3D7CA

Crystal structure of the bromodomain of human gcn5, the general control of amino-acid synthesis protein 5-like 2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
MEDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords General control of amino acid synthesis protein 5-like 2
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3d7cA00
4Q0OA 5EWDA 4WIVA 5FG4A 4UIWA 5I80A 5ENBA 2NXBA 5KHMA 4YYHA 4LYWA 5DBMA 4NQMA 4YBTA 4BHWA 4CUQA 5DKCA 5EM3A 4NUCA 5C4QA 4BW4A 3O36A 4YH4A 4YATA 5DY7A 5E9LA 2OUOA 4O7AA 4LC2A 4NR6A 5A5SA 5D3LA 4CFKA 4NXJA 4QYLA 4NR7A 4TZ2A 5FDZA 4IR4A 4YBSA 4IOOA 3RCWA 4NQNA 3O34A 4HXLA 5F60A 5LVRA 5C89A 4TQNA 5E3DA 4A9OA 4MR6A 5F3AA 1N72A 3LJWA 4C66A 4O7EA 4NYWA 5FFYA 5E9YA 5H1VA 4LYIA 4ALHA 5CRZA 4XY8A 4XUAA 5EQ1A 4IR5A 4X2IA 4BW3A 3O35A 3MQMA 5EPRA 4KV1A 5CUDA 4YAXA 5FE4A 4A9IA 5AMFA 4QUUA 5H1TA 4QEUA 5FE0A 3P5OA 4MR4A 4UYEA 5E3GA 3Q2EA 5HFRA 5LJ0A 4QBMA 5J0DA 4Q0NA 4YC9A 4LRGA 4LR6A 4LYSA 4N3WA 5DYCA 5D3HA 5HQ6A 3UW9A 4YY4A 5I29A 4HXOA 4UYDA 5ENCA 5LJ1A 1X0JA 3MB3A 3HMHA 5D3JA 5I40A 5FFVA 4YYGA 5ENEA 4C67A 5D0CA 5DFCA 5A83A 2R0SA 5F62A 5H85A 4LZ2A 5BT5A 3JVLA 2R0YA 5CUAA 4QR3A 2E3KA 3Q2FA 5EWVA 5A5OA 5D3RA 4J0SA 5KU3A 4IR6A 2DVQA 2E7NA 3FKMX 5A5QA 4PKLA 2D82A 3QZVA 4QY4A 5E9IA 5II2A 4O7CA 4O7FA 5ENHA 3K2JA 3TLPA 4MENA 5LUUA 4F3IA 5ENJA 5FG6A 5L8UA 1F68A 4YYNA 2YQDA 4UYGA 4QC3A 5D3PA 5D3TA 5I7XA 4NYXA 4QSPA 5F1HA 3LQIA 5DLZA 4QNSA 5ETDA 5IGNA 5EWWA 3JVJA 4YY6A 2WP2A 4YABA 5EA1A 4UIXA 5LKTA 2RNYA 5F63A 2I8NA 3U5NA 5DYXA 5EISA 4BJXA 5KTXA 4ZQLA 5CUGA 3NXBA 5DW1A 5D3SA 5LJ2A 4LZRA 5D7XA 4UITA 4OUFA 4BW1A 4O70A 4NUDA 2YDWA 5L97A 4Z1SA 5F36A 5ENIA 4YADA 5EGUA 5KTWA 5FE9A 4IOQA 5CUCA 3D7CA 5FG5A 4MEOA 5CQ7A 2YELA 5AD2A 5C85A 4TTEA 4YBMA 3UV5A 2YW5A 4MR5A 3SVGA 3S91A 5HQ5A 3UVWA 5DLXA 5HEMA 3LQJA 4J3IA 5HFQA 5FE6A 4O77A 5HM0A 2R10A 4Z6IA 2F6JA 4Z93A 5TB6A 5L96A 5I1QA 5EWHA 2KTBB 5ACYA 5HELA 5A7CA 4YH3A 5DKDA 4CURA 4PTBA 5E9VA 5CFWA 4HBVA 2RS9B 2DVVA 5ENGA 4TYLA 4QSSA 5TCMA 5LKXA 5HENA 2F6NA 5FE3A 4DONA 4WHUA 1JSPB 4IORA 3SVHA 3UV4A 4CUSA 5CQ3A 3IU5A 3U5KA 5BT4A 2FSAA 3MUKA 4O71A 3JVKA 4PCEA 5CZGA 4GPJA 2DWWA 5KTUA 5E7DA 5I89A 1WUGA 4MEQA 5EK9A 4KV4A 2I7KA 5EVAA 5CPEA 5CQ4A 2DATA 4PS5A 4UIUA 5EWCA 4HXRA 4N4IA 5F1LA 5FE8A 3U5JA 3U5MA 4NUEA 5CQ6A 4UYFA 4N4GA 5AMEA 4QSQA 5A85A 5CUBA 3P1FA 5CUEA 5I83A 2WP1A 2RI7A 5AD3A 4QEVA 4NS5A 4XYAA 5L99A 2L84A 4CFLA 5BT3A 1ZS5A 5E9KA 4TT2A 5G4SA 4MR3A 5CQ5A 5EI4A 4OGIA 4RVRA 4QSVA 4ALGA 4ZC9A 3G0JA 4IR3A 5HRVA 5HRXA 4O78A 5IGMA 3IU6A 4HXSA 5JI8A 5COIA 2L85A 4HXNA 3UVDA 2DVRA 3AADA 2N9GA 3O33A 4UIZA 5EICA 4J1PA 5LKZA 4QR5A 5I86A 2RO1A 5CQAA 5F25A 5ENFA 1WUMA 5CY9A 4NYVA 5L98A 4FLPA 5E74A 4A9JA 2H60A 2YEMA 4UYFB 4QC1A 5F61A 5G4RA 3DAIA 3U5LA 4NR4A 4QSXA 3G0LA 3P1EA 4YK0A 5H1UA 4UIYA 4O7BA 4Y03A 4BW2A 5E9MA 3MULA 4UIVA 5CS8A 2G4AA 5FE5A 4O72A 3ONIA 4NR5A 5CP5A 4A9KA 4N4FA 2OO1A 3HMEA 5D25A 5HCLA 4QEWA 5DYUA 2LSPB 4LDFA 5II1A 3UV2A 2DVSA 4O75A 4Z1QA 4NRBA 4TS8A 5FE1A 2OSSA 5KO4A 5FFWA 5FE2A 5A5PA 4PCIA 5IGKA 5I88A 4NR8A 3LXJA 4QSTA 5CQTA 5HJCA 5CU8A 2RFJA 4WHWA 5ETBA 2GRCA 5IIDA 4HXKA 3S92A 3UVYA 5EPSA 4CUUA 3HMFA 5D24A 4UYHA 2L5EA 4NRAA 5EPBA 5E73A 5LKUA 5HLSA 4YYJA 5F5ZA 1JM4B 3UVXA 4E96A 5DFBA 3GG3A 4LZSA 4N4HA 5HQ7A 5IG6A 2D9EA 5F2PA 4QB3A 3AQAA 5DYAA 5C8GA 5DX4A 4ZW1A 5A82A 2MJVB 4A9EA 4QSUA 5FE7A 4J0RA 5E0RA 3DWYA 4A9MA 4XUBA 4QZSA 3MXFA 5D26A 5CGPA 5DKHA 4QSRA 5EV9A 5HRWA 5CRMA 4HBXA 4HXPA 4CUTA 5FH7A 5C87A 4YYDA 5D3NA 4YYIA 2R0VA 4A9LA 5EU1A 3P1DA 5FB0A 3O37A 4CLBA 4TT6A 4KCXA 3U5PA 5FH8A 4Z6HA 2DKWA 4HBWA 5JWMA 4O74A 4A9NA 2RNWA 3LQHA 4HBYA 5LVQA 4CUPA 4QUTA 5I7YA 5CQ8A 4MEPA 4XY9A 5C7NA 2E7OA 4A9FA 4TU4A 4A9HA 3QZSA 5DFDA 2RNXA 5DW2A 3MB4A 3ZYUA 5IGLA 5FH6A 5K29A 4NRCA 4YYKA 5A5RA 5FBXA 4TU6A 5EP7A 4O76A 5L8TA 1E6IA 4QYDA 5IBNA 3P1CA 4TZ8A 3U5OA 4OGJA 4HXMA 4QSWA 4CL9A 3QZTA 4NR9A 5CTLA 4YYMA 3JVMA 4AKNA 3SVFA 5A5NA 3I3JA 4PY6A 4QR4A 4TT4A 1EQFA 5FB1A 5A81A 2YYNA 2YEKA
