJ A;  2OUO A;  5D0C A;  4CUR A;  5DKD A;  4XY8 A;  4YYJ A;  5A5P A;  5D3N A;  4Y03 A;  5A5R A;  4YC9 A;  4QEU A;  5F2P A;  5FE7 A;  4MEP A;  4PTB A;  5I80 A;  3UV5 A;  4OUF A;  2L5E A;  3UVX A;  3O34 A;  3DWY A;  4PCI A;  5F3A A;  4YYN A;  3IU5 A;  3G0J A;  4TU6 A;  4IOQ A;  3JVK A;  5HFR A;  5EA1 A;  4YBS A;  4LYS A;  5EWH A;  5FE9 A;  4NRA A;  2MJV B;  4YBT A;  5A83 A;  3DAI A;  5KHM A;  2I8N A;  4IOR A;  2DWW A;  4UIX A;  5HQ5 A;  3AAD A;  5FFV A;  4A9H A;  4LR6 A;  4J1P A;  4NQM A;  5HRW A;  5CS8 A;  5DFC A;  5CRM A;  4Z1S A;  5EVA A;  5D3L A;  4QEV A;  4NYX A;  5DKC A;  5FDZ A;  5D25 A;  5CQ6 A;  5FE4 A;  2DVR A;  4QC1 A;  4HBY A;  4QSW A;  4QZS A;  5FBX A;  4IR5 A;  5I88 A;  4QSP A;  4QB3 A;  5LKT A;  5E0R A;  4A9I A;  2FSA A;  5HQ7 A;  5CUA A;  5A5S A;  5DYU A;  4QSR A;  5DW2 A;  3UVW A;  4OGI A;  5EIC A;  4QNS A;  4A9F A;  5IGL A;  5CUB A;  4QUU A;  4NR7 A;  4NYW A;  4MEN A;  5I7Y A;  5ENF A;  4ALH A;  5ENJ A;  5L99 A;  5IG6 A;  5E9V A;  4N4I A;  4RVR A;  5DX4 A;  3P1C A;  4GPJ A;  5D24 A;  5EWC A;  4X2I A;  4QBM A;  5A81 A;  2YYN A;  2RNW A;  5H1U A;  2D82 A;  2R0Y A;  4O76 A;  5CPE A;  4F3I A;  5KTX A;  4TZ2 A;  2R0V A;  3P5O A;  5KO4 A;  5CRZ A;  4QYD A;  4NQN A;  1EQF A;  3U5P A;  2E7O A;  4UIY A;  5BT5 A;  4CL9 A;  5A82 A;  5HRX A;  4LZR A;  5ETB A;  4MR3 A;  5FB0 A;  2L84 A;  5C4Q A;  5COI A;  4FLP A;  4O72 A;  3U5J A;  5I40 A;  4YYM A;  1X0J A;  5AD2 A;  2R0S A;  5E74 A;  3JVJ A;  2RFJ A;  5CP5 A;  5EIS A;  4NXJ A;  5KTU A;  5KTW A;  5EV9 A;  4CUU A;  4QSX A;  5A7C A;  5FG5 A;  5CQ5 A;  5CUG A;  4O7B A;  5CQ8 A;  5DYX A;  5F62 A;  4NYV A;  5CTL A;  5E9Y A;  2F6J A;  3HMF A;  4UYH A;  3G0L A;  4CUT A;  4HXM A;  3JVL A;  5ENG A;  4HBV A;  4O74 A;  5CU8 A;  5H1V A;  5EWW A;  3O33 A;  2YEK A;  4YAT A;  4Z93 A;  5L97 A;  3LJW A;  2RNX A;  5JI8 A;  4QEW A;  2RNY A;  2N9G A;  5FH6 A;  4O75 A;  4YYH A;  4NUD A;  2H60 A;  5D3S A;  5EQ1 A;  4YY6 A;  5DLX A;  5AMF A;  5FH8 A;  4LZ2 A;  2YEM A;  4C66 A;  2L85 A;  5EGU A;  2G4A A;  3S91 A;  4LC2 A;  4UIV A;  2DVQ A;  