5A5QA

Crystal structure of human atad2 bromodomain in complex with 3-methyl- 8-piperidin-4-ylamino-1,2-dihydro-1,7-naphthyridin-2-one hydrochloride
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 2
publication title Fragment-Based Discovery of Low-Micromolar Atad2 Bromodomain Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5a5qA00
2RS9B 4QR4A 5CUDA 5CPEA 5EWWA 1JM4B 2LSPB 4TZ2A 2RI7A 4O70A 4MEQA 4UIWA 5EPSA 4HXSA 5HLSA 5CQAA 5D25A 5L8TA 4QSPA 3QZTA 4NQNA 4QEVA 4HXPA 5D7XA 4PCIA 4NQMA 4NR4A 5D3HA 4TU6A 5CQ5A 5DKCA 4CUQA 4NXJA 5II1A 5LUUA 3U5PA 1JSPB 4HXOA 5KO4A 4MEPA 3Q2FA 2MJVB 4NR8A 4IOQA 5EU1A 3P1CA 4YYJA 5CQ3A 4YATA 2RNWA 4E96A 5A83A 5IIDA 3O34A 5CUGA 2WP1A 4LZ2A 5F3AA 4Y03A 4LYIA 5ETBA 3UVXA 5F1HA 5FG6A 4HXLA 5ENIA 5BT5A 4C66A 5A82A 5EISA 5D3SA 3LJWA 4YK0A 4A9OA 3AADA 3IU6A 4CUTA 5D0CA 5CQTA 5I88A 5F36A 5FE7A 5ENCA 4LR6A 4J1PA 4QYDA 2OSSA 5ENJA 3UVYA 5HQ5A 3LQJA 4HBYA 5E3DA 4QSTA 3SVFA 2E3KA 3MB4A 4ZQLA 3P5OA 4UYGA 5IG6A 5HFQA 5FBXA 4Z1SA 4PCEA 5I7YA 2R0SA 3LXJA 3G0LA 5L96A 4TT4A 4A9FA 3U5OA 3UV4A 4MR6A 1WUGA 4YH3A 4YYKA 5LVRA 5EWVA 4IR4A 4HXKA 5DBMA 4NRCA 4FLPA 4KCXA 2L85A 1WUMA 4QUUA 3IU5A 4XY9A 4NR7A 5I1QA 4WIVA 2H60A 5F60A 5HEMA 4NYXA 5TCMA 5F63A 5HENA 5KTUA 5LKUA 5FFVA 5A81A 3U5KA 5LKZA 4UYFB 4F3IA 3P1EA 4NUCA 3U5NA 3NXBA 5CU8A 4UYFA 3QZSA 5EK9A 5F2PA 4O7FA 3HMFA 4N4FA 5EGUA 4ZC9A 5FG5A 5CRZA 3RCWA 2RNYA 5ENHA 3JVMA 4QUTA 4A9HA 5F62A 5IGMA 5DYAA 5CUEA 4TT6A 5FG4A 5FDZA 4NR6A 5EA1A 4IOOA 4BW2A 3UVWA 4GPJA 5E9YA 5DW2A 4N4HA 5LKXA 4TZ8A 4ALHA 2RO1A 5D3RA 4LDFA 5E9LA 2G4AA 4LRGA 5EPBA 4YYIA 5E74A 4OUFA 3JVJA 4CL9A 4RVRA 3P1FA 4O7EA 5HRVA 5EVAA 2YW5A 2R0VA 5HCLA 3JVKA 5F1LA 4J0RA 4XUAA 5H1VA 5FE0A 4CURA 5HM0A 2YEMA 4LC2A 4A9EA 5CRMA 1ZS5A 3SVGA 4YYHA 5HQ7A 2WP2A 5EPRA 4Z6HA 4PY6A 4A9MA 4QSXA 4QY4A 4OGJA 5FE4A 4LYWA 4Z1QA 4A9KA 4QSSA 3P1DA 4WHWA 5CQ8A 5KTWA 4LZSA 3DWYA 4YABA 3FKMX 4QSQA 2RNXA 5D26A 4QSRA 5I40A 5D3JA 4UIYA 3MUKA 5ACYA 5C8GA 3D7CA 4CUSA 2I7KA 1EQFA 3LQIA 4MEOA 4YAXA 2FSAA 5ENBA 5D3NA 3UW9A 5G4RA 2GRCA 4YH4A 5D3TA 2E7OA 4YYGA 2DWWA 5DYCA 5DW1A 4UYHA 4Q0OA 4NRAA 3I3JA 5I89A 5A5OA 5HFRA 5E9MA 5ENEA 4O7CA 4J3IA 5KTXA 5KHMA 5FE9A 4IORA 4Z6IA 4DONA 2DVQA 4QB3A 4BW1A 5E0RA 5CUAA 4CFLA 5A5SA 4BHWA 4XY8A 5CUBA 4QR3A 5FB1A 4HBXA 3O35A 4KV4A 4QYLA 2YELA 3TLPA 4XYAA 5D3PA 5BT3A 5TB6A 4UIZA 4TS8A 5CQ7A 4TQNA 4WHUA 5F5ZA 4YY4A 5FB0A 4A9NA 5HELA 2F6NA 5DYUA 2R10A 4O77A 5C87A 5HRWA 5DLXA 5A5NA 5D3LA 5CP5A 4O75A 5FE6A 3MQMA 5CTLA 5FE3A 4NS5A 4CUPA 4QSUA 4YBMA 4QSWA 5E73A 2NXBA 2OO1A 3O37A 5HQ6A 4QC3A 4HXMA 5DX4A 4A9JA 4UITA 5C89A 4NYWA 2DVRA 5C85A 4O7BA 3GG3A 5CY9A 2D82A 5A5RA 4YC9A 4NRBA 5CS8A 2YYNA 4QC1A 3UV2A 5E9IA 4N4IA 4YYNA 1X0JA 4QSVA 4QR5A 5FH6A 5JI8A 4UIVA 5G4SA 5H1UA 3DAIA 4HXRA 5COIA 4AKNA 4YBTA 2OUOA 5A5QA 4NUEA 4MR4A 5DYXA 5IGKA 5F25A 3S92A 5LJ1A 5IBNA 5CQ4A 3ZYUA 3AQAA 4KV1A 5DFBA 4NR5A 4YYDA 5EWCA 5AD2A 3JVLA 4UYDA 4ALGA 2R0YA 2E7NA 5FFYA 5AMEA 5HJCA 1F68A 3MULA 5L97A 5CZGA 4CFKA 5LJ2A 5J0DA 5I7XA 5II2A 5I80A 4A9LA 4LYSA 5I29A 4BJXA 4J0SA 5A5PA 3MXFA 4MENA 5JWMA 5LKTA 5EI4A 5L99A 5DFCA 4C67A 5DY7A 5CGPA 4O76A 5FH7A 4TYLA 5H85A 5LJ0A 4BW4A 5C4QA 4BW3A 4UIUA 4MR5A 5EWDA 5ETDA 4O71A 5F61A 2DVVA 4PTBA 3UVDA 1E6IA 4HBVA 5HRXA 5EV9A 4TU4A 5BT4A 3U5JA 2DVSA 4UIXA 5EQ1A 3O33A 5EM3A 4YY6A 2KTBB 4X2IA 2DATA 4YYMA 4UYEA 4QNSA 4O78A 3S91A 4MR3A 5L8UA 5AMFA 3SVHA 2RFJA 4IR6A 5CUCA 4Q0NA 4PKLA 4NUDA 4NYVA 4LZRA 3HMEA 5DKHA 5IGLA 5FE1A 4A9IA 2I8NA 3U5MA 5EP7A 5KU3A 2DKWA 4CLBA 4QBMA 5CQ6A 5CFWA 1N72A 3G0JA 5FFWA 3UV5A 4IR3A 4N3WA 5H1TA 4O7AA 3O36A 4QEWA 4TTEA 2L5EA 4CUUA 5AD3A 5EICA 5E9KA 5EWHA 2YDWA 5DLZA 5FE2A 5FE8A 3ONIA 3LQHA 3QZVA 5FH8A 5K29A 4HBWA 5C7NA 5E3GA 4ZW1A 2YEKA 4Z93A 4XUBA 2L84A 4N4GA 3U5LA 3MB3A 5E7DA 4OGIA 4O72A 5I83A 4QEUA 3Q2EA 5FE5A 4TT2A 5L98A 5ENFA 5A85A 3K2JA 5DKDA 5I86A 5DFDA 4PS5A 4QZSA 2D9EA 2N9GA 3HMHA 5D24A 5A7CA 4IR5A 5E9VA 4O74A 5ENGA 4YBSA 2F6JA 4NR9A 5IGNA 4YADA 2YQDA 5LVQA 4HXNA
