4LYWA

Crystal structure of brd4(1) bound to inhibitor xd14
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
127
structure length
127
Chain Sequence
AMNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title 4-Acyl pyrroles: mimicking acetylated lysines in histone code reading.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
total genus 40
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4lywA01
5EV9A 2YW5A 4ZW1A 3TLPA 5L96A 4O76A 3MUKA 5HM0A 4YBSA 4MENA 5CU8A 3U5KA 5II2A 4A9EA 2DATA 5HRXA 4NR9A 3D7CA 5E9YA 4CUUA 2DVVA 5E3DA 5FB0A 5CRZA 5FE8A 4YBTA 2RNWA 5EWHA 3LQHA 5HFQA 5DFDA 3MQMA 4BW4A 2RFJA 1EQFA 4MEQA 4TT4A 5CZGA 4QEUA 5DYCA 4O7FA 4UITA 4QUUA 4BW2A 4YADA 5G4SA 4BW1A 5IIDA 4PKLA 4O7EA 5AMFA 5F5ZA 4LYIA 5ENGA 5D3RA 3FKMX 5IGNA 5KHMA 3U5MA 4YY6A 4MR6A 5D3SA 5A5QA 5ENHA 2L5EA 4J0RA 2R0SA 4UYGA 4PCEA 5ACYA 4QC3A 4YYIA 4QSSA 4BW3A 4KV1A 3O36A 3S91A 2YDWA 5FDZA 5CUEA 4FLPA 3P1DA 3UW9A 5E7DA 2L85A 4KCXA 4YBMA 5H1TA 4UIUA 5LVRA 4Z6HA 5HELA 2L84A 3QZTA 4NYVA 5FH7A 4CURA 5FH6A 5HQ7A 4CUQA 3SVHA 5E9KA 4O78A 5CUBA 4RVRA 5A7CA 5ENEA 4NR4A 5HQ5A 5EISA 5II1A 2NXBA 5ENIA 4E96A 2N9GA 4N4IA 5E0RA 2LSPB 5EA1A 3UVDA 3RCWA 5HFRA 5CY9A 5H85A 5D3NA 5FG6A 3LQIA 3Q2EA 4NRBA 4UIWA 4HBWA 5HCLA 4LRGA 3U5JA 2DVRA 4NYWA 5CFWA 2G4AA 2RNYA 5FBXA 5I88A 4TZ8A 4O74A 4O77A 1WUMA 1WUGA 5D0CA 4YATA 4NR7A 4LYWA 1X0JA 5D26A 5KU3A 4QSPA 4A9MA 4QEVA 5DFCA 4N3WA 5A83A 5KTWA 5CP5A 3MB3A 5LKXA 5JWMA 4QR5A 4CFKA 5CUCA 2I7KA 4A9NA 5CUAA 4MR3A 4CFLA 4NQMA 4YC9A 5E3GA 5L8UA 5KTUA 4Y03A 5E9IA 4YYDA 3I3JA 4HBVA 2WP2A 4TQNA 4MR4A 2D82A 4NR6A 5ENJA 5F1LA 5IGKA 2DVSA 4NS5A 4AKNA 4CL9A 5FG5A 5D3TA 2R0YA 4NR8A 5FFYA 5LJ2A 5FH8A 5LUUA 3UV4A 5CQAA 5FE4A 4BJXA 4QB3A 5CPEA 5J0DA 2RS9B 4Z1QA 5FFWA 3IU5A 2F6JA 3SVGA 4QSTA 5G4RA 2RI7A 5JI8A 4PS5A 3P1CA 4A9JA 5EGUA 4QYLA 3UV2A 4YH3A 3ZYUA 5I29A 3IU6A 3G0LA 5D3PA 5EM3A 4LZ2A 4PTBA 3MULA 4O71A 4O7AA 4YYKA 4UYHA 4QEWA 4UYDA 