5ENH A;  5F5Z A;  5A5O A;  4YAX A;  5ENC A;  2E7N A;  3O35 A;  4HXK A;  4QR4 A;  5H1T A;  4Q0O A;  4XY9 A;  5CQ3 A;  4NR4 A;  5C7N A;  3SVG A;  5DBM A;  4LZS A;  4OGJ A;  5D3H A;  5L8T A;  3LQI A;  4QSQ A;  4CFK A;  4J0S A;  2YDW A;  3FKM X;  1WUG A;  4YAD A;  4IOO A;  4NR9 A;  5CUD A;  2DKW A;  5CUC A;  4WHU A;  3HME A;  4O7C A;  5DFB A;  4J3I A;  3IU6 A;  3HMH A;  1WUM A;  4TU4 A;  5EWV A;  5E3D A;  5ACY A;  5FB1 A;  5LJ2 A;  4Z6I A;  5FH7 A;  4TQN A;  5LVR A;  5F63 A;  4HXS A;  5HCL A;  4QR5 A;  4LRG A;  4NR5 A;  5II1 A;  4DON A;  5BT4 A;  1JSP B;  4LYI A;  5IID A;  4BW4 A;  5FG4 A;  5K29 A;  4QSS A;  5F1L A;  4MR4 A;  5E9K A;  4N4G A;  5HFQ A;  5HEL A;  3UV4 A;  4XYA A;  3MB3 A;  4IR6 A;  5LKX A;  5C87 A;  4TT6 A;  3MUK A;  4QST A;  4WIV A;  5A5N A;  5J0D A;  4YBM A;  5L96 A;  4A9L A;  4N4H A;  5DKH A;  4HXL A;  4UYG A;  4UYE A;  4A9O A;  5CY9 A;  4N4F A;  3UVY A;  3AQA A;  4ALG A;  4HBX A;  4C67 A;  4TS8 A;  5EU1 A;  5DYA A;  5ENB A;  5I86 A;  4TYL A;  3O36 A;  5TB6 A;  2F6N A;  2GRC A;  4NRC A;  4UIU A;  5D7X A;  3UV2 A;  5ENE A;  2LSP B;  1ZS5 A;  5IGN A;  4QC3 A;  3LQH A;  2KTB B;  2R10 A;  4TT4 A;  5F61 A;  4CLB A;  4J0R A;  5E3G A;  1E6I A;  4XUB A;  5IGK A;  4YYK A;  3MB4 A;  5FE5 A;  4HXO A;  5BT3 A;  1JM4 B;  5EPB A;  4YH3 A;  5I83 A;  4AKN A;  2DAT A;  4MEO A;  3SVH A;  2YQD A;  3QZS A;  4UYF B;  5TCM A;  4YAB A;  5CFW A;  4QYL A;  5D3P A;  4BHW A;  4TTE A;  4NS5 A;  3UVD A;  3U5N A; 
#chains in the Genus database with same CATH topology
 5FE0 A;  5LKU A;  4WHW A;  4UYF A;  5FE2 A;  5IGM A;  3GG3 A;  5C8G A;  4A9M A;  4UYD A;  5E9M A;  5EM3 A;  3ONI A;  3ZYU A;  5LJ1 A;  4HBW A;  5II2 A;  3VKG A;  4NUE A;  4O71 A;  5CGP A;  3U5K A;  3I3J A;  4LYW A;  5CQT A;  5FFY A;  5D26 A;  3TLP A;  4NRB A;  4Z6H A;  4CFL A;  4O7F A;  5D3J A;  4MEQ A;  1N72 A;  5G4S A;  3MQM A;  5D3R A;  3SVF A;  4A9K A;  4KV4 A;  5HRV A;  4YH4 A;  2NXB A;  5LVQ A;  2DVV A;  5FE6 A;  5I1Q A;  5CQ4 A;  3U5L A;  4KCX A;  4Z1Q A;  3U5M A;  5G4R A;  5DYC A;  4O77 A;  4ZQL A;  4CUP A;  5FE8 A;  