5CRMA

Crystal structure of the first bromodomain of human brd4 in complex with benzo[cd]indol-2(1h)-one ligand
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
133
structure length
133
Chain Sequence
HHHHHLVPRGSNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Discovery of Benzo[cd]indol-2(1H)-ones as Potent and Specific BET Bromodomain Inhibitors: Structure-Based Virtual Screening, Optimization, and Biological Evaluation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 43
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5crmA01
4UYFB 5EPSA 5CQTA 3SVFA 4LYSA 2DVRA 5KTWA 4TZ8A 5BT3A 5KTUA 4YYDA 4O7AA 5LJ1A 2DWWA 4YABA 3U5LA 4C67A 4J3IA 3LXJA 5DKHA 5LKZA 1WUMA 4O71A 4A9IA 5LVRA 5D7XA 4QR3A 2DKWA 5D0CA 2F6NA 4UYEA 5CQ3A 4QUTA 5EISA 4TT2A 3LQJA 2H60A 5D3NA 5LKUA 5HENA 3P1CA 5EV9A 4LYWA 4J1PA 5FBXA 4Q0NA 5CS8A 4HXSA 4UIXA 5F1HA 5H85A 5HQ5A 4IOQA 5D3HA 5D3RA 5TCMA 3G0JA 4Z6IA 1JSPB 4UIZA 4TYLA 5CFWA 3U5KA 4O77A 4LRGA 4YK0A 3U5JA 3P5OA 4NRCA 5H1UA 4QC1A 5C7NA 2RI7A 4QUUA 5IG6A 4A9EA 5CUDA 5E9IA 4TTEA 4NQMA 4O7BA 5L98A 3UV5A 1E6IA 4NYWA 4YH4A 5FE8A 3P1EA 3Q2EA 3JVLA 2E7OA 5F62A 4UIWA 5IGLA 3HMEA 5F25A 5EGUA 5FE7A 5CUBA 5A5NA 5EQ1A 4O7EA 5D3PA 5L96A 4O7CA 3UVDA 4NR9A 5ENFA 4QSQA 5HJCA 3U5PA 4QSTA 5FB1A 5A81A 5TB6A 5I7YA 4A9JA 5D3SA 5DFDA 4TU6A 5G4SA 4A9OA 2N9GA 5G4RA 3LJWA 5DFBA 5FH7A 4N4GA 4QZSA 4HXOA 5FE9A 5CRMA 5E9YA 5E73A 4Z1QA 5ETBA 5EWVA 4WIVA 5CUCA 4NRAA 3MUKA 5D3TA 4YY6A 5A5QA 3Q2FA 5FB0A 5FFWA 5HQ7A 3I3JA 2DVQA 2YW5A 3ZYUA 4YYMA 4UYFA 4Q0OA 5EM3A 4OGJA 5FH8A 5KO4A 4LZ2A 2RFJA 5CQ5A 5I7XA 5EU1A 4N4IA 5K29A 4BW1A 4FLPA 2DVSA 2I7KA 4NR6A 5HRWA 4CUQA 4QR4A 5LJ2A 4NQNA 5DFCA 1X0JA 2RNXA 5A5SA 3MQMA 3K2JA 4QSRA 1F68A 4HXLA 4YYGA 1WUGA 2WP2A 3HMFA 4HBWA 4N4FA 5CGPA 3TLPA 3UVYA 5J0DA 4A9FA 5DYXA 3JVMA 5IGKA 4NUCA 5D26A 2R0VA 3ONIA 4A9HA 4PCIA 4UYDA 5C4QA 5H1VA 4YH3A 5EWCA 4AKNA 2MJVB 5AMFA 5DYAA 5II2A 5BT5A 5A82A 5IGNA 5F1LA 2L5EA 5E9LA 5H1TA 4CLBA 2LSPB 4QSUA 5C8GA 4QSVA 2L84A 4NYXA 5FE5A 4QSXA 5HELA 5LKTA 5CQ4A 4DONA 3UV4A 4LDFA 5E3GA 4O7FA 5A5PA 5E9MA 2G4AA 2DATA 4XY8A 4NS5A 5CQAA 4CUTA 4O75A 4WHWA 3P1DA 5F61A 4E96A 5DKDA 5HEMA 5EICA 4KV4A 5FG5A 4O72A 5CQ6A 4ALHA 4F3IA 2NXBA 5II1A 5E9KA 4YYIA 5F63A 4YYNA 3SVHA 3HMHA 5F60A 4TU4A 4BHWA 5HCLA 4PS5A 4OUFA 3UW9A 2RS9B 5FE2A 2RO1A 5FG6A 4MENA 4IR3A 4A9KA 4IOOA 5A83A 5HLSA 5DYCA 3U5MA 2L85A 1ZS5A 4TZ2A 2YEKA 5E7DA 5IIDA 4HXRA 5D25A 4UITA 5A85A 4RVRA 2OSSA 5CP5A 5DY7A 4CFLA 4MR6A 5FE0A 5EVAA 4XUAA 4O78A 5FH6A 5E74A 4GPJA 3IU5A 5ACYA 1N72A 5EK9A 5CUEA 4HXKA 4TQNA 5EPBA 5CU8A 4QEUA 5LVQA 2F6JA 4CFKA 4YC9A 5CRZA 5FE3A 5ENCA 5AD3A 5BT4A 4NYVA 5FFYA 3O34A 5CY9A 3S92A 4LZRA 4YYJA 5F2PA 5FE6A 2D82A 2RNYA 4QR5A 2R10A 3UV2A 4QYDA 5HRXA 5D24A 5IGMA 2FSAA 4NR8A 5D3JA 2D9EA 4IR6A 4PCEA 2I8NA 4BJXA 5DW1A 4A9MA 4NXJA 4UIVA 4HBVA 2OO1A 3O37A 4MR4A 5F3AA 5IBNA 3MXFA 3U5NA 5A7CA 5AMEA 3RCWA 2YEMA 4Z1SA 4ZW1A 3S91A 5DX4A 5LJ0A 4MEQA 2YELA 5HM0A 5CTLA 5JI8A 4YADA 2GRCA 5F5ZA 5CUAA 4QY4A 5DLXA 4QSSA 5I89A 3MB4A 4PTBA 2E7NA 4O76A 2WP1A 5L97A 2DVVA 3NXBA 4QEVA 4ZQLA 5LUUA 4HXNA 4IR5A 4BW3A 4LR6A 5HQ6A 4BW2A 3QZTA 5DLZA 3JVJA 4NUEA 4QC3A 5FE1A 5I29A 3QZSA 4NR7A 3AQAA 5ENIA 4O70A 4MEOA 3GG3A 4TT4A 3DWYA 4UIUA 4QSPA 5E9VA 4QBMA 4QEWA 5A5OA 5EA1A 3MB3A 4CURA 4CUPA 5FG4A 3LQHA 4Y03A 4YY4A 5KHMA 4HBYA 5FE4A 4OGIA 4CUSA 5A5RA 4TT6A 5EWDA 4ZC9A 5HFQA 5LKXA 3FKMX 3SVGA 4MEPA 4KCXA 4TS8A 5EWHA 4PY6A 4UIYA 3LQIA 5ENEA 4UYGA 3IU6A 4NR5A 3DAIA 5AD2A 4YBMA 4XUBA 4YATA 5DKCA 5ENHA 4O74A 