4NUCA 5AD2A 5FB1A 5AMEA 5D24A 5A5RA 4WIVA 4LDFA 4A9KA 5EWWA 3P1EA 5BT3A 4J3IA 3JVJA 5I83A 5C85A 3AADA 3O34A 2YQDA 5IBNA 4O75A 5FE7A 5TCMA 4A9IA 4Z6IA 4C67A 5DBMA 5EPSA 4YYNA 4TU6A 5LKZA 4HXOA 5BT4A 4PCIA 5ETDA 4CUPA 4A9FA 4A9LA 5D3LA 5KTXA 4MR5A 5LVQA 5FE6A 5DLXA 5D3HA 5L98A 3MB4A 5EVAA 3DWYA 5D3JA 4HXPA 3U5OA 5DKHA 5I7XA 1ZS5A 5F2PA 5L99A 4QSRA 5CRMA 2I8NA 5COIA 4HBYA 5K29A 4UYEA 3JVMA 5CUGA 3ONIA 4O72A 4UIZA 2E7NA 4XYAA 3UVYA 4ALGA 5HRVA 4QSQA 5I1QA 5BT5A 5I80A 2OUOA 5LJ1A 5FE9A 5F25A 4NYXA 1JSPB 4ZQLA 1N72A 5CS8A 3UV5A 4TZ2A 5C8GA 5EICA 4XY9A 4QC1A 4QUTA 4YY4A 2DWWA 2R10A 2YEMA 4O7BA 2R0VA 4YYJA 5CGPA 5ENCA 3AQAA 4IOQA 3U5LA 4LYSA 5DW2A 5L97A 2KTBB 3UVWA 2OSSA 4ZC9A 5E9VA 3U5NA 4A9OA 4YYHA 4QZSA 4YABA 3QZVA 4HXSA 5DFBA 3U5PA 4NR5A 2MJVB 4HXNA 4UYFB 4NRAA 5AD3A 5EQ1A 5DKCA 4MEOA 5C7NA 4N4GA 4MEPA 3O37A 4QBMA 5EK9A 4OUFA 5D7XA 5CQ3A 4Q0OA 5C4QA 5TB6A 4UIYA 4UYFA 4IR6A 4LC2A 4WHUA 3QZSA 5ENBA 5HJCA 4NXJA 2F6NA 4DONA 4GPJA 1E6IA 4LZSA 3NXBA 4UIVA 4NUEA 4OGIA 4TYLA 2YEKA 2RNXA 2H60A 5E9MA 5A82A 4Z1SA 5DYUA 4QSWA 3JVLA 4N4FA 4QSUA 5H1VA 5DKDA 5DW1A 5C87A 5DYAA 5CQ5A 4YK0A 4J0SA 4O70A 4UIXA 4TU4A 4YH4A 3G0JA 5LKUA 4HXRA 5H1UA 5HEMA 3S92A 2E7OA 5I89A 5EPBA 5IG6A 4C66A 5DY7A 5I7YA 4YAXA 5A81A 5E74A 5FE0A 4TS8A 4KV4A 3JVKA 4QNSA 5HLSA 3DAIA 4IR5A 5EU1A 5F1HA 5EWVA 5EWCA 5KO4A 2YELA 4F3IA 3UVXA 3LJWA 5DLZA 5D25A 5FE2A 5CUDA 4NUDA 2OO1A 4N4HA 5CQ8A 4BHWA 4X2IA 5CQTA 5FFVA 5A5NA 5A5SA 5EP7A 3LXJA 5F3AA 4TT2A 3SVFA 4A9HA 5F61A 4CUSA 3P5OA 3HMEA 3LQJA 4Z93A 5FG4A 2YYNA 4J1PA 4NQNA 5DX4A 2FSAA 4IOOA 4TT6A 4LZRA 2DVQA 2DKWA 4TTEA 3K2JA 4CUTA 4WHWA 5CQ4A 5E9LA 4OGJA 5HENA 5I40A 4XY8A 3O33A 5CTLA 5EWDA 4HBXA 5IGLA 5HRWA 4XUBA 4Q0NA 5EI4A 5LKTA 3P1FA 4YYMA 4HXLA 3O35A 5L8TA 4NRCA 5HQ6A 5A5OA 5E73A 5FE5A 5CQ7A 1JM4B 4QYDA 5LJ0A 2WP1A 4QY4A 4IR4A 2GRCA 5A85A 5FE3A 3HMHA 4CLBA 4XUAA 2RO1A 5CQ6A 5C89A 4PY6A 4HXMA 4QR3A 4ALHA 4YYGA 4O7CA 4IORA 4QSXA 5F63A 4IR3A 5F36A 4QR4A 5F62A 5F60A 5A5PA 4HXKA 3Q2FA 5I86A 5FE1A 5IGMA 1F68A 3GG3A 5DYXA 5ENFA 2E3KA 3HMFA 4LR6A 2D9EA 5EPRA 5ETBA 3MXFA 4QSVA