4TZ8 A;  4IR4 A;  4Q0N A;  4QUT A;  2YEL A;  4UIW A;  5C85 A;  4LDF A;  4QSU A;  4O7E A;  4IR3 A;  4ZC9 A;  5KU3 A;  3RCW A;  2DVS A;  5JWM A;  5CQ7 A;  3JVM A;  2D9E A;  4QR3 A;  3P1F A;  4NR8 A;  5E7D A;  3Q2E A;  4YYG A;  5CQA A;  3D1B A;  4QSV A;  3UW9 A;  4AKG A;  3MUL A;  5DY7 A;  3O37 A;  5F1H A;  5HJC A;  3NXB A;  5L98 A;  5HLS A;  4BJX A;  5LJ0 A;  4N3W A;  4YY4 A;  4A9J A;  4PKL A;  4PY6 A;  5DLZ A;  2RS9 B;  2OSS A;  2OO1 A;  5D3T A;  5H85 A;  4O7A A;  3QZT A;  5EWD A;  5HEN A;  4BW2 A;  3P1E A;  4NR6 A;  2E3K A;  4ZW1 A;  5EPR A;  5FFW A;  5I7X A;  5ETD A;  4CUS A;  4E96 A;  4HXR A;  5IBN A;  4HXP A;  5EI4 A;  3P1D A;  5I29 A;  4MR5 A;  5DFD A;  5ENI A;  4BW3 A;  2RI7 A;  4UIZ A;  5EP7 A;  4XUA A;  5F60 A;  5DW1 A;  5HQ6 A;  4YYI A;  5FE3 A;  5AD3 A;  5HEM A;  4CUQ A;  3LQJ A;  3Q2F A;  5E73 A;  5E9L A;  3MXF A;  1F68 A;  2I7K A;  4O78 A;  4PCE A;  5LUU A;  3S92 A;  5LKZ A;  4HXN A;  2RO1 A;  4KV1 A;  3U5O A;  4A9N A;  4AKI A;  3K2J A;  5EK9 A;  3D7C A;  5I89 A;  4O70 A;  4YK0 A;  5L8U A;  4A9E A;  5FG6 A;  4BW1 A;  5A5Q A;  5E9I A;  4YYD A;  4MR6 A;  5F36 A;  4TT2 A;  5F25 A;  5C89 A;  5EPS A;  4UIT A;  5AME A;  5HM0 A;  4PS5 A;  4QY4 A;  4NUC A;  5CZG A;  2WP1 A;  2YW5 A;  5FE1 A;  5A85 A;  3QZV A;  5CUE A;  2WP2 A;  3LXJ A;  2OUO A;  5D0C A;  4CUR A;  5DKD A;  4XY8 A;  4YYJ A;  2EJN A;  5D3N A;  5A5P A;  4Y03 A;  5A5R A;  4YC9 A;  4QEU A;  5F2P A;  5FE7 A;  4MEP A;  4PTB A;  5I80 A;  3UV5 A;  4OUF A;  2L5E A;  3UVX A;  3O34 A;  3DWY A;  4PCI A;  5F3A A;  4YYN A;  3IU5 A;  3G0J A;  4TU6 A;  4IOQ A;  3JVK A;  5HFR A;  5EA1 A;  4YBS A;  4LYS A;  5EWH A;  5FE9 A;  4NRA A;  2MJV B;  4YBT A;  5A83 A;  3DAI A;  5KHM A;  2I8N A;  4IOR A;  2DWW A;  4UIX A;  5HQ5 A;  3AAD A;  5FFV A;  4A9H A;  4LR6 A;  4J1P A;  4NQM A;  5HRW A;  5CS8 A;  5DFC A;  5CRM A;  4Z1S A;  5EVA A;  5D3L A;  4QEV A;  4NYX A;  5DKC A;  5FDZ A;  5D25 A;  5CQ6 A;  5FE4 A;  2DVR A;  4QC1 A;  4HBY A;  4QSW A;  4QZS A;  5FBX A;  4IR5 A;  5I88 A;  4QSP A;  4QB3 A;  5LKT A;  5E0R A;  4A9I A;  2FSA A;  