chains in the Genus database with same CATH superfamily
2RS9B 4QR4A 5CUDA 5CPEA 5EWWA 1JM4B 2LSPB 4TZ2A 2RI7A 4O70A 4MEQA 4UIWA 5EPSA 4HXSA 5HLSA 5CQAA 5D25A 5L8TA 4QSPA 3QZTA 4NQNA 4QEVA 4HXPA 5D7XA 4PCIA 4NQMA 4NR4A 5D3HA 4TU6A 5CQ5A 5DKCA 4CUQA 4NXJA 4AI6A 5II1A 5LUUA 3U5PA 1JSPB 4HXOA 5KO4A 4MEPA 3Q2FA 2MJVB 4NR8A 4IOQA 5EU1A 3P1CA 4YYJA 5CQ3A 4YATA 2RNWA 4E96A 5A83A 5IIDA 3O34A 5CUGA 2WP1A 4LZ2A 5F3AA 4Y03A 4LYIA 5ETBA 3UVXA 5F1HA 5FG6A 4HXLA 5ENIA 5BT5A 4C66A 5A82A 5EISA 5D3SA 3LJWA 4YK0A 4A9OA 3AADA 3IU6A 4CUTA 5D0CA 5CQTA 5I88A 5F36A 5FE7A 5ENCA 4LR6A 4J1PA 4QYDA 2OSSA 5ENJA 3UVYA 5HQ5A 3LQJA 4HBYA 3VKGA 5E3DA 4QSTA 3SVFA 2E3KA 3MB4A 4ZQLA 3P5OA 4UYGA 5IG6A 5HFQA 5FBXA 4Z1SA 4PCEA 5I7YA 2R0SA 3LXJA 3G0LA 5L96A 4TT4A 4A9FA 3U5OA 3UV4A 4MR6A 1WUGA 4YH3A 4YYKA 5LVRA 5EWVA 4IR4A 4HXKA 5DBMA 4NRCA 4FLPA 4KCXA 2L85A 1WUMA 4QUUA 3IU5A 4XY9A 4NR7A 5I1QA 4WIVA 2H60A 5F60A 5HEMA 1PUOA 4NYXA 5TCMA 5F63A 5HENA 5KTUA 5LKUA 5FFVA 5A81A 3U5KA 5LKZA 3D1BA 4UYFB 4F3IA 3P1EA 4NUCA 3U5NA 3NXBA 5CU8A 4UYFA 3QZSA 5EK9A 5F2PA 4O7FA 3HMFA 4N4FA 5EGUA 4ZC9A 5FG5A 5CRZA 3RCWA 3D1DA 2RNYA 5ENHA 3JVMA 4QUTA 4A9HA 5F62A 5IGMA 5DYAA 5CUEA 4TT6A 5FG4A 5FDZA 1ZKRA 4NR6A 5EA1A 4IOOA 4BW2A 3UVWA 4GPJA 5E9YA 5DW2A 4N4HA 5LKXA 4TZ8A 4ALHA 2RO1A 5D3RA 4LDFA 5E9LA 2G4AA 4LRGA 5EPBA 4YYIA 5E74A 4OUFA 3JVJA 4CL9A 4RVRA 3P1FA 4O7EA 5HRVA 5EVAA 2YW5A 2R0VA 5HCLA 3JVKA 5F1LA 4J0RA 4XUAA 5H1VA 5FE0A 4CURA 5HM0A 2YEMA 4LC2A 4A9EA 5CRMA 1ZS5A 3SVGA 4YYHA 5HQ7A 2WP2A 5EPRA 4Z6HA 4PY6A 4A9MA 4QSXA 3VKHA 4QY4A 4OGJA 5FE4A 4AKIA 4LYWA 4Z1QA 4A9KA 4QSSA 3P1DA 4WHWA 5CQ8A 5KTWA 4LZSA 3DWYA 4YABA 3FKMX 4QSQA 2RNXA 5D26A 4QSRA 5I40A 5D3JA 4UIYA 3MUKA 5ACYA 5C8GA 3D7CA 4CUSA 2I7KA 1EQFA 3LQIA 4MEOA 4YAXA 2FSAA 5ENBA 5D3NA 3UW9A 5G4RA 2GRCA 4YH4A 5D3TA 2E7OA 4YYGA 2DWWA 5DYCA 5DW1A 4UYHA 4Q0OA 4NRAA 3I3JA 5I89A 5A5OA 5HFRA 5E9MA 5ENEA 4O7CA 4J3IA 5KTXA 5KHMA 5FE9A 4IORA 4Z6IA 4DONA 2DVQA 4QB3A 4BW1A 5E0RA 5CUAA 4CFLA 5A5SA 4BHWA 4XY8A 5CUBA 4QR3A 5FB1A 4HBXA 3O35A 4KV4A 4QYLA 2YELA 3TLPA 4XYAA 5D3PA 5BT3A 5TB6A 4UIZA 4TS8A 5CQ7A 4TQNA 4WHUA 5F5ZA 4YY4A 5FB0A 4A9NA 5HELA 2F6NA 5DYUA 2R10A 4O77A 5C87A 5HRWA 5DLXA 5A5NA 5D3LA 5CP5A 4O75A 5FE6A 3MQMA 5CTLA 5FE3A 4NS5A 4CUPA 4QSUA 4YBMA 4QSWA 5E73A 2NXBA 2OO1A 3O37A 5HQ6A 4QC3A 4HXMA 5DX4A 4A9JA 4UITA 5C89A 4NYWA 2EJNA 2DVRA 5C85A 4O7BA 3GG3A 5CY9A 2D82A 5A5RA 4YC9A 4NRBA 5CS8A 2YYNA 4QC1A 3UV2A 5E9IA 4N4IA 4YYNA 1X0JA 4QSVA 4QR5A 5FH6A 5JI8A 4UIVA 5G4SA 5H1UA 3DAIA 4HXRA 5COIA 4AKNA 4YBTA 2OUOA 5A5QA 4NUEA 4MR4A 5DYXA 5IGKA 5F25A 3S92A 5LJ1A 5IBNA 5CQ4A 3ZYUA 3AQAA 3ERRA 4KV1A 5DFBA 4NR5A 4YYDA 5EWCA 5AD2A 3JVLA 4UYDA 4ALGA 2R0YA 2E7NA 5FFYA 5AMEA 5HJCA 1F68A 3MULA 5L97A 5CZGA 4CFKA 5LJ2A 5J0DA 5I7XA 5II2A 5I80A 4A9LA 4LYSA 5I29A 4BJXA 4J0SA 5A5PA 3MXFA 4MENA 5JWMA 5LKTA 5EI4A 5L99A 5DFCA 4C67A 5DY7A 5CGPA 4O76A 5FH7A 4TYLA 5H85A 5LJ0A 4BW4A 5C4QA 4BW3A 4UIUA 4MR5A 5EWDA 5ETDA 4O71A 5F61A 2DVVA 4PTBA 3UVDA 1E6IA 4HBVA 5HRXA 5EV9A 4TU4A 