chains in the Genus database with same CATH superfamily
5EV9A 2YW5A 4ZW1A 3TLPA 5L96A 4O76A 3MUKA 5HM0A 4YBSA 4MENA 5CU8A 3U5KA 5II2A 4A9EA 2DATA 5HRXA 4NR9A 3D7CA 5E9YA 4CUUA 2DVVA 5E3DA 5FB0A 5CRZA 5FE8A 4YBTA 3VKGA 2RNWA 5EWHA 3LQHA 5HFQA 5DFDA 3MQMA 4BW4A 2RFJA 1EQFA 4MEQA 4TT4A 5CZGA 4QEUA 5DYCA 4O7FA 4UITA 4QUUA 4BW2A 4YADA 5G4SA 4BW1A 5IIDA 4PKLA 4O7EA 5AMFA 5F5ZA 4LYIA 5ENGA 5D3RA 3FKMX 5IGNA 5KHMA 3U5MA 4YY6A 4MR6A 5D3SA 5A5QA 5ENHA 2L5EA 4J0RA 2R0SA 4UYGA 4PCEA 5ACYA 4QC3A 4YYIA 4QSSA 4BW3A 4KV1A 3O36A 3S91A 2YDWA 5FDZA 5CUEA 4FLPA 3P1DA 3UW9A 5E7DA 2L85A 4KCXA 4YBMA 5H1TA 4UIUA 5LVRA 4Z6HA 5HELA 2L84A 3QZTA 4NYVA 5FH7A 4CURA 5FH6A 5HQ7A 4CUQA 3SVHA 5E9KA 4O78A 5CUBA 4RVRA 5A7CA 5ENEA 4NR4A 5HQ5A 5EISA 5II1A 2NXBA 5ENIA 4E96A 2N9GA 4N4IA 5E0RA 2LSPB 5EA1A 3UVDA 3RCWA 5HFRA 5CY9A 5H85A 5D3NA 5FG6A 3LQIA 3Q2EA 4NRBA 4UIWA 4HBWA 5HCLA 4LRGA 3U5JA 2DVRA 4NYWA 5CFWA 2G4AA 2RNYA 5FBXA 5I88A 4TZ8A 4O74A 4O77A 1WUMA 1WUGA 5D0CA 4YATA 4NR7A 4LYWA 1X0JA 5D26A 5KU3A 4QSPA 4A9MA 4QEVA 5DFCA 4N3WA 5A83A 5KTWA 5CP5A 3MB3A 5LKXA 5JWMA 4QR5A 4CFKA 5CUCA 2I7KA 4A9NA 5CUAA 4MR3A 4CFLA 4NQMA 4YC9A 5E3GA 5L8UA 5KTUA 4Y03A 5E9IA 4YYDA 3I3JA 4HBVA 2WP2A 4TQNA 4MR4A 2D82A 4NR6A 5ENJA 5F1LA 5IGKA 2DVSA 4NS5A 4AKNA 4CL9A 3D1BA 5FG5A 5D3TA 2R0YA 4NR8A 5FFYA 5LJ2A 5FH8A 5LUUA 3UV4A 5CQAA 5FE4A 4BJXA 4QB3A 5CPEA 5J0DA 2RS9B 4Z1QA 5FFWA 3IU5A 2F6JA 3SVGA 4QSTA 5G4RA 2RI7A 5JI8A 4PS5A 3P1CA 4A9JA 5EGUA 4QYLA 3UV2A 4YH3A 3ZYUA 5I29A 3G0LA 3IU6A 5D3PA 5EM3A 4LZ2A 4PTBA 3D1DA 3MULA 4O71A 4O7AA 4YYKA 4UYHA 4QEWA 4UYDA 4NUCA 5AD2A 5FB1A 5AMEA 5D24A 1PUOA 5A5RA 4WIVA 4LDFA 4A9KA 5EWWA 3P1EA 5BT3A 4J3IA 3JVJA 5I83A 5C85A 3AADA 3O34A 2YQDA 5IBNA 4O75A 5FE7A 5TCMA 4A9IA 4Z6IA 4C67A 5DBMA 5EPSA 4YYNA 4TU6A 5LKZA 4HXOA 