5HQ7 A;  5CUA A;  5A5S A;  5DYU A;  4QSR A;  5DW2 A;  3UVW A;  4OGI A;  5EIC A;  4QNS A;  4A9F A;  5IGL A;  5CUB A;  4QUU A;  4NR7 A;  4NYW A;  4MEN A;  5I7Y A;  5ENF A;  4ALH A;  5ENJ A;  5L99 A;  5IG6 A;  5E9V A;  4N4I A;  4RVR A;  5DX4 A;  3P1C A;  4GPJ A;  5D24 A;  5EWC A;  4X2I A;  4QBM A;  5A81 A;  2YYN A;  2RNW A;  5H1U A;  2D82 A;  2R0Y A;  4O76 A;  5CPE A;  4F3I A;  5KTX A;  4TZ2 A;  2R0V A;  3P5O A;  1PUO A;  5KO4 A;  5CRZ A;  4QYD A;  4NQN A;  1EQF A;  3U5P A;  2E7O A;  4UIY A;  5BT5 A;  4CL9 A;  5A82 A;  5HRX A;  4LZR A;  5ETB A;  4MR3 A;  5FB0 A;  2L84 A;  5C4Q A;  5COI A;  4FLP A;  4O72 A;  3U5J A;  5I40 A;  4YYM A;  1X0J A;  5AD2 A;  2R0S A;  5E74 A;  3JVJ A;  2RFJ A;  5CP5 A;  5EIS A;  4NXJ A;  5KTU A;  5KTW A;  5EV9 A;  4CUU A;  4QSX A;  5A7C A;  5FG5 A;  5CQ5 A;  5CUG A;  4O7B A;  5CQ8 A;  5DYX A;  5F62 A;  4NYV A;  5CTL A;  5E9Y A;  2F6J A;  3HMF A;  4UYH A;  3G0L A;  4CUT A;  4HXM A;  3JVL A;  5ENG A;  4HBV A;  4O74 A;  3ERR A;  5CU8 A;  5H1V A;  5EWW A;  3O33 A;  2YEK A;  4YAT A;  4Z93 A;  5L97 A;  3LJW A;  2RNX A;  5JI8 A;  4QEW A;  2RNY A;  2N9G A;  5FH6 A;  4O75 A;  4YYH A;  4NUD A;  2H60 A;  5D3S A;  5EQ1 A;  4YY6 A;  5DLX A;  5AMF A;  5FH8 A;  4LZ2 A;  2YEM A;  4C66 A;  4AI6 A;  2L85 A;  5EGU A;  2G4A A;  3S91 A;  4LC2 A;  4UIV A;  2DVQ A;  5ENH A;  5F5Z A;  5A5O A;  4YAX A;  5ENC A;  2E7N A;  3O35 A;  4HXK A;  4QR4 A;  5H1T A;  4Q0O A;  4XY9 A;  5CQ3 A;  4NR4 A;  5C7N A;  3SVG A;  5DBM A;  4LZS A;  4OGJ A;  5D3H A;  5L8T A;  3LQI A;  3VKH A;  4AKH A;  4QSQ A;  4CFK A;  4J0S A;  2YDW A;  3FKM X;  1WUG A;  4YAD A;  4IOO A;  4NR9 A;  5CUD A;  2DKW A;  5CUC A;  4WHU A;  3HME A;  4O7C A;  5DFB A;  4J3I A;  3IU6 A;  3HMH A;  1WUM A;  4TU4 A;  5EWV A;  5E3D A;  5ACY A;  5FB1 A;  5LJ2 A;  4Z6I A;  1ZKR A;  5FH7 A;  4TQN A;  5LVR A;  5F63 A;  4HXS A;  5HCL A;  4QR5 A;  4LRG A;  4NR5 A;  5II1 A;  4DON A;  5BT4 A;  1JSP B;  4LYI A;  5IID A;  4BW4 A;  5FG4 A;  5K29 A;  4QSS A;  5F1L A;  4MR4 A;  5E9K A;  4N4G A;  5HFQ A;  5HEL A;  3UV4 A;  4XYA A;  3MB3 A;  