5BT4A 3U5JA 2DVSA 4UIXA 5EQ1A 3O33A 5EM3A 4YY6A 2KTBB 4X2IA 2DATA 4YYMA 4UYEA 4QNSA 4O78A 3S91A 4MR3A 5L8UA 5AMFA 3SVHA 2RFJA 4IR6A 5CUCA 4Q0NA 4PKLA 4NUDA 4NYVA 4LZRA 3HMEA 5DKHA 5IGLA 5FE1A 4A9IA 2I8NA 3U5MA 5EP7A 5KU3A 2DKWA 4CLBA 4QBMA 5CQ6A 5CFWA 1N72A 3G0JA 5FFWA 3UV5A 4IR3A 4N3WA 5H1TA 4O7AA 3O36A 4QEWA 4TTEA 2L5EA 4CUUA 5AD3A 5EICA 5E9KA 5EWHA 2YDWA 5DLZA 5FE2A 5FE8A 3ONIA 3LQHA 3QZVA 5FH8A 5K29A 4AKHA 4HBWA 5C7NA 5E3GA 4ZW1A 2YEKA 4Z93A 4AKGA 4XUBA 2L84A 4N4GA 3U5LA 3MB3A 5E7DA 4OGIA 4O72A 5I83A 4QEUA 3Q2EA 5FE5A 4TT2A 5L98A 5ENFA 5A85A 3K2JA 5DKDA 5I86A 5DFDA 4PS5A 4QZSA 2D9EA 2N9GA 3HMHA 5D24A 5A7CA 4IR5A 5E9VA 4O74A 5ENGA 4YBSA 2F6JA 4NR9A 5IGNA 4YADA 2YQDA 5LVQA 4HXNA
chains in the Genus database with same CATH topology
2RS9B 4QR4A 5CUDA 5CPEA 5EWWA 1JM4B 2LSPB 4TZ2A 2RI7A 4O70A 4MEQA 4UIWA 5EPSA 4HXSA 5HLSA 5CQAA 5D25A 5L8TA 4QSPA 3QZTA 4NQNA 4QEVA 4HXPA 5D7XA 4PCIA 4NQMA 4NR4A 5D3HA 4TU6A 5CQ5A 5DKCA 4CUQA 4NXJA 5II1A 5LUUA 3U5PA 1JSPB 4HXOA 5KO4A 4MEPA 3Q2FA 2MJVB 4NR8A 4IOQA 5EU1A 3P1CA 4YYJA 5CQ3A 4YATA 2RNWA 4E96A 5A83A 5IIDA 3O34A 5CUGA 2WP1A 4LZ2A 5F3AA 4Y03A 4LYIA 5ETBA 3UVXA 5F1HA 5FG6A 4HXLA 5ENIA 5BT5A 4C66A 5A82A 5EISA 5D3SA 3LJWA 4YK0A 4A9OA 3AADA 3IU6A 4CUTA 5D0CA 5CQTA 5I88A 5F36A 5FE7A 5ENCA 4LR6A 4J1PA 4QYDA 2OSSA 5ENJA 3UVYA 5HQ5A 3LQJA 4HBYA 5E3DA 4QSTA 3SVFA 2E3KA 3MB4A 4ZQLA 3P5OA 4UYGA 5IG6A 5HFQA 5FBXA 4Z1SA 4PCEA 5I7YA 2R0SA 3LXJA 3G0LA 5L96A 4TT4A 4A9FA 3U5OA 3UV4A 4MR6A 1WUGA 4YH3A 4YYKA 5LVRA 5EWVA 4IR4A 4HXKA 5DBMA 4NRCA 4FLPA 4KCXA 2L85A 1WUMA 4QUUA 3IU5A 4XY9A 4NR7A 5I1QA 4WIVA 2H60A 5F60A 5HEMA 4NYXA 5TCMA 5F63A 5HENA 5KTUA 5LKUA 5FFVA 5A81A 3U5KA 5LKZA 4UYFB 4F3IA 3P1EA 4NUCA 3U5NA 3NXBA 5CU8A 4UYFA 3QZSA 5EK9A 5F2PA 4O7FA 3HMFA 4N4FA 5EGUA 4ZC9A 5FG5A 5CRZA 3RCWA 2RNYA 5ENHA 3JVMA 4QUTA 4A9HA 5F62A 5IGMA 5DYAA 5CUEA 4TT6A 5FG4A 5FDZA 4NR6A 5EA1A 4IOOA 4BW2A 3UVWA 4GPJA 5E9YA 5DW2A 4N4HA 5LKXA 4TZ8A 4ALHA 2RO1A 5D3RA 4LDFA 5E9LA 2G4AA 4LRGA 5EPBA 4YYIA 5E74A 4OUFA 3JVJA 4CL9A 4RVRA 3P1FA 4O7EA 5HRVA 5EVAA 2YW5A 2R0VA 5HCLA 3JVKA 5F1LA 4J0RA 4XUAA 5H1VA 5FE0A 4CURA 5HM0A 2YEMA 4LC2A 4A9EA 5CRMA 1ZS5A 3SVGA 4YYHA 5HQ7A 2WP2A 5EPRA 4Z6HA 4PY6A 4A9MA 4QSXA 4QY4A 4OGJA 5FE4A 4LYWA 4Z1QA 4A9KA 4QSSA 3P1DA 4WHWA 5CQ8A 5KTWA 4LZSA 3DWYA 4YABA 3FKMX 4QSQA 2RNXA 5D26A 4QSRA 5I40A 5D3JA 4UIYA 3MUKA 5ACYA 5C8GA 3D7CA 4CUSA 2I7KA 1EQFA 3LQIA 4MEOA 4YAXA 2FSAA 5ENBA 5D3NA 3UW9A 5G4RA 2GRCA 4YH4A 5D3TA 2E7OA 4YYGA 2DWWA 5DYCA 5DW1A 4UYHA 4Q0OA 4NRAA 3I3JA 5I89A 5A5OA 5HFRA 5E9MA 5ENEA 4O7CA 4J3IA 5KTXA 5KHMA 5FE9A 4IORA 4Z6IA 4DONA 2DVQA 4QB3A 4BW1A 5E0RA 5CUAA 4CFLA 5A5SA 4BHWA 4XY8A 5CUBA 4QR3A 5FB1A 4HBXA 3O35A 4KV4A 4QYLA 2YELA 3TLPA 4XYAA 5D3PA 5BT3A 5TB6A 4UIZA 4TS8A 5CQ7A 4TQNA 4WHUA 5F5ZA 4YY4A 5FB0A 4A9NA 5HELA 2F6NA 5DYUA 2R10A 4O77A 5C87A 5HRWA 5DLXA 5A5NA 5D3LA 5CP5A 4O75A 5FE6A 3MQMA 5CTLA 5FE3A 4NS5A 4CUPA 4QSUA 4YBMA 4QSWA 5E73A 2NXBA 2OO1A 3O37A 5HQ6A 4QC3A 4HXMA 5DX4A 4A9JA 4UITA 5C89A 4NYWA 2DVRA 5C85A 4O7BA 3GG3A 5CY9A 2D82A 5A5RA 4YC9A 4NRBA 5CS8A 2YYNA 4QC1A 3UV2A 5E9IA 4N4IA 4YYNA 1X0JA 4QSVA 4QR5A 5FH6A 5JI8A 4UIVA 5G4SA 5H1UA 3DAIA 4HXRA 5COIA 4AKNA 4YBTA 2OUOA 5A5QA 4NUEA 4MR4A 5DYXA 5IGKA 5F25A 3S92A 5LJ1A 5IBNA 5CQ4A 3ZYUA 3AQAA 4KV1A 5DFBA 4NR5A 4YYDA 5EWCA 5AD2A 3JVLA 4UYDA 4ALGA 2R0YA 2E7NA 5FFYA 5AMEA 5HJCA 1F68A 3MULA 5L97A 5CZGA 4CFKA 5LJ2A 5J0DA 5I7XA 5II2A 5I80A 4A9LA 4LYSA 5I29A 4BJXA 4J0SA 5A5PA 3MXFA 4MENA 