chains in the Genus database with same CATH superfamily
4Q0OA 5EWDA 4WIVA 5FG4A 4UIWA 5I80A 5ENBA 2NXBA 5KHMA 4YYHA 3D1BA 4LYWA 5DBMA 4NQMA 4YBTA 4BHWA 4CUQA 3D1DA 5DKCA 5EM3A 4NUCA 5C4QA 4BW4A 3O36A 4YH4A 4YATA 5DY7A 5E9LA 2OUOA 4O7AA 4AKHA 4LC2A 4NR6A 5A5SA 5D3LA 4CFKA 4NXJA 4QYLA 4NR7A 4TZ2A 5FDZA 4IR4A 4YBSA 4IOOA 3RCWA 4NQNA 3O34A 4HXLA 5F60A 5LVRA 5C89A 4TQNA 5E3DA 4A9OA 4MR6A 5F3AA 1N72A 3LJWA 4AI6A 4C66A 4O7EA 4NYWA 5FFYA 5E9YA 5H1VA 4LYIA 4ALHA 5CRZA 4XY8A 4XUAA 5EQ1A 4IR5A 4X2IA 4BW3A 3O35A 3MQMA 5EPRA 4KV1A 5CUDA 4YAXA 5FE4A 4A9IA 5AMFA 4AKGA 4QUUA 5H1TA 4QEUA 5FE0A 3P5OA 4MR4A 4UYEA 5E3GA 3Q2EA 5HFRA 5LJ0A 4QBMA 5J0DA 4Q0NA 4YC9A 4LRGA 4LR6A 4LYSA 4N3WA 5DYCA 5D3HA 1PUOA 5HQ6A 3UW9A 4YY4A 5I29A 4HXOA 4UYDA 5ENCA 5LJ1A 1X0JA 3MB3A 3HMHA 5D3JA 5I40A 5FFVA 4YYGA 5ENEA 4C67A 5D0CA 5DFCA 5A83A 2R0SA 5F62A 5H85A 4LZ2A 5BT5A 3JVLA 2R0YA 5CUAA 4QR3A 2E3KA 3Q2FA 5EWVA 1ZKRA 5A5OA 5D3RA 4J0SA 5KU3A 4IR6A 2DVQA 2E7NA 3FKMX 5A5QA 4PKLA 3VKGA 2D82A 3QZVA 4QY4A 5E9IA 5II2A 4O7CA 4O7FA 5ENHA 3K2JA 3TLPA 4MENA 5LUUA 4F3IA 5ENJA 5FG6A 5L8UA 1F68A 4YYNA 2YQDA 4UYGA 4QC3A 5D3PA 5D3TA 5I7XA 4NYXA 4QSPA 5F1HA 3LQIA 5DLZA 4QNSA 5ETDA 5IGNA 5EWWA 3JVJA 4YY6A 2WP2A 4YABA 5EA1A 4UIXA 5LKTA 2RNYA 5F63A 2I8NA 3U5NA 5DYXA 5EISA 4BJXA 5KTXA 4ZQLA 5CUGA 3NXBA 5DW1A 5D3SA 5LJ2A 4LZRA 5D7XA 4UITA 4OUFA 4BW1A 4O70A 4NUDA 2YDWA 5L97A 4Z1SA 5F36A 5ENIA 4YADA 5EGUA 5KTWA 5FE9A 4IOQA 5CUCA 3D7CA 5FG5A 4MEOA 5CQ7A 2YELA 5AD2A 5C85A 4TTEA 4YBMA 3UV5A 2YW5A 4MR5A 3SVGA 3S91A 5HQ5A 3UVWA 5DLXA 5HEMA 3LQJA 4J3IA 5HFQA 5FE6A 4O77A 5HM0A 2R10A 4Z6IA 2F6JA 4Z93A 5TB6A 5L96A 5I1QA 5EWHA 2KTBB 5ACYA 5HELA 5A7CA 4YH3A 5DKDA 4CURA 4PTBA 5E9VA 5CFWA 4HBVA 2RS9B 2DVVA 5ENGA 4TYLA 4QSSA 5TCMA 5LKXA 5HENA 2F6NA 5FE3A 4DONA 4WHUA 1JSPB 4IORA 3SVHA 3UV4A 4CUSA 5CQ3A 3IU5A 3U5KA 5BT4A 2FSAA 3MUKA 4O71A 3JVKA 4PCEA 5CZGA 4GPJA 2DWWA 5KTUA 5E7DA 5I89A 1WUGA 4MEQA 5EK9A 4KV4A 2I7KA 5EVAA 5CPEA 5CQ4A 2DATA 4PS5A 4UIUA 5EWCA 4HXRA 4N4IA 5F1LA 5FE8A 3U5JA 3U5MA 4NUEA 5CQ6A 4UYFA 4N4GA 5AMEA 4QSQA 5A85A 5CUBA 3P1FA 5CUEA 5I83A 2WP1A 2RI7A 5AD3A 4QEVA 4NS5A 4XYAA 5L99A 2L84A 4CFLA 5BT3A 1ZS5A 5E9KA 4TT2A 5G4SA 4MR3A 5CQ5A 5EI4A 4OGIA 4RVRA 4QSVA 4ALGA 4ZC9A 3G0JA 4IR3A 5HRVA 5HRXA 4O78A 5IGMA 3IU6A 4HXSA 5JI8A 5COIA 2L85A 4HXNA 3UVDA 2DVRA 3AADA 2N9GA 3O33A 3ERRA 4UIZA 5EICA 4J1PA 5LKZA 4QR5A 5I86A 2RO1A 5CQAA 5F25A 5ENFA 1WUMA 5CY9A 4NYVA 5L98A 4FLPA 5E74A 4A9JA 2H60A 2YEMA 4UYFB 4QC1A 5F61A 5G4RA 3DAIA 3U5LA 4NR4A 4QSXA 3G0LA 3P1EA 4YK0A 5H1UA 4UIYA 4O7BA 4Y03A 4BW2A 5E9MA 3MULA 4UIVA 5CS8A 2G4AA 5FE5A 4O72A 3ONIA 4NR5A 5CP5A 4A9KA 4N4FA 2OO1A 3HMEA 5D25A 5HCLA 4QEWA 5DYUA 2LSPB 4LDFA 5II1A 3UV2A 2DVSA 4O75A 4Z1QA 4NRBA 4TS8A 5FE1A 2OSSA 5KO4A 5FFWA 5FE2A 5A5PA 4PCIA 5IGKA 5I88A 4NR8A 3LXJA 4QSTA 5CQTA 5HJCA 5CU8A 2RFJA 4WHWA 5ETBA 2GRCA 5IIDA 4HXKA 3S92A 3UVYA 2EJNA 5EPSA 4CUUA 3HMFA 5D24A 4UYHA 2L5EA 4NRAA 5EPBA 5E73A 5LKUA 5HLSA 4YYJA 5F5ZA 1JM4B 3UVXA 4E96A 5DFBA 3GG3A 4LZSA 