4IR6 A;  5LKX A;  5C87 A;  4TT6 A;  3MUK A;  4QST A;  4WIV A;  5A5N A;  5J0D A;  4YBM A;  5L96 A;  4A9L A;  4N4H A;  5DKH A;  4HXL A;  4UYG A;  4UYE A;  4A9O A;  5CY9 A;  4N4F A;  3UVY A;  3AQA A;  4ALG A;  4HBX A;  4C67 A;  4TS8 A;  5EU1 A;  5DYA A;  5ENB A;  5I86 A;  4TYL A;  3D1D A;  3O36 A;  5TB6 A;  2F6N A;  2GRC A;  4NRC A;  4UIU A;  5D7X A;  3UV2 A;  5ENE A;  2LSP B;  1ZS5 A;  5IGN A;  4QC3 A;  3LQH A;  2KTB B;  2R10 A;  4TT4 A;  5F61 A;  4CLB A;  4J0R A;  5E3G A;  1E6I A;  4XUB A;  5IGK A;  4YYK A;  3MB4 A;  5FE5 A;  4HXO A;  5BT3 A;  1JM4 B;  5EPB A;  4YH3 A;  5I83 A;  4AKN A;  2DAT A;  4MEO A;  3SVH A;  2YQD A;  3QZS A;  4UYF B;  5TCM A;  4YAB A;  5CFW A;  4QYL A;  5D3P A;  4BHW A;  4TTE A;  4NS5 A;  3UVD A;  3U5N A; 
#chains in the Genus database with same CATH homology
 5FE0 A;  5LKU A;  4WHW A;  4UYF A;  5FE2 A;  5IGM A;  3GG3 A;  5C8G A;  4A9M A;  4UYD A;  5E9M A;  5EM3 A;  3ONI A;  3ZYU A;  5LJ1 A;  4HBW A;  5II2 A;  4NUE A;  4O71 A;  5CGP A;  3U5K A;  3I3J A;  4LYW A;  5CQT A;  5FFY A;  5D26 A;  3TLP A;  4NRB A;  4Z6H A;  4CFL A;  4O7F A;  5D3J A;  4MEQ A;  1N72 A;  5G4S A;  3MQM A;  5D3R A;  3SVF A;  4A9K A;  4KV4 A;  5HRV A;  4YH4 A;  2NXB A;  5LVQ A;  2DVV A;  5FE6 A;  5I1Q A;  5CQ4 A;  3U5L A;  4KCX A;  4Z1Q A;  3U5M A;  5G4R A;  5DYC A;  4O77 A;  4ZQL A;  4CUP A;  5FE8 A;  4TZ8 A;  4IR4 A;  4Q0N A;  4QUT A;  2YEL A;  4UIW A;  5C85 A;  4LDF A;  4QSU A;  4O7E A;  4IR3 A;  4ZC9 A;  5KU3 A;  3RCW A;  2DVS A;  5JWM A;  5CQ7 A;  3JVM A;  2D9E A;  4QR3 A;  3P1F A;  4NR8 A;  5E7D A;  3Q2E A;  4YYG A;  5CQA A;  4QSV A;  3UW9 A;  3MUL A;  5DY7 A;  3O37 A;  5F1H A;  5HJC A;  3NXB A;  5L98 A;  5HLS A;  4BJX A;  5LJ0 A;  4N3W A;  4YY4 A;  4A9J A;  4PKL A;  4PY6 A;  5DLZ A;  2RS9 B;  2OSS A;  2OO1 A;  5D3T A;  5H85 A;  4O7A A;  3QZT A;  5EWD A;  5HEN A;  4BW2 A;  3P1E A;  4NR6 A;  2E3K A;  4ZW1 A;  5EPR A;  5FFW A;  5I7X A;  5ETD A;  4CUS A;  4E96 A;  4HXR A;  5IBN A;  4HXP A;  5EI4 A;  3P1D A;  5I29 A;  4MR5 A;  5DFD A;  5ENI A;  4BW3 A;  2RI7 A;  4UIZ A;  5EP7 