2YEMA

Crystal structure of the second bromodomain of human brd4 with the inhibitor gw841819x
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
110
structure length
110
Chain Sequence
b'KVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BROMODOMAIN-CONTAINING PROTEIN 4
publication title Discovery and Characterization of Small Molecule Inhibitors of the Bet Family Bromodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 38
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2yemA00
4LZRA 2YELA 5CQ4A 3G0JA 5FE6A 5EVAA 5E3GA 2YEMA 5C89A 2DVQA 4QUTA 5FB1A 5HFRA 5HRXA 5CQ6A 4O71A 4YAXA 5L8TA 5EM3A 3IU5A 4MENA 5J0DA 3P1DA 5CGPA 3LQJA 4QR4A 3GG3A 5A5RA 4QSQA 5BT3A 5K29A 5A5PA 2E7NA 4NR7A 5JWMA 4GPJA 4YABA 4NS5A 2DATA 4QEVA 4LZ2A 5CUCA 4XUAA 3S92A 5CY9A 4A9KA 4Z1QA 5LJ0A 4E96A 2E3KA 4PCEA 4OUFA 3FKMX 5ENJA 5FE1A 4QSRA 5LJ1A 4NRCA 4MR4A 2FSAA 2GRCA 3G0LA 3S91A 4QR5A 5L97A 2I8NA 2D82A 4NQMA 4BJXA 3I3JA 4QSSA 5D3LA 5F5ZA 5FG6A 4TQNA 5IIDA 5LJ2A 4O7EA 4A9LA 2DWWA 4J0RA 5BT5A 2D9EA 2RFJA 4QC3A 4KV4A 4HXPA 5G4RA 5EWWA 5A5SA 4YYDA 4NXJA 5EQ1A 5A5QA 4O74A 4HBXA 5LKXA 5CUEA 5D24A 4BW3A 5ENGA 4O70A 5A83A 5CTLA 4TZ8A 5D0CA 5HJCA 2DVRA 4TT4A 5DFBA 5H1UA 5HEMA 4C66A 4UYDA 5TB6A 5EWDA 5CQTA 5A5OA 2OUOA 4PS5A 4HBWA 5KU3A 5DFDA 3ZYUA 4CUPA 5IGMA 4NUDA 4PTBA 5HQ5A 4TTEA 5CUDA 5AD3A 2R0VA 5A81A 1JM4B 4O78A 4QNSA 2RNWA 4QYDA 5FE8A 3U5KA 4TT6A 5DYXA 5CFWA 3TLPA 4NR9A 2YEKA 5DBMA 5D3RA 4YK0A 4YH4A 4LYIA 3LJWA 5F1HA 5FE4A 5E7DA 5I86A 3SVHA 4LYWA 4UIXA 5CRMA 2KTBB 5HFQA 5F63A 5DLXA 3JVLA 5FB0A 5LKZA 3SVFA 3UW9A 5CQ8A 5TCMA 4UYEA 4QEUA 3LQHA 4IR4A 4CL9A 3O35A 3P1CA 4TT2A 4TU6A 4TZ2A 1WUMA 4ZW1A 1X0JA 5HCLA 3Q2FA 5DFCA 4HBVA 3QZSA 3IU6A 4UITA 4QUUA 5F62A 5HRWA 4HXNA 4J0SA 5F2PA 4O7AA 4O77A 5ETBA 3K2JA 5DW2A 4A9EA 2DVVA 1E6IA 4NR6A 5AMEA 4C67A 3U5PA 5FFVA 4KCXA 3UVXA 5AD2A 2DKWA 4YC9A 4MR6A 4N4HA 4HXLA 5I40A 5E0RA 5ENBA 4TS8A 5D26A 5IBNA 3ONIA 4YBTA 4BW1A 1N72A 5L8UA 5CU8A 4HXSA 4UYHA 5FE5A 5ACYA 5FH6A 5H1TA 5D3PA 4NYVA 5LUUA 5HQ7A 4N3WA 4DONA 3U5MA 4QB3A 1WUGA 5L99A 4NYWA 4Z93A 4UYFA 5BT4A 3O33A 3QZVA 4UYFB 4ZC9A 5A5NA 5DYCA 5F60A 4HXMA 4WHUA 5EPBA 2LSPB 2OSSA 4CUUA 5ENFA 5A85A 4YYKA 5CPEA 4O7CA 4IR6A 5EA1A 4AKNA 5II1A 4NUEA 5EICA 4N4GA 5EP7A 5I89A 4YADA 4YYNA 4LDFA 4XY8A 3U5JA 5DKCA 4O7FA 3MQMA 2YQDA 2N9GA 2RO1A 5IG6A 5CUGA 4NYXA 2L84A 4HXRA 5FFWA 5C4QA 5I7YA 4KV1A 3MUKA 4IORA 3U5NA 5CQAA 5D3TA 3HMEA 5H1VA 4QSPA 4Z6HA 4F3IA 4A9NA 5ENIA 5C87A 5HM0A 4O72A 4TYLA 2G4AA 5CQ7A 2WP2A 3AADA 4NQNA 5FFYA 4YYMA 3P1FA 5DW1A 4CUTA 3QZTA 5EU1A 4NR8A 4HBYA 4YBMA 5E74A 5FH8A 4YBSA 5DYUA 3MXFA 4XY9A 4QSXA 5IGNA 5CQ5A 4YYIA 4YATA 4PKLA 5HENA 5EPRA 4BW2A 4A9FA 5CS8A 5IGLA 2YW5A 4PY6A 5ETDA 5CP5A 2YYNA 4A9MA 5I7XA 5E9KA 3UV2A 4CLBA 5L98A 4ZQLA 5FE0A 2I7KA 3D7CA 4O75A 4UIWA 4IR3A 5D3HA 2MJVB 4QSWA 5CRZA 4A9HA 5FBXA 4YYHA 4RVRA 5I80A 5DLZA 1F68A 4CFKA 4N4IA 4YYGA 5ENHA 5CZGA 3O37A 2F6JA 2E7OA 3JVMA 5E9LA 4XYAA 4ALGA 5EPSA 4YYJA 3DWYA 4NRBA 3P5OA 3SVGA 5I1QA 4UIYA 1ZS5A 5KTXA 5D7XA 2H60A 4QEWA 4N4FA 5A7CA 5HLSA 4IOOA 4QR3A 3P1EA 5DX4A 5LKTA 4LZSA 5KO4A 4QZSA 5ENCA 4LRGA 4OGIA 5KHMA 2RNYA 2RI7A 5FDZA 4CURA 5FE3A 4MEOA 2RNXA 4O76A 5CUAA 5LKUA 4Y03A 5EK9A 3UVWA 3MB4A 4IOQA 4UIUA 4A9JA 4X2IA 2R0SA 5KTUA 5L96A 4NR5A 4HXKA 5DKHA 4YY4A 4UIZA 4CFLA 4CUQA 5F1LA 5EWCA 3UV5A 2R10A 2L85A 3HMFA 5D3JA 4J3IA 2R0YA 2DVSA 5D3SA 5DYAA 1EQFA 3MB3A 2L5EA 5HQ6A 4UYGA 4WHWA 2OO1A 3U5LA 5E9IA 4MR5A 4QY4A 5E73A 3UVDA 4TU4A 4Q0OA 5IGKA 4NUCA 5C85A 3JVKA 4OGJA 4IR5A 