4N4HA 5HQ7A 5IG6A 2D9EA 5F2PA 4QB3A 3AQAA 5DYAA 5C8GA 5DX4A 4ZW1A 5A82A 2MJVB 4A9EA 4QSUA 5FE7A 4J0RA 5E0RA 3DWYA 4A9MA 4XUBA 4QZSA 3MXFA 5D26A 5CGPA 5DKHA 4QSRA 5EV9A 5HRWA 5CRMA 4HBXA 4HXPA 4CUTA 5FH7A 5C87A 4YYDA 5D3NA 4YYIA 2R0VA 4A9LA 5EU1A 3P1DA 5FB0A 3O37A 4CLBA 3VKHA 4TT6A 4KCXA 3U5PA 5FH8A 4Z6HA 2DKWA 4HBWA 5JWMA 4O74A 4A9NA 2RNWA 3LQHA 4HBYA 5LVQA 4CUPA 4QUTA 5I7YA 4AKIA 5CQ8A 4MEPA 4XY9A 5C7NA 2E7OA 4A9FA 4TU4A 4A9HA 3QZSA 5DFDA 2RNXA 5DW2A 3MB4A 3ZYUA 5IGLA 5FH6A 5K29A 4NRCA 4YYKA 5A5RA 5FBXA 4TU6A 5EP7A 4O76A 5L8TA 1E6IA 4QYDA 5IBNA 3P1CA 4TZ8A 3U5OA 4OGJA 4HXMA 4QSWA 4CL9A 3QZTA 4NR9A 5CTLA 4YYMA 3JVMA 4AKNA 3SVFA 5A5NA 3I3JA 4PY6A 4QR4A 4TT4A 1EQFA 5FB1A 5A81A 2YYNA 2YEKA
chains in the Genus database with same CATH topology
4Q0OA 5EWDA 4WIVA 5FG4A 4UIWA 5I80A 5ENBA 2NXBA 5KHMA 4YYHA 4LYWA 5DBMA 4NQMA 4YBTA 4BHWA 4CUQA 5DKCA 5EM3A 4NUCA 5C4QA 4BW4A 3O36A 4YH4A 4YATA 5DY7A 5E9LA 2OUOA 4O7AA 4LC2A 4NR6A 5A5SA 5D3LA 4CFKA 4NXJA 4QYLA 4NR7A 4TZ2A 5FDZA 4IR4A 4YBSA 4IOOA 3RCWA 4NQNA 3O34A 4HXLA 5F60A 5LVRA 5C89A 4TQNA 5E3DA 4A9OA 4MR6A 5F3AA 1N72A 3LJWA 4C66A 4O7EA 4NYWA 5FFYA 5E9YA 5H1VA 4LYIA 4ALHA 5CRZA 4XY8A 4XUAA 5EQ1A 4IR5A 4X2IA 4BW3A 3O35A 3MQMA 5EPRA 4KV1A 5CUDA 4YAXA 5FE4A 4A9IA 5AMFA 4QUUA 5H1TA 4QEUA 5FE0A 3P5OA 4MR4A 4UYEA 5E3GA 3Q2EA 5HFRA 5LJ0A 4QBMA 5J0DA 4Q0NA 4YC9A 4LRGA 4LR6A 4LYSA 4N3WA 5DYCA 5D3HA 5HQ6A 3UW9A 4YY4A 5I29A 4HXOA 4UYDA 5ENCA 5LJ1A 1X0JA 3MB3A 3HMHA 5D3JA 5I40A 5FFVA 4YYGA 5ENEA 4C67A 5D0CA 5DFCA 5A83A 2R0SA 5F62A 5H85A 4LZ2A 5BT5A 3JVLA 2R0YA 5CUAA 4QR3A 2E3KA 3Q2FA 5EWVA 5A5OA 5D3RA 4J0SA 5KU3A 4IR6A 2DVQA 2E7NA 3FKMX 5A5QA 4PKLA 2D82A 3QZVA 4QY4A 5E9IA 5II2A 4O7CA 4O7FA 5ENHA 3K2JA 3TLPA 4MENA 5LUUA 4F3IA 5ENJA 5FG6A 5L8UA 1F68A 4YYNA 2YQDA 4UYGA 4QC3A 5D3PA 5D3TA 5I7XA 4NYXA 4QSPA 5F1HA 3LQIA 5DLZA 4QNSA 5ETDA 5IGNA 5EWWA 3JVJA 4YY6A 2WP2A 4YABA 5EA1A 4UIXA 5LKTA 2RNYA 5F63A 2I8NA 3U5NA 5DYXA 5EISA 4BJXA 5KTXA 4ZQLA 5CUGA 3NXBA 5DW1A 5D3SA 5LJ2A 4LZRA 5D7XA 4UITA 4OUFA 4BW1A 4O70A 4NUDA 2YDWA 5L97A 4Z1SA 5F36A 5ENIA 4YADA 5EGUA 5KTWA 5FE9A 4IOQA 5CUCA 3D7CA 5FG5A 4MEOA 5CQ7A 2YELA 5AD2A 5C85A 4TTEA 4YBMA 3UV5A 2YW5A 4MR5A 3SVGA 3S91A 5HQ5A 3UVWA 5DLXA 5HEMA 3LQJA 4J3IA 5HFQA 5FE6A 4O77A 5HM0A 2R10A 4Z6IA 2F6JA 4Z93A 5TB6A 5L96A 5I1QA 5EWHA 2KTBB 5ACYA 5HELA 5A7CA 4YH3A 5DKDA 4CURA 4PTBA 5E9VA 5CFWA 4HBVA 2RS9B 2DVVA 5ENGA 4TYLA 4QSSA 5TCMA 5LKXA 5HENA 2F6NA 5FE3A 4DONA 4WHUA 1JSPB 4IORA 3SVHA 3UV4A 4CUSA 5CQ3A 3IU5A 3U5KA 5BT4A 2FSAA 3MUKA 4O71A 3JVKA 4PCEA 5CZGA 4GPJA 2DWWA 5KTUA 5E7DA 5I89A 1WUGA 4MEQA 5EK9A 4KV4A 2I7KA 5EVAA 5CPEA 5CQ4A 2DATA 4PS5A 4UIUA 5EWCA 4HXRA 4N4IA 5F1LA 5FE8A 3U5JA 3U5MA 4NUEA 5CQ6A 4UYFA 4N4GA 5AMEA 4QSQA 5A85A 5CUBA 3P1FA 5CUEA 5I83A 2WP1A 2RI7A 5AD3A 4QEVA 4NS5A 4XYAA 5L99A 2L84A 4CFLA 5BT3A 1ZS5A 5E9KA 4TT2A 5G4SA 4MR3A 5CQ5A 5EI4A 4OGIA 4RVRA 4QSVA 4ALGA 4ZC9A 3G0JA 4IR3A 5HRVA 5HRXA 4O78A 5IGMA 3IU6A 4HXSA 5JI8A 5COIA 2L85A 4HXNA 3UVDA 2DVRA 3AADA 2N9GA 3O33A 4UIZA 5EICA 4J1PA 5LKZA 4QR5A 5I86A 2RO1A 5CQAA 5F25A 5ENFA 1WUMA 5CY9A 4NYVA 5L98A 4FLPA 5E74A 4A9JA 2H60A 2YEMA 4UYFB 4QC1A 5F61A 5G4RA 3DAIA 3U5LA 4NR4A 4QSXA 3G0LA 3P1EA 4YK0A 5H1UA 4UIYA 4O7BA 4Y03A 4BW2A 5E9MA 3MULA 4UIVA 5CS8A 2G4AA 5FE5A 4O72A 3ONIA 4NR5A 5CP5A 4A9KA 4N4FA 2OO1A 3HMEA 5D25A 5HCLA 4QEWA 5DYUA 2LSPB 4LDFA 5II1A 3UV2A 2DVSA 4O75A 4Z1QA 4NRBA 4TS8A 5FE1A 2OSSA 5KO4A 5FFWA 5FE2A 5A5PA 4PCIA 5IGKA 5I88A 4NR8A 3LXJA 4QSTA 