5BT4A 4PCIA 5ETDA 4CUPA 4A9FA 4A9LA 5D3LA 5KTXA 4MR5A 5LVQA 5FE6A 5DLXA 5D3HA 5L98A 3MB4A 5EVAA 3DWYA 5D3JA 4HXPA 3U5OA 5DKHA 5I7XA 1ZS5A 5F2PA 5L99A 4QSRA 5CRMA 2I8NA 5COIA 4HBYA 5K29A 4UYEA 3JVMA 5CUGA 3ONIA 4O72A 4UIZA 2E7NA 4XYAA 3UVYA 4ALGA 5HRVA 4QSQA 5I1QA 4AKIA 5BT5A 5I80A 2OUOA 5LJ1A 5FE9A 5F25A 4NYXA 1JSPB 4ZQLA 1N72A 5CS8A 3UV5A 4TZ2A 5C8GA 5EICA 4XY9A 4QC1A 4QUTA 4YY4A 2DWWA 2R10A 2YEMA 4O7BA 2R0VA 4YYJA 5CGPA 5ENCA 3AQAA 4IOQA 3U5LA 4LYSA 5DW2A 5L97A 2KTBB 3UVWA 2OSSA 4ZC9A 5E9VA 3U5NA 4A9OA 4YYHA 4QZSA 4YABA 3QZVA 4HXSA 5DFBA 3U5PA 4NR5A 2MJVB 4HXNA 4UYFB 4NRAA 5AD3A 5EQ1A 4AI6A 5DKCA 3ERRA 4MEOA 5C7NA 4N4GA 4MEPA 1ZKRA 3O37A 4QBMA 5EK9A 4OUFA 5D7XA 5CQ3A 4Q0OA 5C4QA 5TB6A 4UIYA 4UYFA 4IR6A 4LC2A 4WHUA 3QZSA 5ENBA 5HJCA 4NXJA 2F6NA 4DONA 4GPJA 1E6IA 4LZSA 3NXBA 4UIVA 4NUEA 4OGIA 4TYLA 2YEKA 2RNXA 2H60A 5E9MA 5A82A 4Z1SA 5DYUA 4QSWA 3JVLA 4AKGA 4N4FA 4QSUA 4AKHA 5H1VA 5DKDA 5DW1A 5C87A 5DYAA 5CQ5A 4YK0A 4J0SA 4O70A 4UIXA 4TU4A 4YH4A 3G0JA 5LKUA 4HXRA 5H1UA 5HEMA 3S92A 2E7OA 5I89A 5EPBA 5IG6A 4C66A 5DY7A 5I7YA 4YAXA 5A81A 5E74A 5FE0A 4TS8A 4KV4A 3JVKA 4QNSA 5HLSA 3DAIA 4IR5A 5EU1A 5F1HA 5EWVA 5EWCA 5KO4A 2YELA 4F3IA 3UVXA 3LJWA 5DLZA 5D25A 5FE2A 5CUDA 4NUDA 2OO1A 4N4HA 5CQ8A 4BHWA 4X2IA 5CQTA 5FFVA 5A5NA 5A5SA 5EP7A 3LXJA 5F3AA 4TT2A 3SVFA 4A9HA 5F61A 4CUSA 3P5OA 3HMEA 3LQJA 4Z93A 5FG4A 2YYNA 4J1PA 4NQNA 5DX4A 2FSAA 4IOOA 4TT6A 4LZRA 2DVQA 2DKWA 4TTEA 3K2JA 4CUTA 4WHWA 5CQ4A 5E9LA 4OGJA 5HENA 5I40A 4XY8A 3O33A 5CTLA 5EWDA 4HBXA 5IGLA 5HRWA 4XUBA 4Q0NA 5EI4A 5LKTA 3P1FA 4YYMA 4HXLA 3O35A 5L8TA 4NRCA 5HQ6A 5A5OA 5E73A 5FE5A 5CQ7A 1JM4B 4QYDA 5LJ0A 2WP1A 4QY4A 4IR4A 2GRCA 5A85A 5FE3A 3HMHA 4CLBA 4XUAA 2RO1A 5CQ6A 5C89A 4PY6A 4HXMA 4QR3A 4ALHA 4YYGA 4O7CA 3VKHA 4IORA 4QSXA 5F63A 2EJNA 4IR3A 5F36A 4QR4A 5F62A 5F60A 5A5PA 4HXKA 3Q2FA 5I86A 5FE1A 5IGMA 1F68A 3GG3A 5DYXA 5ENFA 2E3KA 3HMFA 4LR6A 2D9EA 5EPRA 5ETBA 3MXFA 4QSVA