4XUBA 5F25A 2NXBA 3AQAA 5LVQA 5CQ3A 5FG5A 3O36A 5FE9A 5G4SA 5EWHA 5FE7A 5I88A 2WP1A 4A9IA 3RCWA 4Z6IA 5C7NA 5F36A 5JI8A 4QSVA 4MEPA 4UIVA 4O7BA 5EV9A 5I83A 4Q0NA 3LQIA 5AMFA 4QSTA 3MULA 4FLPA 5FE2A 3JVJA 4YY6A 3HMHA 4BHWA 4BW4A 5E9MA 5EWVA 4A9OA 5EISA 5HRVA 4QC1A 4YH3A 3U5OA 5C8GA 2YDWA 5E9VA 4LYSA 4ALHA 3O34A 4MEQA 5EI4A 5KTWA 5LVRA 5FH7A 5H85A 5HELA 2F6NA 4PCIA 5DY7A 4Z1SA 5CUBA 4LR6A 4QYLA 4HXOA 5I29A 4WIVA 4QBMA 4NRAA 5E3DA 5COIA 5DKDA 3LXJA 5II2A 3UVYA 5EGUA 5FG4A 3Q2EA 1JSPB 4J1PA 4MR3A 5D3NA 3UV4A 5E9YA 4LC2A 4QSUA 5D25A 2RS9B 4NR4A 3DAIA 5F3AA 5ENEA 4CUSA 5F61A 3NXBA 5A82A
chains in the Genus database with same CATH superfamily
4LZRA 2YELA 5CQ4A 3G0JA 5FE6A 5EVAA 5E3GA 2YEMA 5C89A 2DVQA 4QUTA 5FB1A 5HFRA 5HRXA 5CQ6A 4O71A 4YAXA 5L8TA 5EM3A 3ERRA 3IU5A 4MENA 5J0DA 3P1DA 5CGPA 3LQJA 4QR4A 3GG3A 5A5RA 4QSQA 5BT3A 5K29A 5A5PA 2E7NA 4NR7A 5JWMA 4GPJA 4YABA 4NS5A 2DATA 4QEVA 4LZ2A 5CUCA 4XUAA 3S92A 5CY9A 4A9KA 4Z1QA 5LJ0A 4E96A 2E3KA 4PCEA 4OUFA 3FKMX 5ENJA 5FE1A 4QSRA 5LJ1A 4NRCA 4MR4A 2FSAA 2GRCA 3G0LA 3S91A 4QR5A 5L97A 2I8NA 2D82A 4NQMA 4BJXA 3I3JA 4QSSA 5D3LA 5F5ZA 5FG6A 4TQNA 5IIDA 5LJ2A 4O7EA 4A9LA 2DWWA 4J0RA 5BT5A 2D9EA 2RFJA 4QC3A 4KV4A 4HXPA 5G4RA 5EWWA 5A5SA 4YYDA 4NXJA 5EQ1A 5A5QA 4O74A 4HBXA 5LKXA 5CUEA 5D24A 4BW3A 5ENGA 4O70A 5A83A 5CTLA 4TZ8A 5D0CA 5HJCA 2DVRA 4TT4A 5DFBA 5H1UA 5HEMA 4C66A 4UYDA 5TB6A 5EWDA 5CQTA 5A5OA 2OUOA 4PS5A 4HBWA 5KU3A 5DFDA 3ZYUA 4CUPA 5IGMA 4NUDA 4PTBA 5HQ5A 3VKHA 4TTEA 5CUDA 5AD3A 2R0VA 5A81A 1JM4B 1PUOA 4O78A 4QNSA 2RNWA 4QYDA 5FE8A 3U5KA 4TT6A 5DYXA 5CFWA 3TLPA 4NR9A 2YEKA 5DBMA 5D3RA 4YK0A 4YH4A 4LYIA 3LJWA 5F1HA 5FE4A 5E7DA 5I86A 3SVHA 4LYWA 4UIXA 5CRMA 2KTBB 5HFQA 5F63A 5DLXA 3JVLA 5FB0A 5LKZA 3SVFA 3UW9A 5CQ8A 5TCMA 4UYEA 4QEUA 3LQHA 4IR4A 4CL9A 3O35A 3P1CA 4TT2A 4TU6A 4TZ2A 1WUMA 4ZW1A 1X0JA 5HCLA 3Q2FA 5DFCA 4HBVA 3QZSA 3IU6A 4UITA 4QUUA 5F62A 5HRWA 4HXNA 4J0SA 5F2PA 4O7AA 4O77A 5ETBA 3K2JA 5DW2A 4A9EA 2DVVA 1E6IA 4NR6A 5AMEA 4C67A 3U5PA 5FFVA 4KCXA 3UVXA 5AD2A 2DKWA 4YC9A 4MR6A 4N4HA 4HXLA 5I40A 5E0RA 5ENBA 4TS8A 5D26A 5IBNA 3ONIA 4YBTA 4BW1A 1N72A 5L8UA 5CU8A 4HXSA 4UYHA 5FE5A 5ACYA 5FH6A 5H1TA 5D3PA 4NYVA 5LUUA 5HQ7A 4N3WA 4DONA 3U5MA 4QB3A 1WUGA 5L99A 4NYWA 4Z93A 4UYFA 5BT4A 3O33A 3QZVA 4UYFB 4ZC9A 5A5NA 5DYCA 5F60A 4HXMA 4WHUA 5EPBA 2LSPB 2OSSA 4CUUA 5ENFA 5A85A 4YYKA 5CPEA 4O7CA 4IR6A 5EA1A 4AKNA 5II1A 4NUEA 5EICA 4N4GA 5EP7A 5I89A 4YADA 4YYNA 4LDFA 4XY8A 3U5JA 5DKCA 4O7FA 3MQMA 2YQDA 2N9GA 2RO1A 5IG6A 5CUGA 4NYXA 2L84A 4HXRA 5FFWA 5C4QA 5I7YA 4KV1A 3MUKA 4AI6A 4IORA 3U5NA 5CQAA 5D3TA 3HMEA 5H1VA 4QSPA 4Z6HA 4F3IA 4A9NA 5ENIA 5C87A 5HM0A 4O72A 4TYLA 2G4AA 5CQ7A 2WP2A 3AADA 4NQNA 5FFYA 4YYMA 3P1FA 5DW1A 4CUTA 3QZTA 5EU1A 4NR8A 4HBYA 4YBMA 3VKGA 5E74A 5FH8A 4YBSA 5DYUA 3MXFA 4XY9A 4QSXA 5IGNA 5CQ5A 4YYIA 4YATA 4PKLA 5HENA 5EPRA 4BW2A 4A9FA 5CS8A 5IGLA 2YW5A 4PY6A 5ETDA 5CP5A 2YYNA 4A9MA 5I7XA 5E9KA 3UV2A 4CLBA 5L98A 4ZQLA 5FE0A 2I7KA 3D7CA 4O75A 4UIWA 4IR3A 5D3HA 2MJVB 4QSWA 5CRZA 4A9HA 5FBXA 4YYHA 4RVRA 5I80A 5DLZA 1F68A 4CFKA 4N4IA 4YYGA 5ENHA 5CZGA 3O37A 2F6JA 2EJNA 2E7OA 3JVMA 5E9LA 4XYAA 4ALGA 5EPSA 4YYJA 3DWYA 4NRBA 3P5OA 3SVGA 5I1QA 4UIYA 1ZS5A 5KTXA 5D7XA 2H60A 4QEWA 4N4FA 5A7CA 5HLSA 4IOOA 4QR3A 3P1EA 5DX4A 5LKTA 4LZSA 5KO4A 4QZSA 5ENCA 4LRGA 4OGIA 5KHMA 2RNYA 2RI7A 5FDZA 4CURA 5FE3A 4MEOA 2RNXA 4O76A 5CUAA 5LKUA 4Y03A 5EK9A 3UVWA 3MB4A 4IOQA 4UIUA 4A9JA 4X2IA 2R0SA 5KTUA 5L96A 4NR5A 4HXKA 5DKHA 4YY4A 4UIZA 4CFLA 4CUQA 5F1LA 5EWCA 