5JWMA 5LKTA 5EI4A 5L99A 5DFCA 4C67A 5DY7A 5CGPA 4O76A 5FH7A 4TYLA 5H85A 5LJ0A 4BW4A 5C4QA 4BW3A 4UIUA 4MR5A 5EWDA 5ETDA 4O71A 5F61A 2DVVA 4PTBA 3UVDA 1E6IA 4HBVA 5HRXA 5EV9A 4TU4A 5BT4A 3U5JA 2DVSA 4UIXA 5EQ1A 3O33A 5EM3A 4YY6A 2KTBB 4X2IA 2DATA 4YYMA 4UYEA 4QNSA 4O78A 3S91A 4MR3A 5L8UA 5AMFA 3SVHA 2RFJA 4IR6A 5CUCA 4Q0NA 4PKLA 4NUDA 4NYVA 4LZRA 3HMEA 5DKHA 5IGLA 5FE1A 4A9IA 2I8NA 3U5MA 5EP7A 5KU3A 2DKWA 4CLBA 4QBMA 5CQ6A 5CFWA 1N72A 3G0JA 5FFWA 3UV5A 4IR3A 4N3WA 5H1TA 4O7AA 3O36A 4QEWA 4TTEA 2L5EA 4CUUA 5AD3A 5EICA 5E9KA 5EWHA 2YDWA 5DLZA 5FE2A 5FE8A 3ONIA 3LQHA 3QZVA 5FH8A 5K29A 4HBWA 5C7NA 5E3GA 4ZW1A 2YEKA 4Z93A 4XUBA 2L84A 4N4GA 3U5LA 3MB3A 5E7DA 4OGIA 4O72A 5I83A 4QEUA 3Q2EA 5FE5A 4TT2A 5L98A 5ENFA 5A85A 3K2JA 5DKDA 5I86A 5DFDA 4PS5A 4QZSA 2D9EA 2N9GA 3HMHA 5D24A 5A7CA 4IR5A 5E9VA 4O74A 5ENGA 4YBSA 2F6JA 4NR9A 5IGNA 4YADA 2YQDA 5LVQA 4HXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RS9 B;  4QR4 A;  5CUD A;  5CPE A;  5EWW A;  1JM4 B;  2LSP B;  4TZ2 A;  2RI7 A;  4O70 A;  4MEQ A;  4UIW A;  5EPS A;  4HXS A;  5HLS A;  5CQA A;  5D25 A;  5L8T A;  4QSP A;  3QZT A;  4NQN A;  4QEV A;  4HXP A;  5D7X A;  4PCI A;  4NQM A;  4NR4 A;  5D3H A;  4TU6 A;  5CQ5 A;  5DKC A;  4CUQ A;  4NXJ A;  5II1 A;  5LUU A;  3U5P A;  1JSP B;  4HXO A;  5KO4 A;  4MEP A;  3Q2F A;  2MJV B;  4NR8 A;  4IOQ A;  5EU1 A;  3P1C A;  4YYJ A;  5CQ3 A;  4YAT A;  2RNW A;  4E96 A;  5A83 A;  5IID A;  3O34 A;  5CUG A;  2WP1 A;  4LZ2 A;  5F3A A;  4Y03 A;  4LYI A;  5ETB A;  3UVX A;  5F1H A;  5FG6 A;  4HXL A;  5ENI A;  5BT5 A;  4C66 A;  5A82 A;  5EIS A;  5D3S A;  3LJW A;  4YK0 A;  4A9O A;  3AAD A;  3IU6 A;  4CUT A;  5D0C A;  5CQT A;  5I88 A;  5F36 A;  5FE7 A;  5ENC A;  4LR6 A;  4J1P A;  4QYD A;  2OSS A;  5ENJ A;  3UVY A;  5HQ5 A;  3LQJ A;  4HBY A;  5E3D A;  4QST A;  3SVF A;  2E3K A;  3MB4 A;  4ZQL A;  3P5O A;  4UYG A;  5IG6 A;  5HFQ A;  5FBX A;  4Z1S A;  4PCE A;  5I7Y A;  2R0S A;  3LXJ A;  3G0L A;  5L96 A;  4TT4 A;  4A9F A;  3U5O A;  3UV4 A;  4MR6 A;  1WUG A;  4YH3 A;  4YYK A;  5LVR A;  5EWV A;  4IR4 A;  4HXK A;  5DBM A;  4NRC A;  4FLP A;  4KCX A;  2L85 A;  1WUM A;  4QUU A;  3IU5 A;  4XY9 A;  4NR7 A;  5I1Q A;  4WIV A;  2H60 A;  5F60 A;  5HEM A;  4NYX A;  5TCM A;  5F63 A;  5HEN A;  5KTU A;  5LKU A;  5FFV A;  5A81 A;  3U5K A;  5LKZ A;  4UYF B;  4F3I A;  3P1E A;  4NUC A;  3U5N A;  3NXB A;  5CU8 A;  4UYF A;  3QZS A;  5EK9 A;  5F2P A;  4O7F A;  3HMF A;  4N4F A;  5EGU A;  4ZC9 A;  5FG5 A;  5CRZ A;  3RCW A;  2RNY A;  5ENH A;  3JVM A;  4QUT A;  4A9H A;  5F62 A;  5IGM A;  5DYA A;  5CUE A;  4TT6 A;  5FG4 A;  5FDZ A;  4NR6 A;  5EA1 A;  4IOO A;  4BW2 A;  3UVW A;  4GPJ A;  5E9Y A;  5DW2 A;  4N4H A;  5LKX A;  4TZ8 A;  4ALH A;  2RO1 A;  5D3R A;  4LDF A;  5E9L A;  2G4A A;  4LRG A;  5EPB A;  4YYI A;  5E74 A;  4OUF A;  3JVJ A;  4CL9 A;  4RVR A;  3P1F A;  4O7E A;  5HRV A;  5EVA A;  2YW5 A;  2R0V A;  5HCL A;  3JVK A;  5F1L A;  4J0R A;  4XUA A;  5H1V A;  5FE0 A;  4CUR A;  5HM0 A;  2YEM A;  4LC2 A;  4A9E A;  5CRM A;  1ZS5 A;  3SVG A;  4YYH A;  5HQ7 A;  2WP2 A;  5EPR A;  4Z6H A;  4PY6 A;  4A9M A;  4QSX A;  4QY4 A;  4OGJ A;  5FE4 A;  4LYW A;  4Z1Q A;  4A9K A;  4QSS A;  3P1D A;  4WHW A;  5CQ8 A;  5KTW A;  4LZS A;  3DWY A;  4YAB A;  3FKM X;  4QSQ A;  2RNX A;  5D26 A;  4QSR A;  5I40 A;  5D3J A;  4UIY A;  3MUK A;  5ACY A;  5C8G A;  3D7C A;  4CUS A;  2I7K A;  1EQF A;  3LQI A;  4MEO A;  4YAX A;  2FSA A;  5ENB A;  5D3N A;  3UW9 A;  5G4R A;  2GRC A;  4YH4 