4QB3A 4YYHA 4XYAA 2RNWA 3G0LA 4LYIA 5HFRA 5FDZA 5ETDA 4NRBA 4CL9A 4N3WA 5C89A 3O33A 5ENGA 5E0RA 4J0SA 4YAXA 2KTBB 5DYUA 4HXMA 4QSWA 5L8UA 4HXPA 4ALGA 5EWWA 4J0RA 4MR5A 5KU3A 5DBMA 4KV1A 4Z93A 5DW2A 3AADA 4QYLA 4A9NA 5EP7A 4Z6HA 2YQDA 3D7CA 4IR4A 2YYNA 5ENBA 2R0YA 5E3DA 4X2IA 3U5OA 4A9LA 4YBSA 4XY9A 4IORA 5COIA 4LC2A 4NR4A 5EI4A 4C66A 5L8TA 5F36A 3MULA 5FFVA 4QNSA 4LZSA 5HRVA 5CZGA 4N4HA 4WHUA 3P1FA 3QZVA 4UYHA 5C85A 3UVWA 5I1QA 3O35A 4PKLA 4YBTA 4NUDA 5CPEA 4MR3A 5CUGA 5EPRA 5I83A 1JM4B 3O36A 2YDWA 5I88A 3JVKA 1EQFA 5CQ8A 5I86A 5ENJA 5I80A 5I40A 5KTXA 5CQ7A 5C87A 4HBXA 2E3KA 2R0SA 4CUUA 5JWMA 2OUOA 5L99A 3UVXA 5D3LA 4YYKA 4BW4A
chains in the Genus database with same CATH superfamily
4UYFB 5EPSA 5CQTA 3SVFA 4LYSA 2DVRA 5KTWA 4TZ8A 5BT3A 5KTUA 4YYDA 4O7AA 5LJ1A 2DWWA 4YABA 3U5LA 4C67A 4J3IA 3LXJA 5DKHA 5LKZA 1WUMA 4O71A 4A9IA 5LVRA 5D7XA 4QR3A 2DKWA 5D0CA 2F6NA 4UYEA 5CQ3A 4QUTA 5EISA 4TT2A 3LQJA 2H60A 5D3NA 5LKUA 5HENA 3P1CA 5EV9A 4LYWA 4J1PA 5FBXA 4Q0NA 5CS8A 4HXSA 4UIXA 5F1HA 5H85A 5HQ5A 4IOQA 5D3HA 5D3RA 5TCMA 3G0JA 4Z6IA 1JSPB 4UIZA 4TYLA 5CFWA 3U5KA 4O77A 4LRGA 4YK0A 3U5JA 3P5OA 4NRCA 5H1UA 4QC1A 5C7NA 2RI7A 4QUUA 5IG6A 4A9EA 5CUDA 5E9IA 4TTEA 4NQMA 4O7BA 5L98A 3UV5A 1E6IA 3ERRA 4NYWA 4YH4A 3P1EA 5FE8A 3Q2EA 3JVLA 2E7OA 5F62A 4UIWA 5IGLA 3HMEA 5F25A 5EGUA 5FE7A 5CUBA 5A5NA 5EQ1A 4O7EA 5D3PA 5L96A 4O7CA 3UVDA 4NR9A 5ENFA 4QSQA 5HJCA 3U5PA 4QSTA 5FB1A 5A81A 5TB6A 5I7YA 4A9JA 5D3SA 5DFDA 4TU6A 5G4SA 4A9OA 2N9GA 5G4RA 3VKHA 3LJWA 5DFBA 5FH7A 4N4GA 4QZSA 4HXOA 5FE9A 5CRMA 5E9YA 5E73A 3VKGA 4Z1QA 5ETBA 5EWVA 4WIVA 5CUCA 4NRAA 3MUKA 5D3TA 4YY6A 5A5QA 3Q2FA 5FB0A 5FFWA 5HQ7A 3I3JA 2DVQA 2YW5A 3ZYUA 4YYMA 4UYFA 4Q0OA 5EM3A 4OGJA 5FH8A 5KO4A 4LZ2A 2RFJA 5CQ5A 5I7XA 5EU1A 4N4IA 5K29A 4BW1A 4FLPA 2DVSA 2I7KA 4NR6A 5HRWA 4CUQA 4QR4A 5LJ2A 4NQNA 5DFCA 1X0JA 2RNXA 5A5SA 3MQMA 3K2JA 4QSRA 4AKHA 1F68A 4HXLA 4YYGA 1WUGA 2WP2A 3HMFA 4HBWA 4N4FA 5CGPA 3TLPA 3UVYA 5J0DA 4A9FA 5DYXA 3JVMA 5IGKA 4NUCA 5D26A 2R0VA 3ONIA 4A9HA 4PCIA 4UYDA 5C4QA 5H1VA 4YH3A 5EWCA 4AKNA 2MJVB 5AMFA 5DYAA 5II2A 5BT5A 5A82A 5IGNA 5F1LA 2L5EA 5E9LA 5H1TA 4CLBA 2LSPB 4QSUA 5C8GA 4QSVA 2L84A 4NYXA 5FE5A 4QSXA 5HELA 5LKTA 5CQ4A 4DONA 3UV4A 4LDFA 5E3GA 4O7FA 5A5PA 5E9MA 2G4AA 2DATA 4XY8A 4NS5A 5CQAA 4CUTA 4O75A 4WHWA 3P1DA 5F61A 4E96A 5DKDA 5HEMA 5EICA 4KV4A 5FG5A 4O72A 5CQ6A 4ALHA 4F3IA 2NXBA 5II1A 5E9KA 4YYIA 5F63A 4YYNA 3SVHA 3HMHA 5F60A 4TU4A 4BHWA 5HCLA 4PS5A 4AKGA 4OUFA 3UW9A 2RS9B 5FE2A 2RO1A 5FG6A 4MENA 4IR3A 4A9KA 4IOOA 5A83A 5HLSA 5DYCA 3U5MA 2L85A 1ZS5A 4TZ2A 2YEKA 5E7DA 5IIDA 4HXRA 5D25A 4UITA 5A85A 4RVRA 2OSSA 5CP5A 5DY7A 4CFLA 4MR6A 5FE0A 5EVAA 4XUAA 2EJNA 4O78A 5FH6A 5E74A 4GPJA 3IU5A 5ACYA 1N72A 5EK9A 5CUEA 4HXKA 4TQNA 5EPBA 5CU8A 4QEUA 5LVQA 2F6JA 4CFKA 4YC9A 5CRZA 5FE3A 5ENCA 5AD3A 5BT4A 4NYVA 5FFYA 3O34A 5CY9A 3S92A 4LZRA 4YYJA 5F2PA 5FE6A 2D82A 2RNYA 4QR5A 2R10A 3UV2A 4QYDA 5HRXA 5D24A 5IGMA 2FSAA 4NR8A 5D3JA 3D1DA 2D9EA 4IR6A 4PCEA 2I8NA 4BJXA 5DW1A 4A9MA 4NXJA 4UIVA 4HBVA 2OO1A 3O37A 4MR4A 5F3AA 5IBNA 3MXFA 3U5NA 5A7CA 5AMEA 3RCWA 2YEMA 4Z1SA 4ZW1A 3S91A 5DX4A 5LJ0A 4MEQA 2YELA 5HM0A 5CTLA 5JI8A 4YADA 2GRCA 5F5ZA 5CUAA 4QY4A 5DLXA 4QSSA 5I89A 3MB4A 4PTBA 2E7NA 4O76A 2WP1A 5L97A 2DVVA 3NXBA 4QEVA 4ZQLA 5LUUA 4HXNA 4IR5A 4BW3A 4LR6A 5HQ6A 4BW2A 3QZTA 5DLZA 3JVJA 4NUEA 4QC3A 5FE1A 5I29A 3QZSA 4NR7A 3AQAA 5ENIA 4O70A 4MEOA 3GG3A 4TT4A 3DWYA 4UIUA 4QSPA 5E9VA 4QBMA 4QEWA 5A5OA 5EA1A 3MB3A 4CURA 4CUPA 5FG4A 3LQHA 4Y03A 4YY4A 5KHMA 