5CQTA 5HJCA 5CU8A 2RFJA 4WHWA 5ETBA 2GRCA 5IIDA 4HXKA 3S92A 3UVYA 5EPSA 4CUUA 3HMFA 5D24A 4UYHA 2L5EA 4NRAA 5EPBA 5E73A 5LKUA 5HLSA 4YYJA 5F5ZA 1JM4B 3UVXA 4E96A 5DFBA 3GG3A 4LZSA 4N4HA 5HQ7A 5IG6A 2D9EA 5F2PA 4QB3A 3AQAA 5DYAA 5C8GA 5DX4A 4ZW1A 5A82A 2MJVB 4A9EA 4QSUA 5FE7A 4J0RA 5E0RA 3DWYA 4A9MA 4XUBA 4QZSA 3MXFA 5D26A 5CGPA 5DKHA 4QSRA 5EV9A 5HRWA 5CRMA 4HBXA 4HXPA 4CUTA 5FH7A 5C87A 4YYDA 5D3NA 4YYIA 2R0VA 4A9LA 5EU1A 3P1DA 5FB0A 3O37A 4CLBA 4TT6A 4KCXA 3U5PA 5FH8A 4Z6HA 2DKWA 4HBWA 5JWMA 4O74A 4A9NA 2RNWA 3LQHA 4HBYA 5LVQA 4CUPA 4QUTA 5I7YA 5CQ8A 4MEPA 4XY9A 5C7NA 2E7OA 4A9FA 4TU4A 4A9HA 3QZSA 5DFDA 2RNXA 5DW2A 3MB4A 3ZYUA 5IGLA 5FH6A 5K29A 4NRCA 4YYKA 5A5RA 5FBXA 4TU6A 5EP7A 4O76A 5L8TA 1E6IA 4QYDA 5IBNA 3P1CA 4TZ8A 3U5OA 4OGJA 4HXMA 4QSWA 4CL9A 3QZTA 4NR9A 5CTLA 4YYMA 3JVMA 4AKNA 3SVFA 5A5NA 3I3JA 4PY6A 4QR4A 4TT4A 1EQFA 5FB1A 5A81A 2YYNA 2YEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q0O A;  5EWD A;  4WIV A;  5FG4 A;  4UIW A;  5I80 A;  5ENB A;  2NXB A;  5KHM A;  4YYH A;  4LYW A;  5DBM A;  4NQM A;  4YBT A;  4BHW A;  4CUQ A;  5DKC A;  5EM3 A;  4NUC A;  5C4Q A;  4BW4 A;  3O36 A;  4YH4 A;  4YAT A;  5DY7 A;  5E9L A;  2OUO A;  4O7A A;  4LC2 A;  4NR6 A;  5A5S A;  5D3L A;  4CFK A;  4NXJ A;  4QYL A;  4NR7 A;  4TZ2 A;  5FDZ A;  4IR4 A;  4YBS A;  4IOO A;  3RCW A;  4NQN A;  3O34 A;  4HXL A;  5F60 A;  5LVR A;  5C89 A;  4TQN A;  5E3D A;  4A9O A;  4MR6 A;  5F3A A;  1N72 A;  3LJW A;  4C66 A;  4O7E A;  4NYW A;  5FFY A;  5E9Y A;  5H1V A;  4LYI A;  4ALH A;  5CRZ A;  4XY8 A;  4XUA A;  5EQ1 A;  4IR5 A;  4X2I A;  4BW3 A;  3O35 A;  3MQM A;  5EPR A;  4KV1 A;  5CUD A;  4YAX A;  5FE4 A;  4A9I A;  5AMF A;  4QUU A;  5H1T A;  4QEU A;  5FE0 A;  3P5O A;  4MR4 A;  4UYE A;  5E3G A;  3Q2E A;  5HFR A;  5LJ0 A;  4QBM A;  5J0D A;  4Q0N A;  4YC9 A;  4LRG A;  4LR6 A;  4LYS A;  4N3W A;  5DYC A;  5D3H A;  5HQ6 A;  3UW9 A;  4YY4 A;  5I29 A;  4HXO A;  4UYD A;  5ENC A;  5LJ1 A;  1X0J A;  3MB3 A;  3HMH A;  5D3J A;  5I40 A;  5FFV A;  4YYG A;  5ENE A;  4C67 A;  5D0C A;  5DFC A;  5A83 A;  2R0S A;  5F62 A;  5H85 A;  4LZ2 A;  5BT5 A;  3JVL A;  2R0Y A;  5CUA A;  4QR3 A;  2E3K A;  3Q2F A;  5EWV A;  5A5O A;  5D3R A;  4J0S A;  5KU3 A;  4IR6 A;  2DVQ A;  2E7N A;  3FKM X;  5A5Q A;  4PKL A;  2D82 A;  3QZV A;  4QY4 A;  5E9I A;  5II2 A;  4O7C A;  4O7F A;  5ENH A;  3K2J A;  3TLP A;  4MEN A;  5LUU A;  4F3I A;  5ENJ A;  5FG6 A;  5L8U A;  1F68 A;  4YYN A;  2YQD A;  4UYG A;  4QC3 A;  5D3P A;  5D3T A;  5I7X A;  4NYX A;  4QSP A;  5F1H A;  3LQI A;  5DLZ A;  4QNS A;  5ETD A;  5IGN A;  5EWW A;  3JVJ A;  4YY6 A;  2WP2 A;  4YAB A;  5EA1 A;  4UIX A;  5LKT A;  2RNY A;  5F63 A;  2I8N A;  3U5N A;  5DYX A;  5EIS A;  4BJX A;  5KTX A;  4ZQL A;  5CUG A;  3NXB A;  5DW1 A;  5D3S A;  5LJ2 A;  4LZR A;  5D7X A;  4UIT A;  4OUF A;  4BW1 A;  4O70 A;  4NUD A;  2YDW A;  5L97 A;  4Z1S A;  5F36 A;  5ENI A;  4YAD A;  5EGU A;  5KTW A;  5FE9 A;  4IOQ A;  5CUC A;  3D7C A;  5FG5 A;  4MEO A;  5CQ7 A;  2YEL A;  5AD2 A;  5C85 A;  4TTE A;  4YBM A;  3UV5 A;  2YW5 A;  4MR5 A;  3SVG A;  3S91 A;  5HQ5 A;  3UVW A;  5DLX A;  5HEM A;  3LQJ A;  4J3I A;  5HFQ A;  5FE6 A;  4O77 A;  5HM0 A;  2R10 A;  4Z6I A;  2F6J A;  4Z93 A;  5TB6 A;  5L96 A;  5I1Q A;  5EWH A;  2KTB B;  5ACY A;  5HEL A;  5A7C A;  4YH3 A;  5DKD A;  4CUR A;  4PTB A;  5E9V A;  5CFW A;  4HBV A;  2RS9 B;  2DVV A;  5ENG A;  4TYL A;  4QSS A;  5TCM A;  5LKX A;  5HEN A;  2F6N A;  5FE3 A;  4DON A;  4WHU A;  1JSP B;  