3UV5A 2R10A 2L85A 3HMFA 5D3JA 4J3IA 4AKGA 2R0YA 2DVSA 5D3SA 5DYAA 1EQFA 3MB3A 2L5EA 5HQ6A 4UYGA 4WHWA 2OO1A 3U5LA 5E9IA 4MR5A 4QY4A 3D1BA 5E73A 3UVDA 4TU4A 4Q0OA 5IGKA 4NUCA 5C85A 3JVKA 4OGJA 4IR5A 4XUBA 5F25A 2NXBA 3AQAA 5LVQA 5CQ3A 5FG5A 3O36A 5FE9A 5G4SA 5EWHA 5FE7A 5I88A 2WP1A 4A9IA 4AKIA 3RCWA 4Z6IA 5C7NA 5F36A 5JI8A 4QSVA 4MEPA 4UIVA 4O7BA 5EV9A 5I83A 4Q0NA 3LQIA 5AMFA 4QSTA 3MULA 4FLPA 5FE2A 3JVJA 4YY6A 3HMHA 4BHWA 4BW4A 5E9MA 5EWVA 4A9OA 5EISA 5HRVA 4QC1A 4YH3A 3U5OA 5C8GA 2YDWA 5E9VA 4LYSA 4ALHA 3O34A 4MEQA 5EI4A 5KTWA 5LVRA 5FH7A 5H85A 5HELA 2F6NA 4PCIA 5DY7A 4Z1SA 3D1DA 5CUBA 4LR6A 4QYLA 4HXOA 5I29A 4WIVA 4QBMA 4NRAA 5E3DA 5COIA 5DKDA 3LXJA 5II2A 3UVYA 5EGUA 5FG4A 3Q2EA 1JSPB 4J1PA 4MR3A 5D3NA 3UV4A 5E9YA 4AKHA 4LC2A 4QSUA 5D25A 2RS9B 4NR4A 3DAIA 5F3AA 1ZKRA 5ENEA 4CUSA 5F61A 3NXBA 5A82A
chains in the Genus database with same CATH topology
4LZRA 2YELA 5CQ4A 3G0JA 5FE6A 5EVAA 5E3GA 2YEMA 5C89A 2DVQA 4QUTA 5FB1A 5HFRA 5HRXA 5CQ6A 4O71A 4YAXA 5L8TA 5EM3A 3IU5A 4MENA 5J0DA 3P1DA 5CGPA 3LQJA 4QR4A 3GG3A 5A5RA 4QSQA 5BT3A 5K29A 5A5PA 2E7NA 4NR7A 5JWMA 4GPJA 4YABA 4NS5A 2DATA 4QEVA 4LZ2A 5CUCA 4XUAA 3S92A 5CY9A 4A9KA 4Z1QA 5LJ0A 4E96A 2E3KA 4PCEA 4OUFA 3FKMX 5ENJA 5FE1A 4QSRA 5LJ1A 4NRCA 4MR4A 2FSAA 2GRCA 3G0LA 3S91A 4QR5A 5L97A 2I8NA 2D82A 4NQMA 4BJXA 3I3JA 4QSSA 5D3LA 5F5ZA 5FG6A 4TQNA 5IIDA 5LJ2A 4O7EA 4A9LA 2DWWA 4J0RA 5BT5A 2D9EA 2RFJA 4QC3A 4KV4A 4HXPA 5G4RA 5EWWA 5A5SA 4YYDA 4NXJA 5EQ1A 5A5QA 4O74A 4HBXA 5LKXA 5CUEA 5D24A 4BW3A 5ENGA 4O70A 5A83A 5CTLA 4TZ8A 5D0CA 5HJCA 2DVRA 4TT4A 5DFBA 5H1UA 5HEMA 4C66A 4UYDA 5TB6A 5EWDA 5CQTA 5A5OA 2OUOA 4PS5A 4HBWA 5KU3A 5DFDA 3ZYUA 4CUPA 5IGMA 4NUDA 4PTBA 5HQ5A 4TTEA 5CUDA 5AD3A 2R0VA 5A81A 1JM4B 4O78A 4QNSA 2RNWA 4QYDA 5FE8A 3U5KA 4TT6A 5DYXA 5CFWA 3TLPA 4NR9A 2YEKA 5DBMA 5D3RA 4YK0A 4YH4A 4LYIA 3LJWA 5F1HA 5FE4A 5E7DA 5I86A 3SVHA 4LYWA 4UIXA 5CRMA 2KTBB 5HFQA 5F63A 5DLXA 3JVLA 5FB0A 5LKZA 3SVFA 3UW9A 5CQ8A 5TCMA 4UYEA 4QEUA 3LQHA 4IR4A 4CL9A 3O35A 3P1CA 4TT2A 4TU6A 4TZ2A 1WUMA 4ZW1A 1X0JA 5HCLA 3Q2FA 5DFCA 4HBVA 3QZSA 3IU6A 4UITA 4QUUA 5F62A 5HRWA 4HXNA 4J0SA 5F2PA 4O7AA 4O77A 5ETBA 3K2JA 5DW2A 4A9EA 2DVVA 1E6IA 4NR6A 5AMEA 4C67A 3U5PA 5FFVA 4KCXA 3UVXA 5AD2A 2DKWA 4YC9A 4MR6A 4N4HA 4HXLA 5I40A 5E0RA 5ENBA 4TS8A 5D26A 5IBNA 3ONIA 4YBTA 4BW1A 1N72A 5L8UA 5CU8A 4HXSA 4UYHA 5FE5A 5ACYA 5FH6A 5H1TA 5D3PA 4NYVA 5LUUA 5HQ7A 4N3WA 4DONA 3U5MA 4QB3A 1WUGA 5L99A 4NYWA 4Z93A 4UYFA 5BT4A 3O33A 3QZVA 4UYFB 4ZC9A 5A5NA 5DYCA 5F60A 4HXMA 4WHUA 5EPBA 2LSPB 2OSSA 4CUUA 5ENFA 5A85A 4YYKA 5CPEA 4O7CA 4IR6A 5EA1A 4AKNA 5II1A 4NUEA 5EICA 4N4GA 5EP7A 5I89A 4YADA 4YYNA 4LDFA 4XY8A 3U5JA 5DKCA 4O7FA 3MQMA 2YQDA 2N9GA 2RO1A 5IG6A 5CUGA 4NYXA 2L84A 4HXRA 5FFWA 5C4QA 5I7YA 4KV1A 3MUKA 4IORA 3U5NA 5CQAA 5D3TA 3HMEA 5H1VA 4QSPA 4Z6HA 4F3IA 4A9NA 5ENIA 5C87A 5HM0A 4O72A 4TYLA 2G4AA 5CQ7A 2WP2A 3AADA 4NQNA 5FFYA 4YYMA 3P1FA 5DW1A 4CUTA 3QZTA 5EU1A 4NR8A 4HBYA 4YBMA 5E74A 5FH8A 4YBSA 5DYUA 3MXFA 4XY9A 4QSXA 5IGNA 5CQ5A 4YYIA 4YATA 4PKLA 5HENA 5EPRA 4BW2A 4A9FA 5CS8A 5IGLA 2YW5A 4PY6A 5ETDA 5CP5A 2YYNA 4A9MA 5I7XA 5E9KA 3UV2A 4CLBA 5L98A 4ZQLA 5FE0A 2I7KA 3D7CA 4O75A 4UIWA 4IR3A 5D3HA 2MJVB 4QSWA 5CRZA 4A9HA 5FBXA 4YYHA 4RVRA 5I80A 5DLZA 1F68A 4CFKA 4N4IA 4YYGA 5ENHA 5CZGA 3O37A 2F6JA 2E7OA 3JVMA 5E9LA 4XYAA 4ALGA 5EPSA 4YYJA 3DWYA 4NRBA 3P5OA 3SVGA 5I1QA 4UIYA 1ZS5A 5KTXA 5D7XA 2H60A 4QEWA 4N4FA 5A7CA 5HLSA 4IOOA 4QR3A 3P1EA 5DX4A 5LKTA 4LZSA 5KO4A 4QZSA 5ENCA 4LRGA 4OGIA 5KHMA 