4HBYA 5FE4A 4OGIA 4CUSA 5A5RA 4TT6A 5EWDA 4ZC9A 5HFQA 5LKXA 3FKMX 3SVGA 4AKIA 4MEPA 4KCXA 4TS8A 5EWHA 4PY6A 4UIYA 3LQIA 5ENEA 4UYGA 3IU6A 4NR5A 3DAIA 5AD2A 4YBMA 4XUBA 4YATA 5DKCA 5ENHA 4O74A 4QB3A 4YYHA 4XYAA 2RNWA 3G0LA 4LYIA 3D1BA 5HFRA 5FDZA 5ETDA 4NRBA 4CL9A 4N3WA 5C89A 3O33A 5ENGA 5E0RA 4J0SA 4YAXA 2KTBB 1PUOA 5DYUA 1ZKRA 4HXMA 4QSWA 5L8UA 4HXPA 4ALGA 5EWWA 4J0RA 4MR5A 5KU3A 5DBMA 4KV1A 4Z93A 5DW2A 3AADA 4QYLA 4A9NA 5EP7A 4Z6HA 2YQDA 3D7CA 4IR4A 2YYNA 5ENBA 2R0YA 5E3DA 4X2IA 3U5OA 4A9LA 4YBSA 4XY9A 4IORA 5COIA 4LC2A 4NR4A 5EI4A 4C66A 5L8TA 5F36A 3MULA 5FFVA 4QNSA 4LZSA 5HRVA 5CZGA 4N4HA 4WHUA 3P1FA 3QZVA 4UYHA 5C85A 3UVWA 5I1QA 3O35A 4PKLA 4YBTA 4NUDA 5CPEA 4MR3A 5CUGA 5EPRA 5I83A 1JM4B 3O36A 2YDWA 5I88A 3JVKA 1EQFA 5CQ8A 5I86A 5ENJA 5I80A 5I40A 5KTXA 5CQ7A 5C87A 4AI6A 4HBXA 2E3KA 2R0SA 4CUUA 5JWMA 2OUOA 5L99A 3UVXA 5D3LA 4YYKA 4BW4A
chains in the Genus database with same CATH topology
4UYFB 5EPSA 5CQTA 3SVFA 4LYSA 2DVRA 5KTWA 4TZ8A 5BT3A 5KTUA 4YYDA 4O7AA 5LJ1A 2DWWA 4YABA 3U5LA 4C67A 4J3IA 3LXJA 5DKHA 5LKZA 1WUMA 4O71A 4A9IA 5LVRA 5D7XA 4QR3A 2DKWA 5D0CA 2F6NA 4UYEA 5CQ3A 4QUTA 5EISA 4TT2A 3LQJA 2H60A 5D3NA 5LKUA 5HENA 3P1CA 5EV9A 4LYWA 4J1PA 5FBXA 4Q0NA 5CS8A 4HXSA 4UIXA 5F1HA 5H85A 5HQ5A 4IOQA 5D3HA 5D3RA 5TCMA 3G0JA 4Z6IA 1JSPB 4UIZA 4TYLA 5CFWA 3U5KA 4O77A 4LRGA 4YK0A 3U5JA 3P5OA 4NRCA 5H1UA 4QC1A 5C7NA 2RI7A 4QUUA 5IG6A 4A9EA 5CUDA 5E9IA 4TTEA 4NQMA 4O7BA 5L98A 3UV5A 1E6IA 4NYWA 4YH4A 5FE8A 3P1EA 3Q2EA 3JVLA 2E7OA 5F62A 4UIWA 5IGLA 3HMEA 5F25A 5EGUA 5FE7A 5CUBA 5A5NA 5EQ1A 4O7EA 5D3PA 5L96A 4O7CA 3UVDA 4NR9A 5ENFA 4QSQA 5HJCA 3U5PA 4QSTA 5FB1A 5A81A 5TB6A 5I7YA 4A9JA 5D3SA 5DFDA 4TU6A 5G4SA 4A9OA 2N9GA 5G4RA 3LJWA 5DFBA 5FH7A 4N4GA 4QZSA 4HXOA 5FE9A 5CRMA 5E9YA 5E73A 4Z1QA 5ETBA 5EWVA 4WIVA 5CUCA 4NRAA 3MUKA 5D3TA 4YY6A 5A5QA 3Q2FA 5FB0A 5FFWA 5HQ7A 3I3JA 2DVQA 2YW5A 3ZYUA 4YYMA 4UYFA 4Q0OA 5EM3A 4OGJA 5FH8A 5KO4A 4LZ2A 2RFJA 5CQ5A 5I7XA 5EU1A 4N4IA 5K29A 4BW1A 4FLPA 2DVSA 2I7KA 4NR6A 5HRWA 4CUQA 4QR4A 5LJ2A 4NQNA 5DFCA 1X0JA 2RNXA 5A5SA 3MQMA 3K2JA 4QSRA 1F68A 4HXLA 4YYGA 1WUGA 2WP2A 3HMFA 4HBWA 4N4FA 5CGPA 3TLPA 3UVYA 5J0DA 4A9FA 5DYXA 3JVMA 5IGKA 4NUCA 5D26A 2R0VA 3ONIA 4A9HA 4PCIA 4UYDA 5C4QA 5H1VA 4YH3A 5EWCA 4AKNA 2MJVB 5AMFA 5DYAA 5II2A 5BT5A 5A82A 5IGNA 5F1LA 2L5EA 5E9LA 5H1TA 4CLBA 2LSPB 4QSUA 5C8GA 4QSVA 2L84A 4NYXA 5FE5A 4QSXA 5HELA 5LKTA 5CQ4A 4DONA 3UV4A 4LDFA 5E3GA 4O7FA 5A5PA 5E9MA 2G4AA 2DATA 4XY8A 4NS5A 5CQAA 4CUTA 4O75A 4WHWA 3P1DA 5F61A 4E96A 5DKDA 5HEMA 5EICA 4KV4A 5FG5A 4O72A 5CQ6A 4ALHA 4F3IA 2NXBA 5II1A 5E9KA 4YYIA 5F63A 4YYNA 3SVHA 3HMHA 5F60A 4TU4A 4BHWA 5HCLA 4PS5A 4OUFA 3UW9A 2RS9B 5FE2A 2RO1A 5FG6A 4MENA 4IR3A 4A9KA 4IOOA 5A83A 5HLSA 5DYCA 3U5MA 2L85A 1ZS5A 4TZ2A 2YEKA 5E7DA 5IIDA 4HXRA 5D25A 4UITA 5A85A 4RVRA 2OSSA 5CP5A 5DY7A 4CFLA 4MR6A 5FE0A 5EVAA 4XUAA 4O78A 5FH6A 5E74A 4GPJA 3IU5A 5ACYA 1N72A 5EK9A 5CUEA 4HXKA 4TQNA 5EPBA 5CU8A 4QEUA 5LVQA 2F6JA 4CFKA 4YC9A 5CRZA 5FE3A 5ENCA 5AD3A 5BT4A 4NYVA 5FFYA 3O34A 5CY9A 3S92A 4LZRA 4YYJA 5F2PA 5FE6A 2D82A 2RNYA 4QR5A 2R10A 3UV2A 4QYDA 5HRXA 5D24A 5IGMA 2FSAA 4NR8A 5D3JA 2D9EA 4IR6A 4PCEA 2I8NA 4BJXA 5DW1A 4A9MA 4NXJA 4UIVA 4HBVA 2OO1A 3O37A 4MR4A 5F3AA 5IBNA 3MXFA 3U5NA 5A7CA 5AMEA 3RCWA 2YEMA 4Z1SA 4ZW1A 3S91A 5DX4A 5LJ0A 4MEQA 2YELA 5HM0A 5CTLA 5JI8A 4YADA 2GRCA 5F5ZA 5CUAA 4QY4A 5DLXA 4QSSA 5I89A 3MB4A 4PTBA 2E7NA 4O76A 2WP1A 5L97A 2DVVA 3NXBA 4QEVA 4ZQLA 5LUUA 4HXNA 4IR5A 4BW3A 4LR6A 5HQ6A 4BW2A 3QZTA 5DLZA 3JVJA 4NUEA 