4IOR A;  3SVH A;  3UV4 A;  4CUS A;  5CQ3 A;  3IU5 A;  3U5K A;  5BT4 A;  2FSA A;  3MUK A;  4O71 A;  3JVK A;  4PCE A;  5CZG A;  4GPJ A;  2DWW A;  5KTU A;  5E7D A;  5I89 A;  1WUG A;  4MEQ A;  5EK9 A;  4KV4 A;  2I7K A;  5EVA A;  5CPE A;  5CQ4 A;  2DAT A;  4PS5 A;  4UIU A;  5EWC A;  4HXR A;  4N4I A;  5F1L A;  5FE8 A;  3U5J A;  3U5M A;  4NUE A;  5CQ6 A;  4UYF A;  4N4G A;  5AME A;  4QSQ A;  5A85 A;  5CUB A;  3P1F A;  5CUE A;  5I83 A;  2WP1 A;  2RI7 A;  5AD3 A;  4QEV A;  4NS5 A;  4XYA A;  5L99 A;  2L84 A;  4CFL A;  5BT3 A;  1ZS5 A;  5E9K A;  4TT2 A;  5G4S A;  4MR3 A;  5CQ5 A;  5EI4 A;  4OGI A;  4RVR A;  4QSV A;  4ALG A;  4ZC9 A;  3G0J A;  4IR3 A;  5HRV A;  5HRX A;  4O78 A;  5IGM A;  3IU6 A;  4HXS A;  5JI8 A;  5COI A;  2L85 A;  4HXN A;  3UVD A;  2DVR A;  3AAD A;  2N9G A;  3O33 A;  4UIZ A;  5EIC A;  4J1P A;  5LKZ A;  4QR5 A;  5I86 A;  2RO1 A;  5CQA A;  5F25 A;  5ENF A;  1WUM A;  5CY9 A;  4NYV A;  5L98 A;  4FLP A;  5E74 A;  4A9J A;  2H60 A;  2YEM A;  4UYF B;  4QC1 A;  5F61 A;  5G4R A;  3DAI A;  3U5L A;  4NR4 A;  4QSX A;  3G0L A;  3P1E A;  4YK0 A;  5H1U A;  4UIY A;  4O7B A;  4Y03 A;  4BW2 A;  5E9M A;  3MUL A;  4UIV A;  5CS8 A;  2G4A A;  5FE5 A;  4O72 A;  3ONI A;  4NR5 A;  5CP5 A;  4A9K A;  4N4F A;  2OO1 A;  3HME A;  5D25 A;  5HCL A;  4QEW A;  5DYU A;  2LSP B;  4LDF A;  5II1 A;  3UV2 A;  2DVS A;  4O75 A;  4Z1Q A;  4NRB A;  4TS8 A;  5FE1 A;  2OSS A;  5KO4 A;  5FFW A;  5FE2 A;  5A5P A;  4PCI A;  5IGK A;  5I88 A;  4NR8 A;  3LXJ A;  4QST A;  5CQT A;  5HJC A;  5CU8 A;  2RFJ A;  4WHW A;  5ETB A;  2GRC A;  5IID A;  4HXK A;  3S92 A;  3UVY A;  5EPS A;  4CUU A;  3HMF A;  5D24 A;  4UYH A;  2L5E A;  4NRA A;  5EPB A;  5E73 A;  5LKU A;  5HLS A;  4YYJ A;  5F5Z A;  1JM4 B;  3UVX A;  4E96 A;  5DFB A;  3GG3 A;  4LZS A;  4N4H A;  5HQ7 A;  5IG6 A;  2D9E A;  5F2P A;  4QB3 A;  3AQA A;  5DYA A;  5C8G A;  5DX4 A;  4ZW1 A;  5A82 A;  2MJV B;  4A9E A;  4QSU A;  5FE7 A;  4J0R A;  5E0R A;  3DWY A;  4A9M A;  4XUB A;  4QZS A;  3MXF A;  5D26 A;  5CGP A;  5DKH A;  4QSR A;  5EV9 A;  5HRW A;  5CRM A;  4HBX A;  4HXP A;  4CUT A;  5FH7 A;  5C87 A;  4YYD A;  5D3N A;  4YYI A;  2R0V A;  4A9L A;  5EU1 A;  3P1D A;  5FB0 A;  3O37 A;  4CLB A;  4TT6 A;  4KCX A;  3U5P A;  5FH8 A;  4Z6H A;  2DKW A;  4HBW A;  5JWM A;  4O74 A;  4A9N A;  2RNW A;  3LQH A;  4HBY A;  5LVQ A;  4CUP A;  4QUT A;  5I7Y A;  5CQ8 A;  4MEP A;  4XY9 A;  5C7N A;  2E7O A;  4A9F A;  4TU4 A;  4A9H A;  3QZS A;  5DFD A;  2RNX A;  5DW2 A;  3MB4 A;  3ZYU A;  5IGL A;  5FH6 A;  5K29 A;  4NRC A;  4YYK A;  5A5R A;  5FBX A;  4TU6 A;  5EP7 A;  4O76 A;  5L8T A;  1E6I A;  4QYD A;  5IBN A;  3P1C A;  4TZ8 A;  3U5O A;  4OGJ A;  4HXM A;  4QSW A;  4CL9 A;  3QZT A;  4NR9 A;  5CTL A;  4YYM A;  3JVM A;  4AKN A;  3SVF A;  5A5N A;  3I3J A;  4PY6 A;  4QR4 A;  4TT4 A;  1EQF A;  5FB1 A;  5A81 A;  2YYN A;  2YEK A; 
#chains in the Genus database with same CATH topology
 4Q0O A;  5EWD A;  4WIV A;  5FG4 A;  4UIW A;  5I80 A;  5ENB A;  2NXB A;  5KHM A;  4YYH A;  3D1B A;  4LYW A;  5DBM A;  4NQM A;  4YBT A;  4BHW A;  4CUQ A;  3D1D A;  5DKC A;  5EM3 A;  4NUC A;  5C4Q A;  4BW4 A;  3O36 A;  4YH4 A;  4YAT A;  5DY7 A;  5E9L A;  2OUO A;  4O7A A;  4AKH A;  4LC2 A;  4NR6 A;  5A5S A;  5D3L A;  4CFK A;  4NXJ A;  4QYL A;  4NR7 A;  4TZ2 A;  5FDZ A;  4IR4 A;  4YBS A;  4IOO A;  3RCW A;  4NQN A;  3O34 A;  4HXL A;  5F60 A;  5LVR A;  5C89 A;  4TQN A;  5E3D A;  4A9O A;  4MR6 A;  5F3A A;  1N72 A;  3LJW A;  4AI6 A;  4C66 A;  