2RNYA 2RI7A 5FDZA 4CURA 5FE3A 4MEOA 2RNXA 4O76A 5CUAA 5LKUA 4Y03A 5EK9A 3UVWA 3MB4A 4IOQA 4UIUA 4A9JA 4X2IA 2R0SA 5KTUA 5L96A 4NR5A 4HXKA 5DKHA 4YY4A 4UIZA 4CFLA 4CUQA 5F1LA 5EWCA 3UV5A 2R10A 2L85A 3HMFA 5D3JA 4J3IA 2R0YA 2DVSA 5D3SA 5DYAA 1EQFA 3MB3A 2L5EA 5HQ6A 4UYGA 4WHWA 2OO1A 3U5LA 5E9IA 4MR5A 4QY4A 5E73A 3UVDA 4TU4A 4Q0OA 5IGKA 4NUCA 5C85A 3JVKA 4OGJA 4IR5A 4XUBA 5F25A 2NXBA 3AQAA 5LVQA 5CQ3A 5FG5A 3O36A 5FE9A 5G4SA 5EWHA 5FE7A 5I88A 2WP1A 4A9IA 3RCWA 4Z6IA 5C7NA 5F36A 5JI8A 4QSVA 4MEPA 4UIVA 4O7BA 5EV9A 5I83A 4Q0NA 3LQIA 5AMFA 4QSTA 3MULA 4FLPA 5FE2A 3JVJA 4YY6A 3HMHA 4BHWA 4BW4A 5E9MA 5EWVA 4A9OA 5EISA 5HRVA 4QC1A 4YH3A 3U5OA 5C8GA 2YDWA 5E9VA 4LYSA 4ALHA 3O34A 4MEQA 5EI4A 5KTWA 5LVRA 5FH7A 5H85A 5HELA 2F6NA 4PCIA 5DY7A 4Z1SA 5CUBA 4LR6A 4QYLA 4HXOA 5I29A 4WIVA 4QBMA 4NRAA 5E3DA 5COIA 5DKDA 3LXJA 5II2A 3UVYA 5EGUA 5FG4A 3Q2EA 1JSPB 4J1PA 4MR3A 5D3NA 3UV4A 5E9YA 4LC2A 4QSUA 5D25A 2RS9B 4NR4A 3DAIA 5F3AA 5ENEA 4CUSA 5F61A 3NXBA 5A82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LZR A;  2YEL A;  5CQ4 A;  3G0J A;  5FE6 A;  5EVA A;  5E3G A;  2YEM A;  5C89 A;  2DVQ A;  4QUT A;  5FB1 A;  5HFR A;  5HRX A;  5CQ6 A;  4O71 A;  4YAX A;  5L8T A;  5EM3 A;  3IU5 A;  4MEN A;  5J0D A;  3P1D A;  5CGP A;  3LQJ A;  4QR4 A;  3GG3 A;  5A5R A;  4QSQ A;  5BT3 A;  5K29 A;  5A5P A;  2E7N A;  4NR7 A;  5JWM A;  4GPJ A;  4YAB A;  4NS5 A;  2DAT A;  4QEV A;  4LZ2 A;  5CUC A;  4XUA A;  3S92 A;  5CY9 A;  4A9K A;  4Z1Q A;  5LJ0 A;  4E96 A;  2E3K A;  4PCE A;  4OUF A;  3FKM X;  5ENJ A;  5FE1 A;  4QSR A;  5LJ1 A;  4NRC A;  4MR4 A;  2FSA A;  2GRC A;  3G0L A;  3S91 A;  4QR5 A;  5L97 A;  2I8N A;  2D82 A;  4NQM A;  4BJX A;  3I3J A;  4QSS A;  5D3L A;  5F5Z A;  5FG6 A;  4TQN A;  5IID A;  5LJ2 A;  4O7E A;  4A9L A;  2DWW A;  4J0R A;  5BT5 A;  2D9E A;  2RFJ A;  4QC3 A;  4KV4 A;  4HXP A;  5G4R A;  5EWW A;  5A5S A;  4YYD A;  4NXJ A;  5EQ1 A;  5A5Q A;  4O74 A;  4HBX A;  5LKX A;  5CUE A;  5D24 A;  4BW3 A;  5ENG A;  4O70 A;  5A83 A;  5CTL A;  4TZ8 A;  5D0C A;  5HJC A;  2DVR A;  4TT4 A;  5DFB A;  5H1U A;  5HEM A;  4C66 A;  4UYD A;  5TB6 A;  5EWD A;  5CQT A;  5A5O A;  2OUO A;  4PS5 A;  4HBW A;  5KU3 A;  5DFD A;  3ZYU A;  4CUP A;  5IGM A;  4NUD A;  4PTB A;  5HQ5 A;  4TTE A;  5CUD A;  5AD3 A;  2R0V A;  5A81 A;  1JM4 B;  4O78 A;  4QNS A;  2RNW A;  4QYD A;  5FE8 A;  3U5K A;  4TT6 A;  5DYX A;  5CFW A;  3TLP A;  4NR9 A;  2YEK A;  5DBM A;  5D3R A;  4YK0 A;  4YH4 A;  4LYI A;  3LJW A;  5F1H A;  5FE4 A;  5E7D A;  5I86 A;  3SVH A;  4LYW A;  4UIX A;  5CRM A;  2KTB B;  5HFQ A;  5F63 A;  5DLX A;  3JVL A;  5FB0 A;  5LKZ A;  3SVF A;  3UW9 A;  5CQ8 A;  5TCM A;  4UYE A;  4QEU A;  3LQH A;  4IR4 A;  4CL9 A;  3O35 A;  3P1C A;  4TT2 A;  4TU6 A;  4TZ2 A;  1WUM A;  4ZW1 A;  1X0J A;  5HCL A;  3Q2F A;  5DFC A;  4HBV A;  3QZS A;  3IU6 A;  4UIT A;  4QUU A;  5F62 A;  5HRW A;  4HXN A;  4J0S A;  5F2P A;  4O7A A;  4O77 A;  5ETB A;  3K2J A;  5DW2 A;  4A9E A;  2DVV A;  1E6I A;  4NR6 A;  5AME A;  4C67 A;  3U5P A;  5FFV A;  4KCX A;  3UVX A;  5AD2 A;  2DKW A;  4YC9 A;  4MR6 A;  4N4H A;  4HXL A;  5I40 A;  5E0R A;  5ENB A;  4TS8 A;  5D26 A;  5IBN A;  3ONI A;  4YBT A;  4BW1 A;  1N72 A;  5L8U A;  5CU8 A;  4HXS A;  4UYH A;  5FE5 A;  5ACY A;  5FH6 A;  5H1T A;  5D3P A;  4NYV A;  5LUU A;  5HQ7 A;  4N3W A;  4DON A;  3U5M A;  4QB3 A;  1WUG A;  5L99 A;  4NYW A;  4Z93 A;  4UYF A;  5BT4 A;  3O33 A;  3QZV A;  4UYF B;  4ZC9 A;  5A5N A;  5DYC A;  5F60 A;  4HXM A;  4WHU A;  5EPB A;  2LSP B;  