chains in the Genus database with same CATH topology
5EV9A 2YW5A 4ZW1A 3TLPA 5L96A 4O76A 3MUKA 5HM0A 4YBSA 4MENA 5CU8A 3U5KA 5II2A 4A9EA 2DATA 5HRXA 4NR9A 3D7CA 5E9YA 4CUUA 2DVVA 5E3DA 5FB0A 5CRZA 5FE8A 4YBTA 2RNWA 5EWHA 3LQHA 5HFQA 5DFDA 3MQMA 4BW4A 2RFJA 1EQFA 4MEQA 4TT4A 5CZGA 4QEUA 5DYCA 4O7FA 4UITA 4QUUA 4BW2A 4YADA 5G4SA 4BW1A 5IIDA 4PKLA 4O7EA 5AMFA 5F5ZA 4LYIA 5ENGA 5D3RA 3FKMX 5IGNA 5KHMA 3U5MA 4YY6A 4MR6A 5D3SA 5A5QA 5ENHA 2L5EA 4J0RA 2R0SA 4UYGA 4PCEA 5ACYA 4QC3A 4YYIA 4QSSA 4BW3A 4KV1A 3O36A 3S91A 2YDWA 5FDZA 5CUEA 4FLPA 3P1DA 3UW9A 5E7DA 2L85A 4KCXA 4YBMA 5H1TA 4UIUA 5LVRA 4Z6HA 5HELA 2L84A 3QZTA 4NYVA 5FH7A 4CURA 5FH6A 5HQ7A 4CUQA 3SVHA 5E9KA 4O78A 5CUBA 4RVRA 5A7CA 5ENEA 4NR4A 5HQ5A 5EISA 5II1A 2NXBA 5ENIA 4E96A 2N9GA 4N4IA 5E0RA 2LSPB 5EA1A 3UVDA 3RCWA 5HFRA 5CY9A 5H85A 5D3NA 5FG6A 3LQIA 3Q2EA 4NRBA 4UIWA 4HBWA 5HCLA 4LRGA 3U5JA 2DVRA 4NYWA 5CFWA 2G4AA 2RNYA 5FBXA 5I88A 4TZ8A 4O74A 4O77A 1WUMA 1WUGA 5D0CA 4YATA 4NR7A 4LYWA 1X0JA 5D26A 5KU3A 4QSPA 4A9MA 4QEVA 5DFCA 4N3WA 5A83A 5KTWA 5CP5A 3MB3A 5LKXA 5JWMA 4QR5A 4CFKA 5CUCA 2I7KA 4A9NA 5CUAA 4MR3A 4CFLA 4NQMA 4YC9A 5E3GA 5L8UA 5KTUA 4Y03A 5E9IA 4YYDA 3I3JA 4HBVA 2WP2A 4TQNA 4MR4A 2D82A 4NR6A 5ENJA 5F1LA 5IGKA 2DVSA 4NS5A 4AKNA 4CL9A 5FG5A 5D3TA 2R0YA 4NR8A 5FFYA 5LJ2A 5FH8A 5LUUA 3UV4A 5CQAA 5FE4A 4BJXA 4QB3A 5CPEA 5J0DA 2RS9B 4Z1QA 5FFWA 3IU5A 2F6JA 3SVGA 4QSTA 5G4RA 2RI7A 5JI8A 4PS5A 3P1CA 4A9JA 5EGUA 4QYLA 3UV2A 4YH3A 3ZYUA 5I29A 3IU6A 3G0LA 5D3PA 5EM3A 4LZ2A 4PTBA 3MULA 4O71A 4O7AA 4YYKA 4UYHA 4QEWA 4UYDA 4NUCA 5AD2A 5FB1A 5AMEA 5D24A 5A5RA 4WIVA 4LDFA 4A9KA 5EWWA 3P1EA 5BT3A 4J3IA 3JVJA 5I83A 5C85A 3AADA 3O34A 2YQDA 5IBNA 4O75A 5FE7A 5TCMA 4A9IA 4Z6IA 4C67A 5DBMA 5EPSA 4YYNA 4TU6A 5LKZA 4HXOA 5BT4A 4PCIA 5ETDA 4CUPA 4A9FA 4A9LA 5D3LA 5KTXA 4MR5A 5LVQA 5FE6A 5DLXA 5D3HA 5L98A 3MB4A 5EVAA 3DWYA 5D3JA 4HXPA 3U5OA 5DKHA 5I7XA 1ZS5A 5F2PA 5L99A 4QSRA 5CRMA 2I8NA 