4O7E A;  4NYW A;  5FFY A;  5E9Y A;  5H1V A;  4LYI A;  4ALH A;  5CRZ A;  4XY8 A;  4XUA A;  5EQ1 A;  4IR5 A;  4X2I A;  4BW3 A;  3O35 A;  3MQM A;  5EPR A;  4KV1 A;  5CUD A;  4YAX A;  5FE4 A;  4A9I A;  5AMF A;  4AKG A;  4QUU A;  5H1T A;  4QEU A;  5FE0 A;  3P5O A;  4MR4 A;  4UYE A;  5E3G A;  3Q2E A;  5HFR A;  5LJ0 A;  4QBM A;  5J0D A;  4Q0N A;  4YC9 A;  4LRG A;  4LR6 A;  4LYS A;  4N3W A;  5DYC A;  5D3H A;  1PUO A;  5HQ6 A;  3UW9 A;  4YY4 A;  5I29 A;  4HXO A;  4UYD A;  5ENC A;  5LJ1 A;  1X0J A;  3MB3 A;  3HMH A;  5D3J A;  5I40 A;  5FFV A;  4YYG A;  5ENE A;  4C67 A;  5D0C A;  5DFC A;  5A83 A;  2R0S A;  5F62 A;  5H85 A;  4LZ2 A;  5BT5 A;  3JVL A;  2R0Y A;  5CUA A;  4QR3 A;  2E3K A;  3Q2F A;  5EWV A;  1ZKR A;  5A5O A;  5D3R A;  4J0S A;  5KU3 A;  4IR6 A;  2DVQ A;  2E7N A;  3FKM X;  5A5Q A;  4PKL A;  3VKG A;  2D82 A;  3QZV A;  4QY4 A;  5E9I A;  5II2 A;  4O7C A;  4O7F A;  5ENH A;  3K2J A;  3TLP A;  4MEN A;  5LUU A;  4F3I A;  5ENJ A;  5FG6 A;  5L8U A;  1F68 A;  4YYN A;  2YQD A;  4UYG A;  4QC3 A;  5D3P A;  5D3T A;  5I7X A;  4NYX A;  4QSP A;  5F1H A;  3LQI A;  5DLZ A;  4QNS A;  5ETD A;  5IGN A;  5EWW A;  3JVJ A;  4YY6 A;  2WP2 A;  4YAB A;  5EA1 A;  4UIX A;  5LKT A;  2RNY A;  5F63 A;  2I8N A;  3U5N A;  5DYX A;  5EIS A;  4BJX A;  5KTX A;  4ZQL A;  5CUG A;  3NXB A;  5DW1 A;  5D3S A;  5LJ2 A;  4LZR A;  5D7X A;  4UIT A;  4OUF A;  4BW1 A;  4O70 A;  4NUD A;  2YDW A;  5L97 A;  4Z1S A;  5F36 A;  5ENI A;  4YAD A;  5EGU A;  5KTW A;  5FE9 A;  4IOQ A;  5CUC A;  3D7C A;  5FG5 A;  4MEO A;  5CQ7 A;  2YEL A;  5AD2 A;  5C85 A;  4TTE A;  4YBM A;  3UV5 A;  2YW5 A;  4MR5 A;  3SVG A;  3S91 A;  5HQ5 A;  3UVW A;  5DLX A;  5HEM A;  3LQJ A;  4J3I A;  5HFQ A;  5FE6 A;  4O77 A;  5HM0 A;  2R10 A;  4Z6I A;  2F6J A;  4Z93 A;  5TB6 A;  5L96 A;  5I1Q A;  5EWH A;  2KTB B;  5ACY A;  5HEL A;  5A7C A;  4YH3 A;  5DKD A;  4CUR A;  4PTB A;  5E9V A;  5CFW A;  4HBV A;  2RS9 B;  2DVV A;  5ENG A;  4TYL A;  4QSS A;  5TCM A;  5LKX A;  5HEN A;  2F6N A;  5FE3 A;  4DON A;  4WHU A;  1JSP B;  4IOR A;  3SVH A;  3UV4 A;  4CUS A;  5CQ3 A;  3IU5 A;  3U5K A;  5BT4 A;  2FSA A;  3MUK A;  4O71 A;  3JVK A;  4PCE A;  5CZG A;  4GPJ A;  2DWW A;  5KTU A;  5E7D A;  5I89 A;  1WUG A;  4MEQ A;  5EK9 A;  4KV4 A;  2I7K A;  5EVA A;  5CPE A;  5CQ4 A;  2DAT A;  4PS5 A;  4UIU A;  5EWC A;  4HXR A;  4N4I A;  5F1L A;  5FE8 A;  3U5J A;  3U5M A;  4NUE A;  5CQ6 A;  4UYF A;  4N4G A;  5AME A;  4QSQ A;  5A85 A;  5CUB A;  3P1F A;  5CUE A;  5I83 A;  2WP1 A;  2RI7 A;  5AD3 A;  4QEV A;  4NS5 A;  4XYA A;  5L99 A;  2L84 A;  4CFL A;  5BT3 A;  1ZS5 A;  5E9K A;  4TT2 A;  5G4S A;  4MR3 A;  5CQ5 A;  5EI4 A;  4OGI A;  4RVR A;  4QSV A;  4ALG A;  4ZC9 A;  3G0J A;  4IR3 A;  5HRV A;  5HRX A;  4O78 A;  5IGM A;  3IU6 A;  4HXS A;  5JI8 A;  5COI A;  2L85 A;  4HXN A;  3UVD A;  2DVR A;  3AAD A;  2N9G A;  3O33 A;  3ERR A;  4UIZ A;  5EIC A;  4J1P A;  5LKZ A;  4QR5 A;  5I86 A;  2RO1 A;  5CQA A;  5F25 A;  5ENF A;  1WUM A;  5CY9 A;  4NYV A;  5L98 A;  4FLP A;  5E74 A;  4A9J A;  2H60 A;  2YEM A;  4UYF B;  4QC1 A;  5F61 A;  5G4R A;  3DAI A;  3U5L A;  4NR4 A;  4QSX A;  3G0L A;  3P1E A;  4YK0 A;  5H1U A;  4UIY A;  4O7B A;  4Y03 A;  4BW2 A;  5E9M A;  3MUL A;  4UIV A;  5CS8 A;  2G4A A;  5FE5 A;  4O72 A;  3ONI A;  4NR5 A;  5CP5 A;  4A9K A;  4N4F A;  2OO1 A;  3HME A;  5D25 A;  5HCL A;  4QEW A;  5DYU A;  2LSP B;  4LDF A;  5II1 A;  3UV2 A;  2DVS A;  4O75 A;  4Z1Q A;  4NRB A;  4TS8 A;  5FE1 A;  2OSS A;  5KO4 A;  5FFW