A;  4XUA A;  5F60 A;  5DW1 A;  5HQ6 A;  4YYI A;  5FE3 A;  5AD3 A;  5HEM A;  4CUQ A;  3LQJ A;  3Q2F A;  5E73 A;  5E9L A;  3MXF A;  1F68 A;  2I7K A;  4O78 A;  4PCE A;  5LUU A;  3S92 A;  5LKZ A;  4HXN A;  2RO1 A;  4KV1 A;  3U5O A;  4A9N A;  3K2J A;  5EK9 A;  3D7C A;  5I89 A;  4O70 A;  4YK0 A;  5L8U A;  4A9E A;  5FG6 A;  4BW1 A;  5A5Q A;  5E9I A;  4YYD A;  4MR6 A;  5F36 A;  4TT2 A;  5F25 A;  5C89 A;  5EPS A;  4UIT A;  5AME A;  5HM0 A;  4PS5 A;  4QY4 A;  4NUC A;  5CZG A;  2WP1 A;  2YW5 A;  5FE1 A;  5A85 A;  3QZV A;  5CUE A;  2WP2 A;  3LXJ A;  2OUO A;  5D0C A;  4CUR A;  5DKD A;  4XY8 A;  4YYJ A;  5A5P A;  5D3N A;  4Y03 A;  5A5R A;  4YC9 A;  4QEU A;  5F2P A;  5FE7 A;  4MEP A;  4PTB A;  5I80 A;  3UV5 A;  4OUF A;  2L5E A;  3UVX A;  3O34 A;  3DWY A;  4PCI A;  5F3A A;  4YYN A;  3IU5 A;  3G0J A;  4TU6 A;  4IOQ A;  3JVK A;  5HFR A;  5EA1 A;  4YBS A;  4LYS A;  5EWH A;  5FE9 A;  4NRA A;  2MJV B;  4YBT A;  5A83 A;  3DAI A;  5KHM A;  2I8N A;  4IOR A;  2DWW A;  4UIX A;  5HQ5 A;  3AAD A;  5FFV A;  4A9H A;  4LR6 A;  4J1P A;  4NQM A;  5HRW A;  5CS8 A;  5DFC A;  5CRM A;  4Z1S A;  5EVA A;  5D3L A;  4QEV A;  4NYX A;  5DKC A;  5FDZ A;  5D25 A;  5CQ6 A;  5FE4 A;  2DVR A;  4QC1 A;  4HBY A;  4QSW A;  4QZS A;  5FBX A;  4IR5 A;  5I88 A;  4QSP A;  4QB3 A;  5LKT A;  5E0R A;  4A9I A;  2FSA A;  5HQ7 A;  5CUA A;  5A5S A;  5DYU A;  4QSR A;  5DW2 A;  3UVW A;  4OGI A;  5EIC A;  4QNS A;  4A9F A;  5IGL A;  5CUB A;  4QUU A;  4NR7 A;  4NYW A;  4MEN A;  5I7Y A;  5ENF A;  4ALH A;  5ENJ A;  5L99 A;  5IG6 A;  5E9V A;  4N4I A;  4RVR A;  5DX4 A;  3P1C A;  4GPJ A;  5D24 A;  5EWC A;  4X2I A;  4QBM A;  5A81 A;  2YYN A;  2RNW A;  5H1U A;  2D82 A;  2R0Y A;  4O76 A;  5CPE A;  4F3I A;  5KTX A;  4TZ2 A;  2R0V A;  3P5O A;  5KO4 A;  5CRZ A;  4QYD A;  4NQN A;  1EQF A;  3U5P A;  2E7O A;  4UIY A;  5BT5 A;  4CL9 A;  5A82 A;  5HRX A;  4LZR A;  5ETB A;  4MR3 A;  5FB0 A;  2L84 A;  5C4Q A;  5COI A;  4FLP A;  4O72 A;  3U5J A;  5I40 A;  4YYM A;  1X0J A;  5AD2 A;  2R0S A;  5E74 A;  3JVJ A;  2RFJ A;  5CP5 A;  5EIS A;  4NXJ A;  5KTU A;  5KTW