5COIA 4HBYA 5K29A 4UYEA 3JVMA 5CUGA 3ONIA 4O72A 4UIZA 2E7NA 4XYAA 3UVYA 4ALGA 5HRVA 4QSQA 5I1QA 5BT5A 5I80A 2OUOA 5LJ1A 5FE9A 5F25A 4NYXA 1JSPB 4ZQLA 1N72A 5CS8A 3UV5A 4TZ2A 5C8GA 5EICA 4XY9A 4QC1A 4QUTA 4YY4A 2DWWA 2R10A 2YEMA 4O7BA 2R0VA 4YYJA 5CGPA 5ENCA 3AQAA 4IOQA 3U5LA 4LYSA 5DW2A 5L97A 2KTBB 3UVWA 2OSSA 4ZC9A 5E9VA 3U5NA 4A9OA 4YYHA 4QZSA 4YABA 3QZVA 4HXSA 5DFBA 3U5PA 4NR5A 2MJVB 4HXNA 4UYFB 4NRAA 5AD3A 5EQ1A 5DKCA 4MEOA 5C7NA 4N4GA 4MEPA 3O37A 4QBMA 5EK9A 4OUFA 5D7XA 5CQ3A 4Q0OA 5C4QA 5TB6A 4UIYA 4UYFA 4IR6A 4LC2A 4WHUA 3QZSA 5ENBA 5HJCA 4NXJA 2F6NA 4DONA 4GPJA 1E6IA 4LZSA 3NXBA 4UIVA 4NUEA 4OGIA 4TYLA 2YEKA 2RNXA 2H60A 5E9MA 5A82A 4Z1SA 5DYUA 4QSWA 3JVLA 4N4FA 4QSUA 5H1VA 5DKDA 5DW1A 5C87A 5DYAA 5CQ5A 4YK0A 4J0SA 4O70A 4UIXA 4TU4A 4YH4A 3G0JA 5LKUA 4HXRA 5H1UA 5HEMA 3S92A 2E7OA 5I89A 5EPBA 5IG6A 4C66A 5DY7A 5I7YA 4YAXA 5A81A 5E74A 5FE0A 4TS8A 4KV4A 3JVKA 4QNSA 5HLSA 3DAIA 4IR5A 5EU1A 5F1HA 5EWVA 5EWCA 5KO4A 2YELA 4F3IA 3UVXA 3LJWA 5DLZA 5D25A 5FE2A 5CUDA 4NUDA 2OO1A 4N4HA 5CQ8A 4BHWA 4X2IA 5CQTA 5FFVA 5A5NA 5A5SA 5EP7A 3LXJA 5F3AA 4TT2A 3SVFA 4A9HA 5F61A 4CUSA 3P5OA 3HMEA 3LQJA 4Z93A 5FG4A 2YYNA 4J1PA 4NQNA 5DX4A 2FSAA 4IOOA 4TT6A 4LZRA 2DVQA 2DKWA 4TTEA 3K2JA 4CUTA 4WHWA 5CQ4A 5E9LA 4OGJA 5HENA 5I40A 4XY8A 3O33A 5CTLA 5EWDA 4HBXA 5IGLA 5HRWA 4XUBA 4Q0NA 5EI4A 5LKTA 3P1FA 4YYMA 4HXLA 3O35A 5L8TA 4NRCA 5HQ6A 5A5OA 5E73A 5FE5A 5CQ7A 1JM4B 4QYDA 5LJ0A 2WP1A 4QY4A 4IR4A 2GRCA 5A85A 5FE3A 3HMHA 4CLBA 4XUAA 2RO1A 5CQ6A 5C89A 4PY6A 4HXMA 4QR3A 4ALHA 4YYGA 4O7CA 4IORA 4QSXA 5F63A 4IR3A 5F36A 4QR4A 5F62A 5F60A 5A5PA 4HXKA 3Q2FA 5I86A 5FE1A 5IGMA 1F68A 3GG3A 5DYXA 5ENFA 2E3KA 3HMFA 4LR6A 2D9EA 5EPRA 5ETBA 3MXFA 4QSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EV9 A;  2YW5 A;  4ZW1 A;  3TLP A;  5L96 A;  4O76 A;  3MUK A;  5HM0 A;  4YBS A;  4MEN A;  5CU8 A;  3U5K A;  5II2 A;  4A9E A;  2DAT A;  5HRX A;  4NR9 A;  3D7C A;  5E9Y