2OSS A;  4CUU A;  5ENF A;  5A85 A;  4YYK A;  5CPE A;  4O7C A;  4IR6 A;  5EA1 A;  4AKN A;  5II1 A;  4NUE A;  5EIC A;  4N4G A;  5EP7 A;  5I89 A;  4YAD A;  4YYN A;  4LDF A;  4XY8 A;  3U5J A;  5DKC A;  4O7F A;  3MQM A;  2YQD A;  2N9G A;  2RO1 A;  5IG6 A;  5CUG A;  4NYX A;  2L84 A;  4HXR A;  5FFW A;  5C4Q A;  5I7Y A;  4KV1 A;  3MUK A;  4IOR A;  3U5N A;  5CQA A;  5D3T A;  3HME A;  5H1V A;  4QSP A;  4Z6H A;  4F3I A;  4A9N A;  5ENI A;  5C87 A;  5HM0 A;  4O72 A;  4TYL A;  2G4A A;  5CQ7 A;  2WP2 A;  3AAD A;  4NQN A;  5FFY A;  4YYM A;  3P1F A;  5DW1 A;  4CUT A;  3QZT A;  5EU1 A;  4NR8 A;  4HBY A;  4YBM A;  5E74 A;  5FH8 A;  4YBS A;  5DYU A;  3MXF A;  4XY9 A;  4QSX A;  5IGN A;  5CQ5 A;  4YYI A;  4YAT A;  4PKL A;  5HEN A;  5EPR A;  4BW2 A;  4A9F A;  5CS8 A;  5IGL A;  2YW5 A;  4PY6 A;  5ETD A;  5CP5 A;  2YYN A;  4A9M A;  5I7X A;  5E9K A;  3UV2 A;  4CLB A;  5L98 A;  4ZQL A;  5FE0 A;  2I7K A;  3D7C A;  4O75 A;  4UIW A;  4IR3 A;  5D3H A;  2MJV B;  4QSW A;  5CRZ A;  4A9H A;  5FBX A;  4YYH A;  4RVR A;  5I80 A;  5DLZ A;  1F68 A;  4CFK A;  4N4I A;  4YYG A;  5ENH A;  5CZG A;  3O37 A;  2F6J A;  2E7O A;  3JVM A;  5E9L A;  4XYA A;  4ALG A;  5EPS A;  4YYJ A;  3DWY A;  4NRB A;  3P5O A;  3SVG A;  5I1Q A;  4UIY A;  1ZS5 A;  5KTX A;  5D7X A;  2H60 A;  4QEW A;  4N4F A;  5A7C A;  5HLS A;  4IOO A;  4QR3 A;  3P1E A;  5DX4 A;  5LKT A;  4LZS A;  5KO4 A;  4QZS A;  5ENC A;  4LRG A;  4OGI A;  5KHM A;  2RNY A;  2RI7 A;  5FDZ A;  4CUR A;  5FE3 A;  4MEO A;  2RNX A;  4O76 A;  5CUA A;  5LKU A;  4Y03 A;  5EK9 A;  3UVW A;  3MB4 A;  4IOQ A;  4UIU A;  4A9J A;  4X2I A;  2R0S A;  5KTU A;  5L96 A;  4NR5 A;  4HXK A;  5DKH A;  4YY4 A;  4UIZ A;  4CFL A;  4CUQ A;  5F1L A;  5EWC A;  3UV5 A;  2R10 A;  2L85 A;  3HMF A;  5D3J A;  4J3I A;  2R0Y A;  2DVS A;  5D3S A;  5DYA A;  1EQF A;  3MB3 A;  2L5E A;  5HQ6 A;  4UYG A;  4WHW A;  2OO1 A;  3U5L A;  5E9I A;  4MR5 A;  4QY4 A;  5E73 A;  3UVD A;  4TU4 A;  4Q0O A;  5IGK A;  4NUC A;  5C85 A;  3JVK A;  4OGJ A;  4IR5 A;  4XUB A;  5F25 A;  2NXB A;  3AQA A;  5LVQ A;  5CQ3 A;  5FG5 A;  3O36 A;  5FE9 A;  5G4S A;  5EWH A;  5FE7 A;  5I88 A;  2WP1 A;  4A9I A;  3RCW A;  4Z6I A;  5C7N A;  5F36 A;  5JI8 A;  4QSV A;  4MEP A;  4UIV A;  4O7B A;  5EV9 A;  5I83 A;  4Q0N A;  3LQI A;  5AMF A;  4QST A;  3MUL A;  4FLP A;  5FE2 A;  3JVJ A;  4YY6 A;  3HMH A;  4BHW A;  4BW4 A;  5E9M A;  5EWV A;  4A9O A;  5EIS A;  5HRV A;  4QC1 A;  4YH3 A;  3U5O A;  5C8G A;  2YDW A;  5E9V A;  4LYS A;  4ALH A;  3O34 A;  4MEQ A;  5EI4 A;  5KTW A;  5LVR A;  5FH7 A;  5H85 A;  5HEL A;  2F6N A;  4PCI A;  5DY7 A;  4Z1S A;  5CUB A;  4LR6 A;  4QYL A;  4HXO A;  5I29 A;  4WIV A;  4QBM A;  4NRA A;  5E3D A;  5COI A;  5DKD A;  3LXJ A;  5II2 A;  3UVY A;  5EGU A;  5FG4 A;  3Q2E A;  1JSP B;  4J1P A;  4MR3 A;  5D3N A;  3UV4 A;  5E9Y A;  4LC2 A;  4QSU A;  5D25 A;  2RS9 B;  4NR4 A;  3DAI A;  5F3A A;  5ENE A;  4CUS A;  5F61 A;  3NXB A;  5A82 A; 
#chains in the Genus database with same CATH topology