4QC3A 5FE1A 5I29A 3QZSA 4NR7A 3AQAA 5ENIA 4O70A 4MEOA 3GG3A 4TT4A 3DWYA 4UIUA 4QSPA 5E9VA 4QBMA 4QEWA 5A5OA 5EA1A 3MB3A 4CURA 4CUPA 5FG4A 3LQHA 4Y03A 4YY4A 5KHMA 4HBYA 5FE4A 4OGIA 4CUSA 5A5RA 4TT6A 5EWDA 4ZC9A 5HFQA 5LKXA 3FKMX 3SVGA 4MEPA 4KCXA 4TS8A 5EWHA 4PY6A 4UIYA 3LQIA 5ENEA 4UYGA 3IU6A 4NR5A 3DAIA 5AD2A 4YBMA 4XUBA 4YATA 5DKCA 5ENHA 4O74A 4QB3A 4YYHA 4XYAA 2RNWA 3G0LA 4LYIA 5HFRA 5FDZA 5ETDA 4NRBA 4CL9A 4N3WA 5C89A 3O33A 5ENGA 5E0RA 4J0SA 4YAXA 2KTBB 5DYUA 4HXMA 4QSWA 5L8UA 4HXPA 4ALGA 5EWWA 4J0RA 4MR5A 5KU3A 5DBMA 4KV1A 4Z93A 5DW2A 3AADA 4QYLA 4A9NA 5EP7A 4Z6HA 2YQDA 3D7CA 4IR4A 2YYNA 5ENBA 2R0YA 5E3DA 4X2IA 3U5OA 4A9LA 4YBSA 4XY9A 4IORA 5COIA 4LC2A 4NR4A 5EI4A 4C66A 5L8TA 5F36A 3MULA 5FFVA 4QNSA 4LZSA 5HRVA 5CZGA 4N4HA 4WHUA 3P1FA 3QZVA 4UYHA 5C85A 3UVWA 5I1QA 3O35A 4PKLA 4YBTA 4NUDA 5CPEA 4MR3A 5CUGA 5EPRA 5I83A 1JM4B 3O36A 2YDWA 5I88A 3JVKA 1EQFA 5CQ8A 5I86A 5ENJA 5I80A 5I40A 5KTXA 5CQ7A 5C87A 4HBXA 2E3KA 2R0SA 4CUUA 5JWMA 2OUOA 5L99A 3UVXA 5D3LA 4YYKA 4BW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UYF B;  5EPS A;  5CQT A;  3SVF A;  4LYS A;  2DVR A;  5KTW A;  4TZ8 A;  5BT3 A;  5KTU A;  4YYD A;  4O7A A;  5LJ1 A;  2DWW A;  4YAB A;  3U5L A;  4C67 A;  4J3I A;  3LXJ A;  5DKH A;  5LKZ A;  1WUM A;  4O71 A;  4A9I A;  5LVR A;  5D7X A;  4QR3 A;  2DKW A;  5D0C A;  2F6N A;  4UYE A;  5CQ3 A;  4QUT A;  5EIS A;  4TT2 A;  3LQJ A;  2H60 A;  5D3N A;  5LKU A;  5HEN A;  3P1C A;  5EV9 A;  4LYW A;  4J1P A;  5FBX A;  4Q0N A;  5CS8 A;  4HXS A;  4UIX A;  5F1H A;  5H85 A;  5HQ5 A;  4IOQ A;  5D3H A;  5D3R A;  5TCM A;  3G0J A;  4Z6I A;  1JSP B;  4UIZ A;  4TYL A;  5CFW A;  3U5K A;  4O77 A;  4LRG A;  4YK0 A;  3U5J A;  3P5O A;  4NRC A;  5H1U A;  4QC1 A;  5C7N A;  2RI7 A;  4QUU A;  5IG6 A;  4A9E A;  5CUD A;  5E9I A;  4TTE A;  4NQM A;  4O7B A;  5L98 A;  3UV5 A;  1E6I A;  4NYW A;  4YH4 A;  5FE8 A;  3P1E A;  3Q2E A;  3JVL A;  2E7O A;  5F62 A;  4UIW A;  5IGL A;  3HME A;  5F25 A;  5EGU A;  5FE7 A;  5CUB A;  5A5N A;  5EQ1 A;  4O7E A;  5D3P A;  5L96 A;  4O7C A;  3UVD A;  4NR9 A;  5ENF A;  4QSQ A;  5HJC A;  3U5P A;  4QST A;  5FB1 A;  5A81 A;  5TB6 A;  5I7Y A;  4A9J A;  5D3S A;  5DFD A;  4TU6 A;  5G4S A;  4A9O A;  2N9G A;  5G4R A;  3LJW A;  5DFB A;  5FH7 A;  4N4G A;  4QZS A;  4HXO A;  5FE9 A;  5CRM A;  5E9Y A;  5E73 A;  4Z1Q A;  5ETB A;  5EWV A;  4WIV A;  5CUC A;  4NRA A;  3MUK A;  5D3T A;  4YY6 A;  5A5Q A;  3Q2F A;  5FB0 A;  5FFW A;  5HQ7 A;  3I3J A;  2DVQ A;  2YW5 A;  3ZYU A;  4YYM A;  4UYF A;  4Q0O A;  5EM3 A;  4OGJ A;  5FH8 A;  5KO4 A;  4LZ2 A;  2RFJ A;  5CQ5 A;  5I7X A;  5EU1 A;  4N4I A;  5K29 A;  4BW1 A;  4FLP A;  2DVS A;  2I7K A;  4NR6 A;  5HRW A;  4CUQ A;  4QR4 A;  5LJ2 A;  4NQN A;  5DFC A;  1X0J A;  2RNX A;  5A5S A;  3MQM A;  3K2J A;  4QSR A;  1F68 A;  4HXL A;  4YYG A;  1WUG A;  2WP2 A;  3HMF A;  4HBW A;  4N4F A;  5CGP A;  3TLP A;  3UVY A;  5J0D A;  4A9F A;  5DYX A;  3JVM A;  5IGK A;  4NUC A;  5D26 A;  2R0V A;  3ONI A;  4A9H A;  4PCI A;  4UYD A;  5C4Q A;  5H1V A;  4YH3 A;  5EWC A;  4AKN A;  2MJV B;  5AMF A;  5DYA A;  5II2 A;  5BT5 A;  5A82 A;  5IGN A;  5F1L A;  2L5E A;  5E9L A;  5H1T A;  4CLB A;  2LSP B;  4QSU A;  5C8G A;  4QSV A;  2L84 A;  4NYX A;  5FE5 A;  4QSX A;  5HEL A;  5LKT A;  5CQ4 A;  4DON A;  3UV4 A;  4LDF A;  5E3G A;  4O7F A;  5A5P A;  5E9M A;  2G4A A;  2DAT A;  4XY8 A;  4NS5 A;  5CQA A;  4CUT A;  4O75 A;  4WHW A;  3P1D A;  5F61 A;  4E96 A;  5DKD A;  5HEM A;  5EIC A;  4KV4 A;  5FG5 A;  4O72 A;  5CQ6 A;  