A;  5D3T A;  2E7O A;  4YYG A;  2DWW A;  5DYC A;  5DW1 A;  4UYH A;  4Q0O A;  4NRA A;  3I3J A;  5I89 A;  5A5O A;  5HFR A;  5E9M A;  5ENE A;  4O7C A;  4J3I A;  5KTX A;  5KHM A;  5FE9 A;  4IOR A;  4Z6I A;  4DON A;  2DVQ A;  4QB3 A;  4BW1 A;  5E0R A;  5CUA A;  4CFL A;  5A5S A;  4BHW A;  4XY8 A;  5CUB A;  4QR3 A;  5FB1 A;  4HBX A;  3O35 A;  4KV4 A;  4QYL A;  2YEL A;  3TLP A;  4XYA A;  5D3P A;  5BT3 A;  5TB6 A;  4UIZ A;  4TS8 A;  5CQ7 A;  4TQN A;  4WHU A;  5F5Z A;  4YY4 A;  5FB0 A;  4A9N A;  5HEL A;  2F6N A;  5DYU A;  2R10 A;  4O77 A;  5C87 A;  5HRW A;  5DLX A;  5A5N A;  5D3L A;  5CP5 A;  4O75 A;  5FE6 A;  3MQM A;  5CTL A;  5FE3 A;  4NS5 A;  4CUP A;  4QSU A;  4YBM A;  4QSW A;  5E73 A;  2NXB A;  2OO1 A;  3O37 A;  5HQ6 A;  4QC3 A;  4HXM A;  5DX4 A;  4A9J A;  4UIT A;  5C89 A;  4NYW A;  2DVR A;  5C85 A;  4O7B A;  3GG3 A;  5CY9 A;  2D82 A;  5A5R A;  4YC9 A;  4NRB A;  5CS8 A;  2YYN A;  4QC1 A;  3UV2 A;  5E9I A;  4N4I A;  4YYN A;  1X0J A;  4QSV A;  4QR5 A;  5FH6 A;  5JI8 A;  4UIV A;  5G4S A;  5H1U A;  3DAI A;  4HXR A;  5COI A;  4AKN A;  4YBT A;  2OUO A;  5A5Q A;  4NUE A;  4MR4 A;  5DYX A;  5IGK A;  5F25 A;  3S92 A;  5LJ1 A;  5IBN A;  5CQ4 A;  3ZYU A;  3AQA A;  4KV1 A;  5DFB A;  4NR5 A;  4YYD A;  5EWC A;  5AD2 A;  3JVL A;  4UYD A;  4ALG A;  2R0Y A;  2E7N A;  5FFY A;  5AME A;  5HJC A;  1F68 A;  3MUL A;  5L97 A;  5CZG A;  4CFK A;  5LJ2 A;  5J0D A;  5I7X A;  5II2 A;  5I80 A;  4A9L A;  4LYS A;  5I29 A;  4BJX A;  4J0S A;  5A5P A;  3MXF A;  4MEN A;  5JWM A;  5LKT A;  5EI4 A;  5L99 A;  5DFC A;  4C67 A;  5DY7 A;  5CGP A;  4O76 A;  5FH7 A;  4TYL A;  5H85 A;  5LJ0 A;  4BW4 A;  5C4Q A;  4BW3 A;  4UIU A;  4MR5 A;  5EWD A;  5ETD A;  4O71 A;  5F61 A;  2DVV A;  4PTB A;  3UVD A;  1E6I A;  4HBV A;  5HRX A;  5EV9 A;  4TU4 A;  5BT4 A;  3U5J A;  2DVS A;  4UIX A;  5EQ1 A;  3O33 A;  5EM3 A;  4YY6 A;  2KTB B;  4X2I A;  2DAT A;  4YYM A;  4UYE A;  4QNS A;  4O78 A;  3S91 A;  4MR3 A;  5L8U A;  5AMF A;  3SVH A;  2RFJ A;  4IR6 A;  5CUC A;  4Q0N A;  4PKL A;  4NUD A;  4NYV A;  4LZR A;  3HME A;  5DKH A;  5IGL A;  5FE1 A;  4A9I A;  2I8N A;  3U5M A;  5EP7 A;  5KU3 A;  2DKW A;  4CLB A;  4QBM A;  5CQ6 A;  5CFW A;  1N72 A;  3G0J A;  5FFW A;  3UV5 A;  4IR3 A;  4N3W A;  5H1T A;  4O7A A;  3O36 A;  4QEW A;  4TTE A;  2L5E A;  4CUU A;  5AD3 A;  5EIC A;  5E9K A;  5EWH A;  2YDW A;  5DLZ A;  5FE2 A;  5FE8 A;  3ONI A;  3LQH A;  3QZV A;  5FH8 A;  5K29 A;  4HBW A;  5C7N A;  5E3G A;  4ZW1 A;  2YEK A;  4Z93 A;  4XUB A;  2L84 A;  4N4G A;  3U5L A;  3MB3 A;  5E7D A;  4OGI A;  4O72 A;  5I83 A;  4QEU A;  3Q2E A;  5FE5 A;  4TT2 A;  5L98 A;  5ENF A;  5A85 A;  3K2J A;  5DKD A;  5I86 A;  5DFD A;  4PS5 A;  4QZS A;  2D9E A;  2N9G A;  3HMH A;  5D24 A;  5A7C A;  4IR5 A;  5E9V A;  4O74 A;  5ENG A;  4YBS A;  2F6J A;  4NR9 A;  5IGN A;  4YAD A;  2YQD A;  5LVQ A;  4HXN A; 
#chains in the Genus database with same CATH topology
 2RS9 B;  4QR4 A;  5CUD A;  5CPE A;  5EWW A;  1JM4 B;  2LSP B;  4TZ2 A;  2RI7 A;  4O70 A;  4MEQ A;  4UIW A;  5EPS A;  4HXS A;  5HLS A;  5CQA A;  5D25 A;  5L8T A;  4QSP A;  3QZT A;  4NQN A;  4QEV A;  4HXP A;  5D7X A;  4PCI A;  4NQM A;  4NR4 A;  5D3H A;  4TU6 A;  5CQ5 A;  5DKC A;  4CUQ A;  4NXJ A;  4AI6 A;  5II1 A;  5LUU A;  3U5P A;  1JSP B;  4HXO A;  5KO4 A;  4MEP A;  3Q2F A;  2MJV B;  4NR8 A;  4IOQ A;  5EU1 A;  3P1C A;  4YYJ A;  5CQ3 A;  4YAT A;  2RNW A;  4E96 A;  5A83 A;  5IID A;  3O34 A;  5CUG A;  2WP1 A;  4LZ2 A;  5F3A A;  4Y03 A;  4LYI