 4LZR A;  2YEL A;  5CQ4 A;  3G0J A;  5FE6 A;  5EVA A;  5E3G A;  2YEM A;  5C89 A;  2DVQ A;  4QUT A;  5FB1 A;  5HFR A;  5HRX A;  5CQ6 A;  4O71 A;  4YAX A;  5L8T A;  5EM3 A;  3ERR A;  3IU5 A;  4MEN A;  5J0D A;  3P1D A;  5CGP A;  3LQJ A;  4QR4 A;  3GG3 A;  5A5R A;  4QSQ A;  5BT3 A;  5K29 A;  5A5P A;  2E7N A;  4NR7 A;  5JWM A;  4GPJ A;  4YAB A;  4NS5 A;  2DAT A;  4QEV A;  4LZ2 A;  5CUC A;  4XUA A;  3S92 A;  5CY9 A;  4A9K A;  4Z1Q A;  5LJ0 A;  4E96 A;  2E3K A;  4PCE A;  4OUF A;  3FKM X;  5ENJ A;  5FE1 A;  4QSR A;  5LJ1 A;  4NRC A;  4MR4 A;  2FSA A;  2GRC A;  3G0L A;  3S91 A;  4QR5 A;  5L97 A;  2I8N A;  2D82 A;  4NQM A;  4BJX A;  3I3J A;  4QSS A;  5D3L A;  5F5Z A;  5FG6 A;  4TQN A;  5IID A;  5LJ2 A;  4O7E A;  4A9L A;  2DWW A;  4J0R A;  5BT5 A;  2D9E A;  2RFJ A;  4QC3 A;  4KV4 A;  4HXP A;  5G4R A;  5EWW A;  5A5S A;  4YYD A;  4NXJ A;  5EQ1 A;  5A5Q A;  4O74 A;  4HBX A;  5LKX A;  5CUE A;  5D24 A;  4BW3 A;  5ENG A;  4O70 A;  5A83 A;  5CTL A;  4TZ8 A;  5D0C A;  5HJC A;  2DVR A;  4TT4 A;  5DFB A;  5H1U A;  5HEM A;  4C66 A;  4UYD A;  5TB6 A;  5EWD A;  5CQT A;  5A5O A;  2OUO A;  4PS5 A;  4HBW A;  5KU3 A;  5DFD A;  3ZYU A;  4CUP A;  5IGM A;  4NUD A;  4PTB A;  5HQ5 A;  3VKH A;  4TTE A;  5CUD A;  5AD3 A;  2R0V A;  5A81 A;  1JM4 B;  1PUO A;  4O78 A;  4QNS A;  2RNW A;  4QYD A;  5FE8 A;  3U5K A;  4TT6 A;  5DYX A;  5CFW A;  3TLP A;  4NR9 A;  2YEK A;  5DBM A;  5D3R A;  4YK0 A;  4YH4 A;  4LYI A;  3LJW A;  5F1H A;  5FE4 A;  5E7D A;  5I86 A;  3SVH A;  4LYW A;  4UIX A;  5CRM A;  2KTB B;  5HFQ A;  5F63 A;  5DLX A;  3JVL A;  5FB0 A;  5LKZ A;  3SVF A;  3UW9 A;  5CQ8 A;  5TCM A;  4UYE A;  4QEU A;  3LQH A;  4IR4 A;  4CL9 A;  3O35 A;  3P1C A;  4TT2 A;  4TU6 A;  4TZ2 A;  1WUM A;  4ZW1 A;  1X0J A;  5HCL A;  3Q2F A;  5DFC A;  4HBV A;  3QZS A;  3IU6 A;  4UIT A;  4QUU A;  5F62 A;  5HRW A;  4HXN A;  4J0S A;  5F2P A;  4O7A A;  4O77 A;  5ETB A;  3K2J A;  5DW2 A;  4A9E A;  2DVV A;  1E6I A;  4NR6 A;  5AME A;  4C67 A;  3U5P A;  5FFV A;  4KCX A;  3UVX A;  5AD2 A;  2DKW A;  4YC9 A;  4MR6 A;  4N4H A;  4HXL A;  5I40 A;  5E0R A;  5ENB A;  4TS8 A;  5D26 A;  5IBN A;  3ONI A;  4YBT A;  4BW1 A;  1N72 A;  5L8U A;  5CU8 A;  4HXS A;  4UYH A;  5FE5 A;  5ACY A;  5FH6 A;  5H1T A;  5D3P A;  4NYV A;  5LUU A;  5HQ7 A;  4N3W A;  4DON A;  3U5M A;  4QB3 A;  1WUG A;  5L99 A;  4NYW A;  4Z93 A;  4UYF A;  5BT4 A;  3O33 A;  3QZV A;  4UYF B;  4ZC9 A;  5A5N A;  5DYC A;  5F60 A;  4HXM A;  4WHU A;  5EPB A;  2LSP B;  2OSS A;  4CUU A;  5ENF A;  5A85 A;  4YYK A;  5CPE A;  4O7C A;  4IR6 A;  5EA1 A;  4AKN A;  5II1 A;  4NUE A;  5EIC A;  4N4G A;  5EP7 A;  5I89 A;  4YAD A;  4YYN A;  4LDF A;  4XY8 A;  3U5J A;  5DKC A;  4O7F A;  3MQM A;  2YQD A;  2N9G A;  2RO1 A;  5IG6 A;  5CUG A;  4NYX A;  2L84 A;  4HXR A;  5FFW A;  5C4Q A;  5I7Y A;  4KV1 A;  3MUK A;  4AI6 A;  4IOR A;  3U5N A;  5CQA A;  5D3T A;  3HME A;  5H1V A;  4QSP A;  4Z6H A;  4F3I A;  4A9N A;  5ENI A;  5C87 A;  5HM0 A;  4O72 A;  4TYL A;  2G4A A;  5CQ7 A;  2WP2 A;  3AAD A;  4NQN A;  5FFY A;  4YYM A;  3P1F A;  5DW1 A;  4CUT A;  3QZT A;  5EU1 A;  4NR8 A;  4HBY A;  4YBM A;  3VKG A;  5E74 A;  5FH8 A;  4YBS A;  5DYU A;  3MXF A;  4XY9 A;  4QSX A;  5IGN A;  5CQ5 A;  4YYI A;  4YAT A;  4PKL A;  5HEN A;  5EPR A;  4BW2 A;  4A9F A;  5CS8 A;  5IGL A;  2YW5 A;  4PY6 A;  5ETD A;  5CP5 A;  2YYN A;  4A9M A;  5I7X A;  5E9K A;  3UV2 A;  4CLB A;  5L98 A;  4ZQL A;  5FE0 A;  2I7K A;  3D7C A;  4O75 A;  4UIW A;  4IR3 A;  5D3H A;  2MJV B;  4QSW A;  5CRZ A;  4A9H A;  5FBX A;  4YYH A;  4RVR A;  5I80 A;  5DLZ A;  1F68 A;  4CFK A;  4N4I A;  4YYG A;  5ENH A;  5CZG A;  3O37 A;  2F6J A;  2EJN A;  2E7O A;  3JVM A;  5E9L A;  4XYA A;  4ALG A;  5EPS A;  4YYJ A;  3DWY A;  4NRB A;  3P5O A;  3SVG A;  5I1Q A;  4UIY A;  1ZS5 A;  5KTX A;  5D7X A;  2H60 A;  4QEW A;  4N4F A;  5A7C A;  5HLS A;  4IOO A;  4QR3 A;  3P1E A;  5DX4 A;  5LKT A;  4LZS A;  5KO4 A;  4QZS A;  5ENC A;  4LRG A;  4OGI A;  5KHM A;  2RNY A;  2RI7 A;  5FDZ A;  4CUR A;  5FE3 A;  4MEO