4ALH A;  4F3I A;  2NXB A;  5II1 A;  5E9K A;  4YYI A;  5F63 A;  4YYN A;  3SVH A;  3HMH A;  5F60 A;  4TU4 A;  4BHW A;  5HCL A;  4PS5 A;  4OUF A;  3UW9 A;  2RS9 B;  5FE2 A;  2RO1 A;  5FG6 A;  4MEN A;  4IR3 A;  4A9K A;  4IOO A;  5A83 A;  5HLS A;  5DYC A;  3U5M A;  2L85 A;  1ZS5 A;  4TZ2 A;  2YEK A;  5E7D A;  5IID A;  4HXR A;  5D25 A;  4UIT A;  5A85 A;  4RVR A;  2OSS A;  5CP5 A;  5DY7 A;  4CFL A;  4MR6 A;  5FE0 A;  5EVA A;  4XUA A;  4O78 A;  5FH6 A;  5E74 A;  4GPJ A;  3IU5 A;  5ACY A;  1N72 A;  5EK9 A;  5CUE A;  4HXK A;  4TQN A;  5EPB A;  5CU8 A;  4QEU A;  5LVQ A;  2F6J A;  4CFK A;  4YC9 A;  5CRZ A;  5FE3 A;  5ENC A;  5AD3 A;  5BT4 A;  4NYV A;  5FFY A;  3O34 A;  5CY9 A;  3S92 A;  4LZR A;  4YYJ A;  5F2P A;  5FE6 A;  2D82 A;  2RNY A;  4QR5 A;  2R10 A;  3UV2 A;  4QYD A;  5HRX A;  5D24 A;  5IGM A;  2FSA A;  4NR8 A;  5D3J A;  2D9E A;  4IR6 A;  4PCE A;  2I8N A;  4BJX A;  5DW1 A;  4A9M A;  4NXJ A;  4UIV A;  4HBV A;  2OO1 A;  3O37 A;  4MR4 A;  5F3A A;  5IBN A;  3MXF A;  3U5N A;  5A7C A;  5AME A;  3RCW A;  2YEM A;  4Z1S A;  4ZW1 A;  3S91 A;  5DX4 A;  5LJ0 A;  4MEQ A;  2YEL A;  5HM0 A;  5CTL A;  5JI8 A;  4YAD A;  2GRC A;  5F5Z A;  5CUA A;  4QY4 A;  5DLX A;  4QSS A;  5I89 A;  3MB4 A;  4PTB A;  2E7N A;  4O76 A;  2WP1 A;  5L97 A;  2DVV A;  3NXB A;  4QEV A;  4ZQL A;  5LUU A;  4HXN A;  4IR5 A;  4BW3 A;  4LR6 A;  5HQ6 A;  4BW2 A;  3QZT A;  5DLZ A;  3JVJ A;  4NUE A;  4QC3 A;  5FE1 A;  5I29 A;  3QZS A;  4NR7 A;  3AQA A;  5ENI A;  4O70 A;  4MEO A;  3GG3 A;  4TT4 A;  3DWY A;  4UIU A;  4QSP A;  5E9V A;  4QBM A;  4QEW A;  5A5O A;  5EA1 A;  3MB3 A;  4CUR A;  4CUP A;  5FG4 A;  3LQH A;  4Y03 A;  4YY4 A;  5KHM A;  4HBY A;  5FE4 A;  4OGI A;  4CUS A;  5A5R A;  4TT6 A;  5EWD A;  4ZC9 A;  5HFQ A;  5LKX A;  3FKM X;  3SVG A;  4MEP A;  4KCX A;  4TS8 A;  5EWH A;  4PY6 A;  4UIY A;  3LQI A;  5ENE A;  4UYG A;  3IU6 A;  4NR5 A;  3DAI A;  5AD2 A;  4YBM A;  4XUB A;  4YAT A;  5DKC A;  5ENH A;  4O74 A;  4QB3 A;  4YYH A;  4XYA A;  2RNW A;  3G0L A;  4LYI A;  5HFR A;  5FDZ A;  5ETD A;  4NRB A;  4CL9 A;  4N3W A;  5C89 A;  3O33 A;  5ENG A;  5E0R A;  4J0S A;  4YAX A;  2KTB B;  5DYU A;  4HXM A;  4QSW A;  5L8U A;  4HXP A;  4ALG A;  5EWW A;  4J0R A;  4MR5 A;  5KU3 A;  5DBM A;  4KV1 A;  4Z93 A;  5DW2 A;  3AAD A;  4QYL A;  4A9N A;  5EP7 A;  4Z6H A;  2YQD A;  3D7C A;  4IR4 A;  2YYN A;  5ENB A;  2R0Y A;  5E3D A;  4X2I A;  3U5O A;  4A9L A;  4YBS A;  4XY9 A;  4IOR A;  5COI A;  4LC2 A;  4NR4 A;  5EI4 A;  4C66 A;  5L8T A;  5F36 A;  3MUL A;  5FFV A;  4QNS A;  4LZS A;  5HRV A;  5CZG A;  4N4H A;  4WHU A;  3P1F A;  3QZV A;  4UYH A;  5C85 A;  3UVW A;  5I1Q A;  3O35 A;  4PKL A;  4YBT A;  4NUD A;  5CPE A;  4MR3 A;  5CUG A;  5EPR A;  5I83 A;  1JM4 B;  3O36 A;  2YDW A;  5I88 A;  3JVK A;  1EQF A;  5CQ8 A;  5I86 A;  5ENJ A;  5I80 A;  5I40 A;  5KTX A;  5CQ7 A;  5C87 A;  4HBX A;  2E3K A;  2R0S A;  4CUU A;  5JWM A;  2OUO A;  5L99 A;  3UVX A;  5D3L A;  4YYK A;  4BW4 A; 
#chains in the Genus database with same CATH topology