A;  5ETB A;  3UVX A;  5F1H A;  5FG6 A;  4HXL A;  5ENI A;  5BT5 A;  4C66 A;  5A82 A;  5EIS A;  5D3S A;  3LJW A;  4YK0 A;  4A9O A;  3AAD A;  3IU6 A;  4CUT A;  5D0C A;  5CQT A;  5I88 A;  5F36 A;  5FE7 A;  5ENC A;  4LR6 A;  4J1P A;  4QYD A;  2OSS A;  5ENJ A;  3UVY A;  5HQ5 A;  3LQJ A;  4HBY A;  3VKG A;  5E3D A;  4QST A;  3SVF A;  2E3K A;  3MB4 A;  4ZQL A;  3P5O A;  4UYG A;  5IG6 A;  5HFQ A;  5FBX A;  4Z1S A;  4PCE A;  5I7Y A;  2R0S A;  3LXJ A;  3G0L A;  5L96 A;  4TT4 A;  4A9F A;  3U5O A;  3UV4 A;  4MR6 A;  1WUG A;  4YH3 A;  4YYK A;  5LVR A;  5EWV A;  4IR4 A;  4HXK A;  5DBM A;  4NRC A;  4FLP A;  4KCX A;  2L85 A;  1WUM A;  4QUU A;  3IU5 A;  4XY9 A;  4NR7 A;  5I1Q A;  4WIV A;  2H60 A;  5F60 A;  5HEM A;  1PUO A;  4NYX A;  5TCM A;  5F63 A;  5HEN A;  5KTU A;  5LKU A;  5FFV A;  5A81 A;  3U5K A;  5LKZ A;  3D1B A;  4UYF B;  4F3I A;  3P1E A;  4NUC A;  3U5N A;  3NXB A;  5CU8 A;  4UYF A;  3QZS A;  5EK9 A;  5F2P A;  4O7F A;  3HMF A;  4N4F A;  5EGU A;  4ZC9 A;  5FG5 A;  5CRZ A;  3RCW A;  3D1D A;  2RNY A;  5ENH A;  3JVM A;  4QUT A;  4A9H A;  5F62 A;  5IGM A;  5DYA A;  5CUE A;  4TT6 A;  5FG4 A;  5FDZ A;  1ZKR A;  4NR6 A;  5EA1 A;  4IOO A;  4BW2 A;  3UVW A;  4GPJ A;  5E9Y A;  5DW2 A;  4N4H A;  5LKX A;  4TZ8 A;  4ALH A;  2RO1 A;  5D3R A;  4LDF A;  5E9L A;  2G4A A;  4LRG A;  5EPB A;  4YYI A;  5E74 A;  4OUF A;  3JVJ A;  4CL9 A;  4RVR A;  3P1F A;  4O7E A;  5HRV A;  5EVA A;  2YW5 A;  2R0V A;  5HCL A;  3JVK A;  5F1L A;  4J0R A;  4XUA A;  5H1V A;  5FE0 A;  4CUR A;  5HM0 A;  2YEM A;  4LC2 A;  4A9E A;  5CRM A;  1ZS5 A;  3SVG A;  4YYH A;  5HQ7 A;  2WP2 A;  5EPR A;  4Z6H A;  4PY6 A;  4A9M A;  4QSX A;  3VKH A;  4QY4 A;  4OGJ A;  5FE4 A;  4AKI A;  4LYW A;  4Z1Q A;  4A9K A;  4QSS A;  3P1D A;  4WHW A;  5CQ8 A;  5KTW A;  4LZS A;  3DWY A;  4YAB A;  3FKM X;  4QSQ A;  2RNX A;  5D26 A;  4QSR A;  5I40 A;  5D3J A;  4UIY A;  3MUK A;  5ACY A;  5C8G A;  3D7C A;  4CUS A;  2I7K A;  1EQF A;  3LQI A;  4MEO A;  4YAX A;  2FSA A;  5ENB A;  5D3N A;  3UW9 A;  5G4R A;  2GRC A;  4YH4 A;  5D3T A;  2E7O A;  4YYG A;  2DWW A;  5DYC A;  5DW1 A;  4UYH A;  4Q0O A;  4NRA A;  3I3J A;  5I89 A;  5A5O A;  5HFR A;  5E9M A;  5ENE A;  4O7C A;  4J3I A;  5KTX A;  5KHM A;  5FE9 A;  4IOR A;  4Z6I A;  4DON A;  2DVQ A;  4QB3 A;  4BW1 A;  5E0R A;  5CUA A;  4CFL A;  5A5S A;  4BHW A;  4XY8 A;  5CUB A;  4QR3 A;  5FB1 A;  4HBX A;  3O35 A;  4KV4 A;  4QYL A;  2YEL A;  3TLP A;  4XYA A;  5D3P A;  5BT3 A;  5TB6 A;  4UIZ A;  4TS8 A;  5CQ7 A;  4TQN A;  4WHU A;  5F5Z A;  4YY4 A;  5FB0 A;  4A9N A;  5HEL A;  2F6N A;  5DYU A;  2R10 A;  4O77 A;  5C87 A;  5HRW A;  5DLX A;  5A5N A;  5D3L A;  5CP5 A;  4O75 A;  5FE6 A;  3MQM A;  5CTL A;  5FE3 A;  4NS5 A;  4CUP A;  4QSU A;  4YBM A;  4QSW A;  5E73 A;  2NXB A;  2OO1 A;  3O37 A;  5HQ6 A;  4QC3 A;  4HXM A;  5DX4 A;  4A9J A;  4UIT A;  5C89 A;  4NYW A;  2EJN A;  2DVR A;  5C85 A;  4O7B A;  3GG3 A;  5CY9 A;  2D82 A;  5A5R A;  4YC9 A;  4NRB A;  5CS8 A;  2YYN A;  4QC1 A;  3UV2 A;  5E9I A;  4N4I A;  4YYN A;  1X0J A;  4QSV A;  4QR5 A;  5FH6 A;  5JI8 A;  4UIV A;  5G4S A;  5H1U A;  3DAI A;  4HXR A;  5COI A;  4AKN A;  4YBT A;  2OUO A;  5A5Q A;  4NUE A;  4MR4 A;  5DYX A;  5IGK A;  5F25 A;  3S92 A;  5LJ1 A;  5IBN A;  5CQ4 A;  3ZYU A;  3AQA A;  3ERR A;  4KV1 A;  5DFB A;  4NR5 A;  4YYD A;  5EWC A;  5AD2 A;  3JVL A;  4UYD A;  4ALG A;  2R0Y A;  2E7N A;  5FFY A;  5AME A;  5HJC A;  1F68 A;  3MUL A;  5L97 A;  5CZG A;  4CFK A;  5LJ2 A;  5J0D A;  5I7X