A;  2RNX A;  4O76 A;  5CUA A;  5LKU A;  4Y03 A;  5EK9 A;  3UVW A;  3MB4 A;  4IOQ A;  4UIU A;  4A9J A;  4X2I A;  2R0S A;  5KTU A;  5L96 A;  4NR5 A;  4HXK A;  5DKH A;  4YY4 A;  4UIZ A;  4CFL A;  4CUQ A;  5F1L A;  5EWC A;  3UV5 A;  2R10 A;  2L85 A;  3HMF A;  5D3J A;  4J3I A;  4AKG A;  2R0Y A;  2DVS A;  5D3S A;  5DYA A;  1EQF A;  3MB3 A;  2L5E A;  5HQ6 A;  4UYG A;  4WHW A;  2OO1 A;  3U5L A;  5E9I A;  4MR5 A;  4QY4 A;  3D1B A;  5E73 A;  3UVD A;  4TU4 A;  4Q0O A;  5IGK A;  4NUC A;  5C85 A;  3JVK A;  4OGJ A;  4IR5 A;  4XUB A;  5F25 A;  2NXB A;  3AQA A;  5LVQ A;  5CQ3 A;  5FG5 A;  3O36 A;  5FE9 A;  5G4S A;  5EWH A;  5FE7 A;  5I88 A;  2WP1 A;  4A9I A;  4AKI A;  3RCW A;  4Z6I A;  5C7N A;  5F36 A;  5JI8 A;  4QSV A;  4MEP A;  4UIV A;  4O7B A;  5EV9 A;  5I83 A;  4Q0N A;  3LQI A;  5AMF A;  4QST A;  3MUL A;  4FLP A;  5FE2 A;  3JVJ A;  4YY6 A;  3HMH A;  4BHW A;  4BW4 A;  5E9M A;  5EWV A;  4A9O A;  5EIS A;  5HRV A;  4QC1 A;  4YH3 A;  3U5O A;  5C8G A;  2YDW A;  5E9V A;  4LYS A;  4ALH A;  3O34 A;  4MEQ A;  5EI4 A;  5KTW A;  5LVR A;  5FH7 A;  5H85 A;  5HEL A;  2F6N A;  4PCI A;  5DY7 A;  4Z1S A;  3D1D A;  5CUB A;  4LR6 A;  4QYL A;  4HXO A;  5I29 A;  4WIV A;  4QBM A;  4NRA A;  5E3D A;  5COI A;  5DKD A;  3LXJ A;  5II2 A;  3UVY A;  5EGU A;  5FG4 A;  3Q2E A;  1JSP B;  4J1P A;  4MR3 A;  5D3N A;  3UV4 A;  5E9Y A;  4AKH A;  4LC2 A;  4QSU A;  5D25 A;  2RS9 B;  4NR4 A;  3DAI A;  5F3A A;  1ZKR A;  5ENE A;  4CUS A;  5F61 A;  3NXB A;  5A82 A; 
#chains in the Genus database with same CATH homology
 4LZR A;  2YEL A;  5CQ4 A;  3G0J A;  5FE6 A;  5EVA A;  5E3G A;  2YEM A;  5C89 A;  2DVQ A;  4QUT A;  5FB1 A;  5HFR A;  5HRX A;  5CQ6 A;  4O71 A;  4YAX A;  5L8T A;  5EM3 A;  3IU5 A;  4MEN A;  5J0D A;  3P1D A;  5CGP A;  3LQJ A;  4QR4 A;  3GG3 A;  5A5R A;  4QSQ A;  5BT3 A;  5K29 A;  5A5P A;  2E7N A;  4NR7 A;  5JWM A;  4GPJ A;  4YAB A;  4NS5 A;  2DAT A;  4QEV A;  4LZ2 A;  5CUC A;  4XUA A;  3S92 A;  5CY9 A;  4A9K A;  4Z1Q A;  5LJ0 A;  4E96 A;  2E3K A;  4PCE A;  4OUF A;  3FKM X;  5ENJ A;  5FE1 A;  4QSR A;  5LJ1 A;  4NRC A;  4MR4 A;  2FSA A;  2GRC A;  3G0L A;  3S91 A;  4QR5 A;  5L97 A;  2I8N A;  2D82 A;  4NQM A;  4BJX A;  3I3J A;  4QSS A;  5D3L A;  5F5Z A;  5FG6 A;  4TQN A;  5IID A;  5LJ2 A;  4O7E A;  4A9L A;  2DWW A;  4J0R A;  5BT5 A;  2D9E A;  2RFJ A;  4QC3 A;  4KV4 A;  4HXP A;  5G4R A;  5EWW A;  5A5S A;  4YYD A;  4NXJ A;  5EQ1 A;  5A5Q A;  4O74 A;  4HBX A;  5LKX A;  5CUE A;  5D24 A;  4BW3 A;  5ENG A;  4O70 A;  5A83 A;  5CTL A;  4TZ8 A;  5D0C A;  5HJC A;  2DVR A;  4TT4 A;  5DFB A;  5H1U A;  5HEM A;  4C66 A;  4UYD A;  5TB6 A;  5EWD A;  5CQT A;  5A5O A;  2OUO A;  4PS5 A;  4HBW A;  5KU3 A;  5DFD A;  3ZYU A;  4CUP A;  5IGM A;  4NUD A;  4PTB A;  5HQ5 A;  4TTE A;  5CUD A;  5AD3 A;  2R0V A;  5A81 A;  1JM4 B;  4O78 A;  4QNS A;  2RNW A;  4QYD A;  5FE8 A;  3U5K A;  4TT6 A;  5DYX A;  5CFW A;  3TLP A;  4NR9 A;  2YEK A;  5DBM A;  5D3R A;  4YK0 A;  4YH4 A;  4LYI A;  3LJW A;  5F1H A;  5FE4 A;  5E7D A;  5I86 A;  3SVH A;  4LYW A;  4UIX A;  5CRM A;  2KTB B;  5HFQ A;  5F63 A;  5DLX A;  3JVL A;  5FB0 A;  5LKZ A;  3SVF A;  3UW9 A;  5CQ8 A;  5TCM A;  4UYE A;  4QEU A;  3LQH A;  4IR4 A;  4CL9 A;  3O35 A;  3P1C A;  4TT2 A;  4TU6 A;  4TZ2 A;  1WUM A;  4ZW1 A;  1X0J A;  5HCL A;  3Q2F A;  5DFC A;  4HBV A;  3QZS A;  3IU6 A;  4UIT A;  4QUU A;  5F62 A;  5HRW A;  4HXN A;  4J0S A;  5F2P A;  4O7A A;  4O77 A;  5ETB A;  3K2J A;  5DW2 A;  4A9E A;  2DVV A;  1E6I A;  4NR6 A;  5AME