 4UYF B;  5EPS A;  5CQT A;  3SVF A;  4LYS A;  2DVR A;  5KTW A;  4TZ8 A;  5BT3 A;  5KTU A;  4YYD A;  4O7A A;  5LJ1 A;  2DWW A;  4YAB A;  3U5L A;  4C67 A;  4J3I A;  3LXJ A;  5DKH A;  5LKZ A;  1WUM A;  4O71 A;  4A9I A;  5LVR A;  5D7X A;  4QR3 A;  2DKW A;  5D0C A;  2F6N A;  4UYE A;  5CQ3 A;  4QUT A;  5EIS A;  4TT2 A;  3LQJ A;  2H60 A;  5D3N A;  5LKU A;  5HEN A;  3P1C A;  5EV9 A;  4LYW A;  4J1P A;  5FBX A;  4Q0N A;  5CS8 A;  4HXS A;  4UIX A;  5F1H A;  5H85 A;  5HQ5 A;  4IOQ A;  5D3H A;  5D3R A;  5TCM A;  3G0J A;  4Z6I A;  1JSP B;  4UIZ A;  4TYL A;  5CFW A;  3U5K A;  4O77 A;  4LRG A;  4YK0 A;  3U5J A;  3P5O A;  4NRC A;  5H1U A;  4QC1 A;  5C7N A;  2RI7 A;  4QUU A;  5IG6 A;  4A9E A;  5CUD A;  5E9I A;  4TTE A;  4NQM A;  4O7B A;  5L98 A;  3UV5 A;  1E6I A;  3ERR A;  4NYW A;  4YH4 A;  3P1E A;  5FE8 A;  3Q2E A;  3JVL A;  2E7O A;  5F62 A;  4UIW A;  5IGL A;  3HME A;  5F25 A;  5EGU A;  5FE7 A;  5CUB A;  5A5N A;  5EQ1 A;  4O7E A;  5D3P A;  5L96 A;  4O7C A;  3UVD A;  4NR9 A;  5ENF A;  4QSQ A;  5HJC A;  3U5P A;  4QST A;  5FB1 A;  5A81 A;  5TB6 A;  5I7Y A;  4A9J A;  5D3S A;  5DFD A;  4TU6 A;  5G4S A;  4A9O A;  2N9G A;  5G4R A;  3VKH A;  3LJW A;  5DFB A;  5FH7 A;  4N4G A;  4QZS A;  4HXO A;  5FE9 A;  5CRM A;  5E9Y A;  5E73 A;  3VKG A;  4Z1Q A;  5ETB A;  5EWV A;  4WIV A;  5CUC A;  4NRA A;  3MUK A;  5D3T A;  4YY6 A;  5A5Q A;  3Q2F A;  5FB0 A;  5FFW A;  5HQ7 A;  3I3J A;  2DVQ A;  2YW5 A;  3ZYU A;  4YYM A;  4UYF A;  4Q0O A;  5EM3 A;  4OGJ A;  5FH8 A;  5KO4 A;  4LZ2 A;  2RFJ A;  5CQ5 A;  5I7X A;  5EU1 A;  4N4I A;  5K29 A;  4BW1 A;  4FLP A;  2DVS A;  2I7K A;  4NR6 A;  5HRW A;  4CUQ A;  4QR4 A;  5LJ2 A;  4NQN A;  5DFC A;  1X0J A;  2RNX A;  5A5S A;  3MQM A;  3K2J A;  4QSR A;  4AKH A;  1F68 A;  4HXL A;  4YYG A;  1WUG A;  2WP2 A;  3HMF A;  4HBW A;  4N4F A;  5CGP A;  3TLP A;  3UVY A;  5J0D A;  4A9F A;  5DYX A;  3JVM A;  5IGK A;  4NUC A;  5D26 A;  2R0V A;  3ONI A;  4A9H A;  4PCI A;  4UYD A;  5C4Q A;  5H1V A;  4YH3 A;  5EWC A;  4AKN A;  2MJV B;  5AMF A;  5DYA A;  5II2 A;  5BT5 A;  5A82 A;  5IGN A;  5F1L A;  2L5E A;  5E9L A;  5H1T A;  4CLB A;  2LSP B;  4QSU A;  5C8G A;  4QSV A;  2L84 A;  4NYX A;  5FE5 A;  4QSX A;  5HEL A;  5LKT A;  5CQ4 A;  4DON A;  3UV4 A;  4LDF A;  5E3G A;  4O7F A;  5A5P A;  5E9M A;  2G4A A;  2DAT A;  4XY8 A;  4NS5 A;  5CQA A;  4CUT A;  4O75 A;  4WHW A;  3P1D A;  5F61 A;  4E96 A;  5DKD A;  5HEM A;  5EIC A;  4KV4 A;  5FG5 A;  4O72 A;  5CQ6 A;  4ALH A;  4F3I A;  2NXB A;  5II1 A;  5E9K A;  4YYI A;  5F63 A;  4YYN A;  3SVH A;  3HMH A;  5F60 A;  4TU4 A;  4BHW A;  5HCL A;  4PS5 A;  4AKG A;  4OUF A;  3UW9 A;  2RS9 B;  5FE2 A;  2RO1 A;  5FG6 A;  4MEN A;  4IR3 A;  4A9K A;  4IOO A;  5A83 A;  5HLS A;  5DYC A;  3U5M A;  2L85 A;  1ZS5 A;  4TZ2 A;  2YEK A;  5E7D A;  5IID A;  4HXR A;  5D25 A;  4UIT A;  5A85 A;  4RVR A;  2OSS A;  5CP5 A;  5DY7 A;  4CFL A;  4MR6 A;  5FE0 A;  5EVA A;  4XUA A;  2EJN A;  4O78 A;  5FH6 A;  5E74 A;  4GPJ A;  3IU5 A;  5ACY A;  1N72 A;  5EK9 A;  5CUE A;  4HXK A;  4TQN A;  5EPB A;  5CU8 A;  4QEU A;  5LVQ A;  2F6J A;  4CFK A;  4YC9 A;  5CRZ A;  5FE3 A;  5ENC A;  5AD3 A;  5BT4 A;  4NYV A;  5FFY A;  3O34 A;  5CY9 A;  3S92 A;  4LZR A;  4YYJ A;  5F2P A;  5FE6 A;  2D82 A;  2RNY A;  4QR5 A;  2R10 A;  3UV2 A;  4QYD A;  5HRX A;  5D24 A;  5IGM A;  2FSA A;  4NR8 A;  5D3J A;  3D1D A;  2D9E A;  4IR6 A;  4PCE A;  2I8N A;  4BJX A;  5DW1 A;  4A9M A;  4NXJ A;  4UIV A;  4HBV A;  2OO1 A;  3O37 A;  4MR4 A;  5F3A A;  5IBN A;  3MXF A;  3U5N A;  5A7C A;  5AME A;  3RCW A;  2YEM A;  4Z1S A;  4ZW1 A;  3S91 A;  5DX4 A;  5LJ0 A;  4MEQ A;  2YEL A;  5HM0 A;  5CTL A;  5JI8 A;  4YAD A;  2GRC A;  5F5Z A;  5CUA A;  4QY4 A;  5DLX A;  4QSS A;  5I89 A;  3MB4 A;  4PTB A;  2E7N A;  4O76 A;  2WP1 A;  5L97 A;  2DVV A;  3NXB A;  4QEV A;  4ZQL A;  5LUU A;  4HXN A;  4IR5 A;  4BW3 A;  4LR6 A;  5HQ6 A;  4BW2 A;  3QZT A;  5DLZ A;  3JVJ A;  4NUE A;  4QC3 A;  5FE1 A;  5I29 A;  3QZS A;  4NR7 A;  3AQA A;  5ENI A;  4O70 