A;  5II2 A;  5I80 A;  4A9L A;  4LYS A;  5I29 A;  4BJX A;  4J0S A;  5A5P A;  3MXF A;  4MEN A;  5JWM A;  5LKT A;  5EI4 A;  5L99 A;  5DFC A;  4C67 A;  5DY7 A;  5CGP A;  4O76 A;  5FH7 A;  4TYL A;  5H85 A;  5LJ0 A;  4BW4 A;  5C4Q A;  4BW3 A;  4UIU A;  4MR5 A;  5EWD A;  5ETD A;  4O71 A;  5F61 A;  2DVV A;  4PTB A;  3UVD A;  1E6I A;  4HBV A;  5HRX A;  5EV9 A;  4TU4 A;  5BT4 A;  3U5J A;  2DVS A;  4UIX A;  5EQ1 A;  3O33 A;  5EM3 A;  4YY6 A;  2KTB B;  4X2I A;  2DAT A;  4YYM A;  4UYE A;  4QNS A;  4O78 A;  3S91 A;  4MR3 A;  5L8U A;  5AMF A;  3SVH A;  2RFJ A;  4IR6 A;  5CUC A;  4Q0N A;  4PKL A;  4NUD A;  4NYV A;  4LZR A;  3HME A;  5DKH A;  5IGL A;  5FE1 A;  4A9I A;  2I8N A;  3U5M A;  5EP7 A;  5KU3 A;  2DKW A;  4CLB A;  4QBM A;  5CQ6 A;  5CFW A;  1N72 A;  3G0J A;  5FFW A;  3UV5 A;  4IR3 A;  4N3W A;  5H1T A;  4O7A A;  3O36 A;  4QEW A;  4TTE A;  2L5E A;  4CUU A;  5AD3 A;  5EIC A;  5E9K A;  5EWH A;  2YDW A;  5DLZ A;  5FE2 A;  5FE8 A;  3ONI A;  3LQH A;  3QZV A;  5FH8 A;  5K29 A;  4AKH A;  4HBW A;  5C7N A;  5E3G A;  4ZW1 A;  2YEK A;  4Z93 A;  4AKG A;  4XUB A;  2L84 A;  4N4G A;  3U5L A;  3MB3 A;  5E7D A;  4OGI A;  4O72 A;  5I83 A;  4QEU A;  3Q2E A;  5FE5 A;  4TT2 A;  5L98 A;  5ENF A;  5A85 A;  3K2J A;  5DKD A;  5I86 A;  5DFD A;  4PS5 A;  4QZS A;  2D9E A;  2N9G A;  3HMH A;  5D24 A;  5A7C A;  4IR5 A;  5E9V A;  4O74 A;  5ENG A;  4YBS A;  2F6J A;  4NR9 A;  5IGN A;  4YAD A;  2YQD A;  5LVQ A;  4HXN A; 
#chains in the Genus database with same CATH homology
 2RS9 B;  4QR4 A;  5CUD A;  5CPE A;  5EWW A;  1JM4 B;  2LSP B;  4TZ2 A;  2RI7 A;  4O70 A;  4MEQ A;  4UIW A;  5EPS A;  4HXS A;  5HLS A;  5CQA A;  5D25 A;  5L8T A;  4QSP A;  3QZT A;  4NQN A;  4QEV A;  4HXP A;  5D7X A;  4PCI A;  4NQM A;  4NR4 A;  5D3H A;  4TU6 A;  5CQ5 A;  5DKC A;  4CUQ A;  4NXJ A;  5II1 A;  5LUU A;  3U5P A;  1JSP B;  4HXO A;  5KO4 A;  4MEP A;  3Q2F A;  2MJV B;  4NR8 A;  4IOQ A;  5EU1 A;  3P1C A;  4YYJ A;  5CQ3 A;  4YAT A;  2RNW A;  4E96 A;  5A83 A;  5IID A;  3O34 A;  5CUG A;  2WP1 A;  4LZ2 A;  5F3A A;  4Y03 A;  4LYI A;  5ETB A;  3UVX A;  5F1H A;  5FG6 A;  4HXL A;  5ENI A;  5BT5 A;  4C66 A;  5A82 A;  5EIS A;  5D3S A;  3LJW A;  4YK0 A;  4A9O A;  3AAD A;  3IU6 A;  4CUT A;  5D0C A;  5CQT A;  5I88 A;  5F36 A;  5FE7 A;  5ENC A;  4LR6 A;  4J1P A;  4QYD A;  2OSS A;  5ENJ A;  3UVY A;  5HQ5 A;  3LQJ A;  4HBY A;  5E3D A;  4QST A;  3SVF A;  2E3K A;  3MB4 A;  4ZQL A;  3P5O A;  4UYG A;  5IG6 A;  5HFQ A;  5FBX A;  4Z1S A;  4PCE A;  5I7Y A;  2R0S A;  3LXJ A;  3G0L A;  5L96 A;  4TT4 A;  4A9F A;  3U5O A;  3UV4 A;  4MR6 A;  1WUG A;  4YH3 A;  4YYK A;  5LVR A;  5EWV A;  4IR4 A;  4HXK A;  5DBM A;  4NRC A;  4FLP A;  4KCX A;  2L85 A;  1WUM A;  4QUU A;  3IU5 A;  4XY9 A;  4NR7 A;  5I1Q A;  4WIV A;  2H60 A;  5F60 A;  5HEM A;  4NYX A;  5TCM A;  5F63 A;  5HEN A;  5KTU A;  5LKU A;  5FFV A;  5A81 A;  3U5K A;  5LKZ A;  4UYF B;  4F3I A;  3P1E A;  4NUC A;  3U5N A;  3NXB A;  5CU8 A;  4UYF A;  3QZS A;  5EK9 A;  5F2P A;  4O7F A;  3HMF A;  4N4F A;  5EGU A;  4ZC9 A;  5FG5 A;  5CRZ A;  3RCW A;  2RNY A;  5ENH A;  3JVM A;  4QUT A;  4A9H A;  5F62 A;  5IGM A;  5DYA A;  5CUE A;  4TT6 A;  5FG4 A;  5FDZ A;  4NR6 A;  5EA1 A;  4IOO A;  4BW2 A;  3UVW A;  4GPJ A;  5E9Y A;  5DW2 A;  4N4H A;  5LKX A;  4TZ8 A;  4ALH A;  2RO1 A;  5D3R A;  4LDF A;  5E9L A;  2G4A A;  4LRG A;  5EPB A;  4YYI A;  5E74 A;  4OUF A;  3JVJ A;  4CL9 A;  4RVR A;  3P1F A;  4O7E A;  5HRV A;  5EVA A;  2YW5 A;  2R0V A;  5HCL