A;  4C67 A;  3U5P A;  5FFV A;  4KCX A;  3UVX A;  5AD2 A;  2DKW A;  4YC9 A;  4MR6 A;  4N4H A;  4HXL A;  5I40 A;  5E0R A;  5ENB A;  4TS8 A;  5D26 A;  5IBN A;  3ONI A;  4YBT A;  4BW1 A;  1N72 A;  5L8U A;  5CU8 A;  4HXS A;  4UYH A;  5FE5 A;  5ACY A;  5FH6 A;  5H1T A;  5D3P A;  4NYV A;  5LUU A;  5HQ7 A;  4N3W A;  4DON A;  3U5M A;  4QB3 A;  1WUG A;  5L99 A;  4NYW A;  4Z93 A;  4UYF A;  5BT4 A;  3O33 A;  3QZV A;  4UYF B;  4ZC9 A;  5A5N A;  5DYC A;  5F60 A;  4HXM A;  4WHU A;  5EPB A;  2LSP B;  2OSS A;  4CUU A;  5ENF A;  5A85 A;  4YYK A;  5CPE A;  4O7C A;  4IR6 A;  5EA1 A;  4AKN A;  5II1 A;  4NUE A;  5EIC A;  4N4G A;  5EP7 A;  5I89 A;  4YAD A;  4YYN A;  4LDF A;  4XY8 A;  3U5J A;  5DKC A;  4O7F A;  3MQM A;  2YQD A;  2N9G A;  2RO1 A;  5IG6 A;  5CUG A;  4NYX A;  2L84 A;  4HXR A;  5FFW A;  5C4Q A;  5I7Y A;  4KV1 A;  3MUK A;  4IOR A;  3U5N A;  5CQA A;  5D3T A;  3HME A;  5H1V A;  4QSP A;  4Z6H A;  4F3I A;  4A9N A;  5ENI A;  5C87 A;  5HM0 A;  4O72 A;  4TYL A;  2G4A A;  5CQ7 A;  2WP2 A;  3AAD A;  4NQN A;  5FFY A;  4YYM A;  3P1F A;  5DW1 A;  4CUT A;  3QZT A;  5EU1 A;  4NR8 A;  4HBY A;  4YBM A;  5E74 A;  5FH8 A;  4YBS A;  5DYU A;  3MXF A;  4XY9 A;  4QSX A;  5IGN A;  5CQ5 A;  4YYI A;  4YAT A;  4PKL A;  5HEN A;  5EPR A;  4BW2 A;  4A9F A;  5CS8 A;  5IGL A;  2YW5 A;  4PY6 A;  5ETD A;  5CP5 A;  2YYN A;  4A9M A;  5I7X A;  5E9K A;  3UV2 A;  4CLB A;  5L98 A;  4ZQL A;  5FE0 A;  2I7K A;  3D7C A;  4O75 A;  4UIW A;  4IR3 A;  5D3H A;  2MJV B;  4QSW A;  5CRZ A;  4A9H A;  5FBX A;  4YYH A;  4RVR A;  5I80 A;  5DLZ A;  1F68 A;  4CFK A;  4N4I A;  4YYG A;  5ENH A;  5CZG A;  3O37 A;  2F6J A;  2E7O A;  3JVM A;  5E9L A;  4XYA A;  4ALG A;  5EPS A;  4YYJ A;  3DWY A;  4NRB A;  3P5O A;  3SVG A;  5I1Q A;  4UIY A;  1ZS5 A;  5KTX A;  5D7X A;  2H60 A;  4QEW A;  4N4F A;  5A7C A;  5HLS A;  4IOO A;  4QR3 A;  3P1E A;  5DX4 A;  5LKT A;  4LZS A;  5KO4 A;  4QZS A;  5ENC A;  4LRG A;  4OGI A;  5KHM A;  2RNY A;  2RI7 A;  5FDZ A;  4CUR A;  5FE3 A;  4MEO A;  2RNX A;  4O76 A;  5CUA A;  5LKU A;  4Y03 A;  5EK9 A;  3UVW A;  3MB4 A;  4IOQ A;  4UIU A;  4A9J A;  4X2I A;  2R0S A;  5KTU A;  5L96 A;  4NR5 A;  4HXK A;  5DKH A;  4YY4 A;  4UIZ A;  4CFL A;  4CUQ A;  5F1L A;  5EWC A;  3UV5 A;  2R10 A;  2L85 A;  3HMF A;  5D3J A;  4J3I A;  2R0Y A;  2DVS A;  5D3S A;  5DYA A;  1EQF A;  3MB3 A;  2L5E A;  5HQ6 A;  4UYG A;  4WHW A;  2OO1 A;  3U5L A;  5E9I A;  4MR5 A;  4QY4 A;  5E73 A;  3UVD A;  4TU4 A;  4Q0O A;  5IGK A;  4NUC A;  5C85 A;  3JVK A;  4OGJ A;  4IR5 A;  4XUB A;  5F25 A;  2NXB A;  3AQA A;  5LVQ A;  5CQ3 A;  5FG5 A;  3O36 A;  5FE9 A;  5G4S A;  5EWH A;  5FE7 A;  5I88 A;  2WP1 A;  4A9I A;  3RCW A;  4Z6I A;  5C7N A;  5F36 A;  5JI8 A;  4QSV A;  4MEP A;  4UIV A;  4O7B A;  5EV9 A;  5I83 A;  4Q0N A;  3LQI A;  5AMF A;  4QST A;  3MUL A;  4FLP A;  5FE2 A;  3JVJ A;  4YY6 A;  3HMH A;  4BHW A;  4BW4 A;  5E9M A;  5EWV A;  4A9O A;  5EIS A;  5HRV A;  4QC1 A;  4YH3 A;  3U5O A;  5C8G A;  2YDW A;  5E9V A;  4LYS A;  4ALH A;  3O34 A;  4MEQ A;  5EI4 A;  5KTW A;  5LVR A;  5FH7 A;  5H85 A;  5HEL A;  2F6N A;  4PCI A;  5DY7 A;  4Z1S A;  5CUB A;  4LR6 A;  4QYL A;  4HXO A;  5I29 A;  4WIV A;  4QBM A;  4NRA A;  5E3D A;  5COI A;  5DKD A;  3LXJ A;  5II2 A;  3UVY A;  5EGU A;  5FG4 A;  3Q2E A;  1JSP B;  4J1P A;  4MR3 A;  5D3N A;  3UV4 A;  5E9Y A;  4LC2 A;  4QSU A;  5D25 A;  2RS9 B;  4NR4 A;  3DAI A;  5F3A A;  5ENE A;  4CUS A;  5F61 A;  3NXB A;  5A82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...