A;  4MEO A;  3GG3 A;  4TT4 A;  3DWY A;  4UIU A;  4QSP A;  5E9V A;  4QBM A;  4QEW A;  5A5O A;  5EA1 A;  3MB3 A;  4CUR A;  4CUP A;  5FG4 A;  3LQH A;  4Y03 A;  4YY4 A;  5KHM A;  4HBY A;  5FE4 A;  4OGI A;  4CUS A;  5A5R A;  4TT6 A;  5EWD A;  4ZC9 A;  5HFQ A;  5LKX A;  3FKM X;  3SVG A;  4AKI A;  4MEP A;  4KCX A;  4TS8 A;  5EWH A;  4PY6 A;  4UIY A;  3LQI A;  5ENE A;  4UYG A;  3IU6 A;  4NR5 A;  3DAI A;  5AD2 A;  4YBM A;  4XUB A;  4YAT A;  5DKC A;  5ENH A;  4O74 A;  4QB3 A;  4YYH A;  4XYA A;  2RNW A;  3G0L A;  4LYI A;  3D1B A;  5HFR A;  5FDZ A;  5ETD A;  4NRB A;  4CL9 A;  4N3W A;  5C89 A;  3O33 A;  5ENG A;  5E0R A;  4J0S A;  4YAX A;  2KTB B;  1PUO A;  5DYU A;  1ZKR A;  4HXM A;  4QSW A;  5L8U A;  4HXP A;  4ALG A;  5EWW A;  4J0R A;  4MR5 A;  5KU3 A;  5DBM A;  4KV1 A;  4Z93 A;  5DW2 A;  3AAD A;  4QYL A;  4A9N A;  5EP7 A;  4Z6H A;  2YQD A;  3D7C A;  4IR4 A;  2YYN A;  5ENB A;  2R0Y A;  5E3D A;  4X2I A;  3U5O A;  4A9L A;  4YBS A;  4XY9 A;  4IOR A;  5COI A;  4LC2 A;  4NR4 A;  5EI4 A;  4C66 A;  5L8T A;  5F36 A;  3MUL A;  5FFV A;  4QNS A;  4LZS A;  5HRV A;  5CZG A;  4N4H A;  4WHU A;  3P1F A;  3QZV A;  4UYH A;  5C85 A;  3UVW A;  5I1Q A;  3O35 A;  4PKL A;  4YBT A;  4NUD A;  5CPE A;  4MR3 A;  5CUG A;  5EPR A;  5I83 A;  1JM4 B;  3O36 A;  2YDW A;  5I88 A;  3JVK A;  1EQF A;  5CQ8 A;  5I86 A;  5ENJ A;  5I80 A;  5I40 A;  5KTX A;  5CQ7 A;  5C87 A;  4AI6 A;  4HBX A;  2E3K A;  2R0S A;  4CUU A;  5JWM A;  2OUO A;  5L99 A;  3UVX A;  5D3L A;  4YYK A;  4BW4 A; 
#chains in the Genus database with same CATH homology
 4UYF B;  5EPS A;  5CQT A;  3SVF A;  4LYS A;  2DVR A;  5KTW A;  4TZ8 A;  5BT3 A;  5KTU A;  4YYD A;  4O7A A;  5LJ1 A;  2DWW A;  4YAB A;  3U5L A;  4C67 A;  4J3I A;  3LXJ A;  5DKH A;  5LKZ A;  1WUM A;  4O71 A;  4A9I A;  5LVR A;  5D7X A;  4QR3 A;  2DKW A;  5D0C A;  2F6N A;  4UYE A;  5CQ3 A;  4QUT A;  5EIS A;  4TT2 A;  3LQJ A;  2H60 A;  5D3N A;  5LKU A;  5HEN A;  3P1C A;  5EV9 A;  4LYW A;  4J1P A;  5FBX A;  4Q0N A;  5CS8 A;  4HXS A;  4UIX A;  5F1H A;  5H85 A;  5HQ5 A;  4IOQ A;  5D3H A;  5D3R A;  5TCM A;  3G0J A;  4Z6I A;  1JSP B;  4UIZ A;  4TYL A;  5CFW A;  3U5K A;  4O77 A;  4LRG A;  4YK0 A;  3U5J A;  3P5O A;  4NRC A;  5H1U A;  4QC1 A;  5C7N A;  2RI7 A;  4QUU A;  5IG6 A;  4A9E A;  5CUD A;  5E9I A;  4TTE A;  4NQM A;  4O7B A;  5L98 A;  3UV5 A;  1E6I A;  4NYW A;  4YH4 A;  5FE8 A;  3P1E A;  3Q2E A;  3JVL A;  2E7O A;  5F62 A;  4UIW A;  5IGL A;  3HME A;  5F25 A;  5EGU A;  5FE7 A;  5CUB A;  5A5N A;  5EQ1 A;  4O7E A;  5D3P A;  5L96 A;  4O7C A;  3UVD A;  4NR9 A;  5ENF A;  4QSQ A;  5HJC A;  3U5P A;  4QST A;  5FB1 A;  5A81 A;  5TB6 A;  5I7Y A;  4A9J A;  5D3S A;  5DFD A;  4TU6 A;  5G4S A;  4A9O A;  2N9G A;  5G4R A;  3LJW A;  5DFB A;  5FH7 A;  4N4G A;  4QZS A;  4HXO A;  5FE9 A;  5CRM A;  5E9Y A;  5E73 A;  4Z1Q A;  5ETB A;  5EWV A;  4WIV A;  5CUC A;  4NRA A;  3MUK A;  5D3T A;  4YY6 A;  5A5Q A;  3Q2F A;  5FB0 A;  5FFW A;  5HQ7 A;  3I3J A;  2DVQ A;  2YW5 A;  3ZYU A;  4YYM A;  4UYF A;  4Q0O A;  5EM3 A;  4OGJ A;  5FH8 A;  5KO4 A;  4LZ2 A;  2RFJ A;  5CQ5 A;  5I7X A;  5EU1 A;  4N4I A;  5K29 A;  4BW1 A;  4FLP A;  2DVS A;  2I7K A;  4NR6 A;  5HRW A;  4CUQ A;  4QR4 A;  5LJ2 A;  4NQN A;  5DFC A;  1X0J A;  2RNX A;  5A5S A;  3MQM A;  3K2J A;  4QSR A;  1F68 A;  4HXL A;  4YYG A;  1WUG A;  2WP2 A;  3HMF A;  4HBW A;  4N4F A;  5CGP A;  3TLP A;  3UVY A;  5J0D A;  4A9F A;  5DYX A;  3JVM A;  5IGK A;  4NUC A;  5D26 A;  2R0V A;  3ONI A;  4A9H A;  4PCI A;  4UYD A;  5C4Q