A;  4CUU A;  2DVV A;  5E3D A;  5FB0 A;  5CRZ A;  5FE8 A;  4YBT A;  2RNW A;  5EWH A;  3LQH A;  5HFQ A;  5DFD A;  3MQM A;  4BW4 A;  2RFJ A;  1EQF A;  4MEQ A;  4TT4 A;  5CZG A;  4QEU A;  5DYC A;  4O7F A;  4UIT A;  4QUU A;  4BW2 A;  4YAD A;  5G4S A;  4BW1 A;  5IID A;  4PKL A;  4O7E A;  5AMF A;  5F5Z A;  4LYI A;  5ENG A;  5D3R A;  3FKM X;  5IGN A;  5KHM A;  3U5M A;  4YY6 A;  4MR6 A;  5D3S A;  5A5Q A;  5ENH A;  2L5E A;  4J0R A;  2R0S A;  4UYG A;  4PCE A;  5ACY A;  4QC3 A;  4YYI A;  4QSS A;  4BW3 A;  4KV1 A;  3O36 A;  3S91 A;  2YDW A;  5FDZ A;  5CUE A;  4FLP A;  3P1D A;  3UW9 A;  5E7D A;  2L85 A;  4KCX A;  4YBM A;  5H1T A;  4UIU A;  5LVR A;  4Z6H A;  5HEL A;  2L84 A;  3QZT A;  4NYV A;  5FH7 A;  4CUR A;  5FH6 A;  5HQ7 A;  4CUQ A;  3SVH A;  5E9K A;  4O78 A;  5CUB A;  4RVR A;  5A7C A;  5ENE A;  4NR4 A;  5HQ5 A;  5EIS A;  5II1 A;  2NXB A;  5ENI A;  4E96 A;  2N9G A;  4N4I A;  5E0R A;  2LSP B;  5EA1 A;  3UVD A;  3RCW A;  5HFR A;  5CY9 A;  5H85 A;  5D3N A;  5FG6 A;  3LQI A;  3Q2E A;  4NRB A;  4UIW A;  4HBW A;  5HCL A;  4LRG A;  3U5J A;  2DVR A;  4NYW A;  5CFW A;  2G4A A;  2RNY A;  5FBX A;  5I88 A;  4TZ8 A;  4O74 A;  4O77 A;  1WUM A;  1WUG A;  5D0C A;  4YAT A;  4NR7 A;  4LYW A;  1X0J A;  5D26 A;  5KU3 A;  4QSP A;  4A9M A;  4QEV A;  5DFC A;  4N3W A;  5A83 A;  5KTW A;  5CP5 A;  3MB3 A;  5LKX A;  5JWM A;  4QR5 A;  4CFK A;  5CUC A;  2I7K A;  4A9N A;  5CUA A;  4MR3 A;  4CFL A;  4NQM A;  4YC9 A;  5E3G A;  5L8U A;  5KTU A;  4Y03 A;  5E9I A;  4YYD A;  3I3J A;  4HBV A;  2WP2 A;  4TQN A;  4MR4 A;  2D82 A;  4NR6 A;  5ENJ A;  5F1L A;  5IGK A;  2DVS A;  4NS5 A;  4AKN A;  4CL9 A;  5FG5 A;  5D3T A;  2R0Y A;  4NR8 A;  5FFY A;  5LJ2 A;  5FH8 A;  5LUU A;  3UV4 A;  5CQA A;  5FE4 A;  4BJX A;  4QB3 A;  5CPE A;  5J0D A;  2RS9 B;  4Z1Q A;  5FFW A;  3IU5 A;  2F6J A;  3SVG A;  4QST A;  5G4R A;  2RI7 A;  5JI8 A;  4PS5 A;  3P1C A;  4A9J A;  5EGU A;  4QYL A;  3UV2 A;  4YH3 