A;  3JVK A;  5F1L A;  4J0R A;  4XUA A;  5H1V A;  5FE0 A;  4CUR A;  5HM0 A;  2YEM A;  4LC2 A;  4A9E A;  5CRM A;  1ZS5 A;  3SVG A;  4YYH A;  5HQ7 A;  2WP2 A;  5EPR A;  4Z6H A;  4PY6 A;  4A9M A;  4QSX A;  4QY4 A;  4OGJ A;  5FE4 A;  4LYW A;  4Z1Q A;  4A9K A;  4QSS A;  3P1D A;  4WHW A;  5CQ8 A;  5KTW A;  4LZS A;  3DWY A;  4YAB A;  3FKM X;  4QSQ A;  2RNX A;  5D26 A;  4QSR A;  5I40 A;  5D3J A;  4UIY A;  3MUK A;  5ACY A;  5C8G A;  3D7C A;  4CUS A;  2I7K A;  1EQF A;  3LQI A;  4MEO A;  4YAX A;  2FSA A;  5ENB A;  5D3N A;  3UW9 A;  5G4R A;  2GRC A;  4YH4 A;  5D3T A;  2E7O A;  4YYG A;  2DWW A;  5DYC A;  5DW1 A;  4UYH A;  4Q0O A;  4NRA A;  3I3J A;  5I89 A;  5A5O A;  5HFR A;  5E9M A;  5ENE A;  4O7C A;  4J3I A;  5KTX A;  5KHM A;  5FE9 A;  4IOR A;  4Z6I A;  4DON A;  2DVQ A;  4QB3 A;  4BW1 A;  5E0R A;  5CUA A;  4CFL A;  5A5S A;  4BHW A;  4XY8 A;  5CUB A;  4QR3 A;  5FB1 A;  4HBX A;  3O35 A;  4KV4 A;  4QYL A;  2YEL A;  3TLP A;  4XYA A;  5D3P A;  5BT3 A;  5TB6 A;  4UIZ A;  4TS8 A;  5CQ7 A;  4TQN A;  4WHU A;  5F5Z A;  4YY4 A;  5FB0 A;  4A9N A;  5HEL A;  2F6N A;  5DYU A;  2R10 A;  4O77 A;  5C87 A;  5HRW A;  5DLX A;  5A5N A;  5D3L A;  5CP5 A;  4O75 A;  5FE6 A;  3MQM A;  5CTL A;  5FE3 A;  4NS5 A;  4CUP A;  4QSU A;  4YBM A;  4QSW A;  5E73 A;  2NXB A;  2OO1 A;  3O37 A;  5HQ6 A;  4QC3 A;  4HXM A;  5DX4 A;  4A9J A;  4UIT A;  5C89 A;  4NYW A;  2DVR A;  5C85 A;  4O7B A;  3GG3 A;  5CY9 A;  2D82 A;  5A5R A;  4YC9 A;  4NRB A;  5CS8 A;  2YYN A;  4QC1 A;  3UV2 A;  5E9I A;  4N4I A;  4YYN A;  1X0J A;  4QSV A;  4QR5 A;  5FH6 A;  5JI8 A;  4UIV A;  5G4S A;  5H1U A;  3DAI A;  4HXR A;  5COI A;  4AKN A;  4YBT A;  2OUO A;  5A5Q A;  4NUE A;  4MR4 A;  5DYX A;  5IGK A;  5F25 A;  3S92 A;  5LJ1 A;  5IBN A;  5CQ4 A;  3ZYU A;  3AQA A;  4KV1 A;  5DFB A;  4NR5 A;  4YYD A;  5EWC A;  5AD2 A;  3JVL A;  4UYD A;  4ALG A;  2R0Y A;  2E7N A;  5FFY A;  5AME A;  5HJC A;  1F68 A;  3MUL A;  5L97 A;  5CZG A;  4CFK A;  5LJ2 A;  5J0D A;  5I7X A;  5II2 A;  5I80 A;  4A9L A;  4LYS A;  5I29 A;  4BJX A;  4J0S A;  5A5P A;  3MXF A;  4MEN A;  5JWM A;  5LKT A;  5EI4 A;  5L99 A;  5DFC A;  4C67 A;  5DY7 A;  5CGP A;  4O76 A;  5FH7 A;  4TYL A;  5H85 A;  5LJ0 A;  4BW4 A;  5C4Q A;  4BW3 A;  4UIU A;  4MR5 A;  5EWD A;  5ETD A;  4O71 A;  5F61 A;  2DVV A;  4PTB A;  3UVD A;  1E6I A;  4HBV A;  5HRX A;  5EV9 A;  4TU4 A;  5BT4 A;  3U5J A;  2DVS A;  4UIX A;  5EQ1 A;  3O33 A;  5EM3 A;  4YY6 A;  2KTB B;  4X2I A;  2DAT A;  4YYM A;  4UYE A;  4QNS A;  4O78 A;  3S91 A;  4MR3 A;  5L8U A;  5AMF A;  3SVH A;  2RFJ A;  4IR6 A;  5CUC A;  4Q0N A;  4PKL A;  4NUD A;  4NYV A;  4LZR A;  3HME A;  5DKH A;  5IGL A;  5FE1 A;  4A9I A;  2I8N A;  3U5M A;  5EP7 A;  5KU3 A;  2DKW A;  4CLB A;  4QBM A;  5CQ6 A;  5CFW A;  1N72 A;  3G0J A;  5FFW A;  3UV5 A;  4IR3 A;  4N3W A;  5H1T A;  4O7A A;  3O36 A;  4QEW A;  4TTE A;  2L5E A;  4CUU A;  5AD3 A;  5EIC A;  5E9K A;  5EWH A;  2YDW A;  5DLZ A;  5FE2 A;  5FE8 A;  3ONI A;  3LQH A;  3QZV A;  5FH8 A;  5K29 A;  4HBW A;  5C7N A;  5E3G A;  4ZW1 A;  2YEK A;  4Z93 A;  4XUB A;  2L84 A;  4N4G A;  3U5L A;  3MB3 A;  5E7D A;  4OGI A;  4O72 A;  5I83 A;  4QEU A;  3Q2E A;  5FE5 A;  4TT2 A;  5L98 A;  5ENF A;  5A85 A;  3K2J A;  5DKD A;  5I86 A;  5DFD A;  4PS5 A;  4QZS A;  2D9E A;  2N9G A;  3HMH A;  5D24 A;  5A7C A;  4IR5 A;  5E9V A;  4O74 A;  5ENG A;  4YBS A;  2F6J A;  4NR9 A;  5IGN A;  4YAD A;  2YQD A;  5LVQ A;  4HXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...