A;  5FE2 A;  5A5P A;  4PCI A;  5IGK A;  5I88 A;  4NR8 A;  3LXJ A;  4QST A;  5CQT A;  5HJC A;  5CU8 A;  2RFJ A;  4WHW A;  5ETB A;  2GRC A;  5IID A;  4HXK A;  3S92 A;  3UVY A;  2EJN A;  5EPS A;  4CUU A;  3HMF A;  5D24 A;  4UYH A;  2L5E A;  4NRA A;  5EPB A;  5E73 A;  5LKU A;  5HLS A;  4YYJ A;  5F5Z A;  1JM4 B;  3UVX A;  4E96 A;  5DFB A;  3GG3 A;  4LZS A;  4N4H A;  5HQ7 A;  5IG6 A;  2D9E A;  5F2P A;  4QB3 A;  3AQA A;  5DYA A;  5C8G A;  5DX4 A;  4ZW1 A;  5A82 A;  2MJV B;  4A9E A;  4QSU A;  5FE7 A;  4J0R A;  5E0R A;  3DWY A;  4A9M A;  4XUB A;  4QZS A;  3MXF A;  5D26 A;  5CGP A;  5DKH A;  4QSR A;  5EV9 A;  5HRW A;  5CRM A;  4HBX A;  4HXP A;  4CUT A;  5FH7 A;  5C87 A;  4YYD A;  5D3N A;  4YYI A;  2R0V A;  4A9L A;  5EU1 A;  3P1D A;  5FB0 A;  3O37 A;  4CLB A;  3VKH A;  4TT6 A;  4KCX A;  3U5P A;  5FH8 A;  4Z6H A;  2DKW A;  4HBW A;  5JWM A;  4O74 A;  4A9N A;  2RNW A;  3LQH A;  4HBY A;  5LVQ A;  4CUP A;  4QUT A;  5I7Y A;  4AKI A;  5CQ8 A;  4MEP A;  4XY9 A;  5C7N A;  2E7O A;  4A9F A;  4TU4 A;  4A9H A;  3QZS A;  5DFD A;  2RNX A;  5DW2 A;  3MB4 A;  3ZYU A;  5IGL A;  5FH6 A;  5K29 A;  4NRC A;  4YYK A;  5A5R A;  5FBX A;  4TU6 A;  5EP7 A;  4O76 A;  5L8T A;  1E6I A;  4QYD A;  5IBN A;  3P1C A;  4TZ8 A;  3U5O A;  4OGJ A;  4HXM A;  4QSW A;  4CL9 A;  3QZT A;  4NR9 A;  5CTL A;  4YYM A;  3JVM A;  4AKN A;  3SVF A;  5A5N A;  3I3J A;  4PY6 A;  4QR4 A;  4TT4 A;  1EQF A;  5FB1 A;  5A81 A;  2YYN A;  2YEK A; 
#chains in the Genus database with same CATH homology
 4Q0O A;  5EWD A;  4WIV A;  5FG4 A;  4UIW A;  5I80 A;  5ENB A;  2NXB A;  5KHM A;  4YYH A;  4LYW A;  5DBM A;  4NQM A;  4YBT A;  4BHW A;  4CUQ A;  5DKC A;  5EM3 A;  4NUC A;  5C4Q A;  4BW4 A;  3O36 A;  4YH4 A;  4YAT A;  5DY7 A;  5E9L A;  2OUO A;  4O7A A;  4LC2 A;  4NR6 A;  5A5S A;  5D3L A;  4CFK A;  4NXJ A;  4QYL A;  4NR7 A;  4TZ2 A;  5FDZ A;  4IR4 A;  4YBS A;  4IOO A;  3RCW A;  4NQN A;  3O34 A;  4HXL A;  5F60 A;  5LVR A;  5C89 A;  4TQN A;  5E3D A;  4A9O A;  4MR6 A;  5F3A A;  1N72 A;  3LJW A;  4C66 A;  4O7E A;  4NYW A;  5FFY A;  5E9Y A;  5H1V A;  4LYI A;  4ALH A;  5CRZ A;  4XY8 A;  4XUA A;  5EQ1 A;  4IR5 A;  4X2I A;  4BW3 A;  3O35 A;  3MQM A;  5EPR A;  4KV1 A;  5CUD A;  4YAX A;  5FE4 A;  4A9I A;  5AMF A;  4QUU A;  5H1T A;  4QEU A;  5FE0 A;  3P5O A;  4MR4 A;  4UYE A;  5E3G A;  3Q2E A;  5HFR A;  5LJ0 A;  4QBM A;  5J0D A;  4Q0N A;  4YC9 A;  4LRG A;  4LR6 A;  4LYS A;  4N3W A;  5DYC A;  5D3H A;  5HQ6 A;  3UW9 A;  4YY4 A;  5I29 A;  4HXO A;  4UYD A;  5ENC A;  5LJ1 A;  1X0J A;  3MB3 A;  3HMH A;  5D3J A;  5I40 A;  5FFV A;  4YYG A;  5ENE A;  4C67 A;  5D0C A;  5DFC A;  5A83 A;  2R0S A;  5F62 A;  5H85 A;  4LZ2 A;  5BT5 A;  3JVL A;  2R0Y A;  5CUA A;  4QR3 A;  2E3K A;  3Q2F A;  5EWV A;  5A5O A;  5D3R A;  4J0S A;  5KU3 A;  4IR6 A;  2DVQ A;  2E7N A;  3FKM X;  5A5Q A;  4PKL A;  2D82 A;  3QZV A;  4QY4 A;  5E9I A;  5II2 A;  4O7C A;  4O7F A;  5ENH A;  3K2J A;  3TLP A;  4MEN A;  5LUU A;  4F3I A;  5ENJ A;  5FG6 A;  5L8U A;  1F68 A;  4YYN A;  2YQD A;  4UYG A;  4QC3 A;  5D3P A;  5D3T A;  5I7X A;  4NYX A;  4QSP A;  5F1H A;  3LQI A;  5DLZ A;  4QNS A;  5ETD A;  5IGN A;  5EWW A;  3JVJ A;  4YY6 A;  2WP2 A;  4YAB A;  5EA1 A;  4UIX A;  5LKT A;  2RNY A;  5F63 A;  2I8N A;  3U5N A;  5DYX A;  5EIS A;  4BJX A;  5KTX A;  4ZQL A;  5CUG A;  3NXB A;  5DW1 A;  5D3S A;  5LJ2 A;  4LZR A;  5D7X A;  4UIT A;  4OUF A;  4BW1 A;  4O70 A;  4NUD A;  2YDW A;  5L97 A;  4Z1S A;  5F36 A;  5ENI A;  4YAD A;  5EGU