A;  5EV9 A;  4CUU A;  4QSX A;  5A7C A;  5FG5 A;  5CQ5 A;  5CUG A;  4O7B A;  5CQ8 A;  5DYX A;  5F62 A;  4NYV A;  5CTL A;  5E9Y A;  2F6J A;  3HMF A;  4UYH A;  3G0L A;  4CUT A;  4HXM A;  3JVL A;  5ENG A;  4HBV A;  4O74 A;  5CU8 A;  5H1V A;  5EWW A;  3O33 A;  2YEK A;  4YAT A;  4Z93 A;  5L97 A;  3LJW A;  2RNX A;  5JI8 A;  4QEW A;  2RNY A;  2N9G A;  5FH6 A;  4O75 A;  4YYH A;  4NUD A;  2H60 A;  5D3S A;  5EQ1 A;  4YY6 A;  5DLX A;  5AMF A;  5FH8 A;  4LZ2 A;  2YEM A;  4C66 A;  2L85 A;  5EGU A;  2G4A A;  3S91 A;  4LC2 A;  4UIV A;  2DVQ A;  5ENH A;  5F5Z A;  5A5O A;  4YAX A;  5ENC A;  2E7N A;  3O35 A;  4HXK A;  4QR4 A;  5H1T A;  4Q0O A;  4XY9 A;  5CQ3 A;  4NR4 A;  5C7N A;  3SVG A;  5DBM A;  4LZS A;  4OGJ A;  5D3H A;  5L8T A;  3LQI A;  4QSQ A;  4CFK A;  4J0S A;  2YDW A;  3FKM X;  1WUG A;  4YAD A;  4IOO A;  4NR9 A;  5CUD A;  2DKW A;  5CUC A;  4WHU A;  3HME A;  4O7C A;  5DFB A;  4J3I A;  3IU6 A;  3HMH A;  1WUM A;  4TU4 A;  5EWV A;  5E3D A;  5ACY A;  5FB1 A;  5LJ2 A;  4Z6I A;  5FH7 A;  4TQN A;  5LVR A;  5F63 A;  4HXS A;  5HCL A;  4QR5 A;  4LRG A;  4NR5 A;  5II1 A;  4DON A;  5BT4 A;  1JSP B;  4LYI A;  5IID A;  4BW4 A;  5FG4 A;  5K29 A;  4QSS A;  5F1L A;  4MR4 A;  5E9K A;  4N4G A;  5HFQ A;  5HEL A;  3UV4 A;  4XYA A;  3MB3 A;  4IR6 A;  5LKX A;  5C87 A;  4TT6 A;  3MUK A;  4QST A;  4WIV A;  5A5N A;  5J0D A;  4YBM A;  5L96 A;  4A9L A;  4N4H A;  5DKH A;  4HXL A;  4UYG A;  4UYE A;  4A9O A;  5CY9 A;  4N4F A;  3UVY A;  3AQA A;  4ALG A;  4HBX A;  4C67 A;  4TS8 A;  5EU1 A;  5DYA A;  5ENB A;  5I86 A;  4TYL A;  3O36 A;  5TB6 A;  2F6N A;  2GRC A;  4NRC A;  4UIU A;  5D7X A;  3UV2 A;  5ENE A;  2LSP B;  1ZS5 A;  5IGN A;  4QC3 A;  3LQH A;  2KTB B;  2R10 A;  4TT4 A;  5F61 A;  4CLB A;  4J0R A;  5E3G A;  1E6I A;  4XUB A;  5IGK A;  4YYK A;  3MB4 A;  5FE5 A;  4HXO A;  5BT3 A;  1JM4 B;  5EPB A;  4YH3 A;  5I83 A;  4AKN A;  2DAT A;  4MEO A;  3SVH A;  2YQD A;  3QZS A;  4UYF B;  5TCM A;  4YAB A;  5CFW A;  4QYL A;  5D3P A;  4BHW A;  4TTE A;  4NS5 A;  3UVD A;  3U5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...