A;  5H1V A;  4YH3 A;  5EWC A;  4AKN A;  2MJV B;  5AMF A;  5DYA A;  5II2 A;  5BT5 A;  5A82 A;  5IGN A;  5F1L A;  2L5E A;  5E9L A;  5H1T A;  4CLB A;  2LSP B;  4QSU A;  5C8G A;  4QSV A;  2L84 A;  4NYX A;  5FE5 A;  4QSX A;  5HEL A;  5LKT A;  5CQ4 A;  4DON A;  3UV4 A;  4LDF A;  5E3G A;  4O7F A;  5A5P A;  5E9M A;  2G4A A;  2DAT A;  4XY8 A;  4NS5 A;  5CQA A;  4CUT A;  4O75 A;  4WHW A;  3P1D A;  5F61 A;  4E96 A;  5DKD A;  5HEM A;  5EIC A;  4KV4 A;  5FG5 A;  4O72 A;  5CQ6 A;  4ALH A;  4F3I A;  2NXB A;  5II1 A;  5E9K A;  4YYI A;  5F63 A;  4YYN A;  3SVH A;  3HMH A;  5F60 A;  4TU4 A;  4BHW A;  5HCL A;  4PS5 A;  4OUF A;  3UW9 A;  2RS9 B;  5FE2 A;  2RO1 A;  5FG6 A;  4MEN A;  4IR3 A;  4A9K A;  4IOO A;  5A83 A;  5HLS A;  5DYC A;  3U5M A;  2L85 A;  1ZS5 A;  4TZ2 A;  2YEK A;  5E7D A;  5IID A;  4HXR A;  5D25 A;  4UIT A;  5A85 A;  4RVR A;  2OSS A;  5CP5 A;  5DY7 A;  4CFL A;  4MR6 A;  5FE0 A;  5EVA A;  4XUA A;  4O78 A;  5FH6 A;  5E74 A;  4GPJ A;  3IU5 A;  5ACY A;  1N72 A;  5EK9 A;  5CUE A;  4HXK A;  4TQN A;  5EPB A;  5CU8 A;  4QEU A;  5LVQ A;  2F6J A;  4CFK A;  4YC9 A;  5CRZ A;  5FE3 A;  5ENC A;  5AD3 A;  5BT4 A;  4NYV A;  5FFY A;  3O34 A;  5CY9 A;  3S92 A;  4LZR A;  4YYJ A;  5F2P A;  5FE6 A;  2D82 A;  2RNY A;  4QR5 A;  2R10 A;  3UV2 A;  4QYD A;  5HRX A;  5D24 A;  5IGM A;  2FSA A;  4NR8 A;  5D3J A;  2D9E A;  4IR6 A;  4PCE A;  2I8N A;  4BJX A;  5DW1 A;  4A9M A;  4NXJ A;  4UIV A;  4HBV A;  2OO1 A;  3O37 A;  4MR4 A;  5F3A A;  5IBN A;  3MXF A;  3U5N A;  5A7C A;  5AME A;  3RCW A;  2YEM A;  4Z1S A;  4ZW1 A;  3S91 A;  5DX4 A;  5LJ0 A;  4MEQ A;  2YEL A;  5HM0 A;  5CTL A;  5JI8 A;  4YAD A;  2GRC A;  5F5Z A;  5CUA A;  4QY4 A;  5DLX A;  4QSS A;  5I89 A;  3MB4 A;  4PTB A;  2E7N A;  4O76 A;  2WP1 A;  5L97 A;  2DVV A;  3NXB A;  4QEV A;  4ZQL A;  5LUU A;  4HXN A;  4IR5 A;  4BW3 A;  4LR6 A;  5HQ6 A;  4BW2 A;  3QZT A;  5DLZ A;  3JVJ A;  4NUE A;  4QC3 A;  5FE1 A;  5I29 A;  3QZS A;  4NR7 A;  3AQA A;  5ENI A;  4O70 A;  4MEO A;  3GG3 A;  4TT4 A;  3DWY A;  4UIU A;  4QSP A;  5E9V A;  4QBM A;  4QEW A;  5A5O A;  5EA1 A;  3MB3 A;  4CUR A;  4CUP A;  5FG4 A;  3LQH A;  4Y03 A;  4YY4 A;  5KHM A;  4HBY A;  5FE4 A;  4OGI A;  4CUS A;  5A5R A;  4TT6 A;  5EWD A;  4ZC9 A;  5HFQ A;  5LKX A;  3FKM X;  3SVG A;  4MEP A;  4KCX A;  4TS8 A;  5EWH A;  4PY6 A;  4UIY A;  3LQI A;  5ENE A;  4UYG A;  3IU6 A;  4NR5 A;  3DAI A;  5AD2 A;  4YBM A;  4XUB A;  4YAT A;  5DKC A;  5ENH A;  4O74 A;  4QB3 A;  4YYH A;  4XYA A;  2RNW A;  3G0L A;  4LYI A;  5HFR A;  5FDZ A;  5ETD A;  4NRB A;  4CL9 A;  4N3W A;  5C89 A;  3O33 A;  5ENG A;  5E0R A;  4J0S A;  4YAX A;  2KTB B;  5DYU A;  4HXM A;  4QSW A;  5L8U A;  4HXP A;  4ALG A;  5EWW A;  4J0R A;  4MR5 A;  5KU3 A;  5DBM A;  4KV1 A;  4Z93 A;  5DW2 A;  3AAD A;  4QYL A;  4A9N A;  5EP7 A;  4Z6H A;  2YQD A;  3D7C A;  4IR4 A;  2YYN A;  5ENB A;  2R0Y A;  5E3D A;  4X2I A;  3U5O A;  4A9L A;  4YBS A;  4XY9 A;  4IOR A;  5COI A;  4LC2 A;  4NR4 A;  5EI4 A;  4C66 A;  5L8T A;  5F36 A;  3MUL A;  5FFV A;  4QNS A;  4LZS A;  5HRV A;  5CZG A;  4N4H A;  4WHU A;  3P1F A;  3QZV A;  4UYH A;  5C85 A;  3UVW A;  5I1Q A;  3O35 A;  4PKL A;  4YBT A;  4NUD A;  5CPE A;  4MR3 A;  5CUG A;  5EPR A;  5I83 A;  1JM4 B;  3O36 A;  2YDW A;  5I88 A;  3JVK A;  1EQF A;  5CQ8 A;  5I86 A;  5ENJ A;  5I80 A;  5I40 A;  5KTX A;  5CQ7 A;  5C87 A;  4HBX A;  2E3K A;  2R0S A;  4CUU A;  5JWM A;  2OUO A;  5L99 A;  3UVX A;  5D3L A;  4YYK A;  4BW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...