A;  5KTW A;  5FE9 A;  4IOQ A;  5CUC A;  3D7C A;  5FG5 A;  4MEO A;  5CQ7 A;  2YEL A;  5AD2 A;  5C85 A;  4TTE A;  4YBM A;  3UV5 A;  2YW5 A;  4MR5 A;  3SVG A;  3S91 A;  5HQ5 A;  3UVW A;  5DLX A;  5HEM A;  3LQJ A;  4J3I A;  5HFQ A;  5FE6 A;  4O77 A;  5HM0 A;  2R10 A;  4Z6I A;  2F6J A;  4Z93 A;  5TB6 A;  5L96 A;  5I1Q A;  5EWH A;  2KTB B;  5ACY A;  5HEL A;  5A7C A;  4YH3 A;  5DKD A;  4CUR A;  4PTB A;  5E9V A;  5CFW A;  4HBV A;  2RS9 B;  2DVV A;  5ENG A;  4TYL A;  4QSS A;  5TCM A;  5LKX A;  5HEN A;  2F6N A;  5FE3 A;  4DON A;  4WHU A;  1JSP B;  4IOR A;  3SVH A;  3UV4 A;  4CUS A;  5CQ3 A;  3IU5 A;  3U5K A;  5BT4 A;  2FSA A;  3MUK A;  4O71 A;  3JVK A;  4PCE A;  5CZG A;  4GPJ A;  2DWW A;  5KTU A;  5E7D A;  5I89 A;  1WUG A;  4MEQ A;  5EK9 A;  4KV4 A;  2I7K A;  5EVA A;  5CPE A;  5CQ4 A;  2DAT A;  4PS5 A;  4UIU A;  5EWC A;  4HXR A;  4N4I A;  5F1L A;  5FE8 A;  3U5J A;  3U5M A;  4NUE A;  5CQ6 A;  4UYF A;  4N4G A;  5AME A;  4QSQ A;  5A85 A;  5CUB A;  3P1F A;  5CUE A;  5I83 A;  2WP1 A;  2RI7 A;  5AD3 A;  4QEV A;  4NS5 A;  4XYA A;  5L99 A;  2L84 A;  4CFL A;  5BT3 A;  1ZS5 A;  5E9K A;  4TT2 A;  5G4S A;  4MR3 A;  5CQ5 A;  5EI4 A;  4OGI A;  4RVR A;  4QSV A;  4ALG A;  4ZC9 A;  3G0J A;  4IR3 A;  5HRV A;  5HRX A;  4O78 A;  5IGM A;  3IU6 A;  4HXS A;  5JI8 A;  5COI A;  2L85 A;  4HXN A;  3UVD A;  2DVR A;  3AAD A;  2N9G A;  3O33 A;  4UIZ A;  5EIC A;  4J1P A;  5LKZ A;  4QR5 A;  5I86 A;  2RO1 A;  5CQA A;  5F25 A;  5ENF A;  1WUM A;  5CY9 A;  4NYV A;  5L98 A;  4FLP A;  5E74 A;  4A9J A;  2H60 A;  2YEM A;  4UYF B;  4QC1 A;  5F61 A;  5G4R A;  3DAI A;  3U5L A;  4NR4 A;  4QSX A;  3G0L A;  3P1E A;  4YK0 A;  5H1U A;  4UIY A;  4O7B A;  4Y03 A;  4BW2 A;  5E9M A;  3MUL A;  4UIV A;  5CS8 A;  2G4A A;  5FE5 A;  4O72 A;  3ONI A;  4NR5 A;  5CP5 A;  4A9K A;  4N4F A;  2OO1 A;  3HME A;  5D25 A;  5HCL A;  4QEW A;  5DYU A;  2LSP B;  4LDF A;  5II1 A;  3UV2 A;  2DVS A;  4O75 A;  4Z1Q A;  4NRB A;  4TS8 A;  5FE1 A;  2OSS A;  5KO4 A;  5FFW A;  5FE2 A;  5A5P A;  4PCI A;  5IGK A;  5I88 A;  4NR8 A;  3LXJ A;  4QST A;  5CQT A;  5HJC A;  5CU8 A;  2RFJ A;  4WHW A;  5ETB A;  2GRC A;  5IID A;  4HXK A;  3S92 A;  3UVY A;  5EPS A;  4CUU A;  3HMF A;  5D24 A;  4UYH A;  2L5E A;  4NRA A;  5EPB A;  5E73 A;  5LKU A;  5HLS A;  4YYJ A;  5F5Z A;  1JM4 B;  3UVX A;  4E96 A;  5DFB A;  3GG3 A;  4LZS A;  4N4H A;  5HQ7 A;  5IG6 A;  2D9E A;  5F2P A;  4QB3 A;  3AQA A;  5DYA A;  5C8G A;  5DX4 A;  4ZW1 A;  5A82 A;  2MJV B;  4A9E A;  4QSU A;  5FE7 A;  4J0R A;  5E0R A;  3DWY A;  4A9M A;  4XUB A;  4QZS A;  3MXF A;  5D26 A;  5CGP A;  5DKH A;  4QSR A;  5EV9 A;  5HRW A;  5CRM A;  4HBX A;  4HXP A;  4CUT A;  5FH7 A;  5C87 A;  4YYD A;  5D3N A;  4YYI A;  2R0V A;  4A9L A;  5EU1 A;  3P1D A;  5FB0 A;  3O37 A;  4CLB A;  4TT6 A;  4KCX A;  3U5P A;  5FH8 A;  4Z6H A;  2DKW A;  4HBW A;  5JWM A;  4O74 A;  4A9N A;  2RNW A;  3LQH A;  4HBY A;  5LVQ A;  4CUP A;  4QUT A;  5I7Y A;  5CQ8 A;  4MEP A;  4XY9 A;  5C7N A;  2E7O A;  4A9F A;  4TU4 A;  4A9H A;  3QZS A;  5DFD A;  2RNX A;  5DW2 A;  3MB4 A;  3ZYU A;  5IGL A;  5FH6 A;  5K29 A;  4NRC A;  4YYK A;  5A5R A;  5FBX A;  4TU6 A;  5EP7 A;  4O76 A;  5L8T A;  1E6I A;  4QYD A;  5IBN A;  3P1C A;  4TZ8 A;  3U5O A;  4OGJ A;  4HXM A;  4QSW A;  4CL9 A;  3QZT A;  4NR9 A;  5CTL A;  4YYM A;  3JVM A;  4AKN A;  3SVF A;  5A5N A;  3I3J A;  4PY6 A;  4QR4 A;  4TT4 A;  1EQF A;  5FB1 A;  5A81 A;  2YYN A;  2YEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...