A;  3ZYU A;  5I29 A;  3IU6 A;  3G0L A;  5D3P A;  5EM3 A;  4LZ2 A;  4PTB A;  3MUL A;  4O71 A;  4O7A A;  4YYK A;  4UYH A;  4QEW A;  4UYD A;  4NUC A;  5AD2 A;  5FB1 A;  5AME A;  5D24 A;  5A5R A;  4WIV A;  4LDF A;  4A9K A;  5EWW A;  3P1E A;  5BT3 A;  4J3I A;  3JVJ A;  5I83 A;  5C85 A;  3AAD A;  3O34 A;  2YQD A;  5IBN A;  4O75 A;  5FE7 A;  5TCM A;  4A9I A;  4Z6I A;  4C67 A;  5DBM A;  5EPS A;  4YYN A;  4TU6 A;  5LKZ A;  4HXO A;  5BT4 A;  4PCI A;  5ETD A;  4CUP A;  4A9F A;  4A9L A;  5D3L A;  5KTX A;  4MR5 A;  5LVQ A;  5FE6 A;  5DLX A;  5D3H A;  5L98 A;  3MB4 A;  5EVA A;  3DWY A;  5D3J A;  4HXP A;  3U5O A;  5DKH A;  5I7X A;  1ZS5 A;  5F2P A;  5L99 A;  4QSR A;  5CRM A;  2I8N A;  5COI A;  4HBY A;  5K29 A;  4UYE A;  3JVM A;  5CUG A;  3ONI A;  4O72 A;  4UIZ A;  2E7N A;  4XYA A;  3UVY A;  4ALG A;  5HRV A;  4QSQ A;  5I1Q A;  5BT5 A;  5I80 A;  2OUO A;  5LJ1 A;  5FE9 A;  5F25 A;  4NYX A;  1JSP B;  4ZQL A;  1N72 A;  5CS8 A;  3UV5 A;  4TZ2 A;  5C8G A;  5EIC A;  4XY9 A;  4QC1 A;  4QUT A;  4YY4 A;  2DWW A;  2R10 A;  2YEM A;  4O7B A;  2R0V A;  4YYJ A;  5CGP A;  5ENC A;  3AQA A;  4IOQ A;  3U5L A;  4LYS A;  5DW2 A;  5L97 A;  2KTB B;  3UVW A;  2OSS A;  4ZC9 A;  5E9V A;  3U5N A;  4A9O A;  4YYH A;  4QZS A;  4YAB A;  3QZV A;  4HXS A;  5DFB A;  3U5P A;  4NR5 A;  2MJV B;  4HXN A;  4UYF B;  4NRA A;  5AD3 A;  5EQ1 A;  5DKC A;  4MEO A;  5C7N A;  4N4G A;  4MEP A;  3O37 A;  4QBM A;  5EK9 A;  4OUF A;  5D7X A;  5CQ3 A;  4Q0O A;  5C4Q A;  5TB6 A;  4UIY A;  4UYF A;  4IR6 A;  4LC2 A;  4WHU A;  3QZS A;  5ENB A;  5HJC A;  4NXJ A;  2F6N A;  4DON A;  4GPJ A;  1E6I A;  4LZS A;  3NXB A;  4UIV A;  4NUE A;  4OGI A;  4TYL A;  2YEK A;  2RNX A;  2H60 A;  5E9M A;  5A82 A;  4Z1S A;  5DYU A;  4QSW A;  3JVL A;  4N4F A;  4QSU A;  5H1V A;  5DKD A;  5DW1 A;  5C87 A;  5DYA A;  5CQ5 A;  4YK0 A;  4J0S A;  4O70 A;  4UIX A;  4TU4 A;  4YH4 A;  3G0J A;  5LKU A;  4HXR A;  5H1U A;  5HEM A;  3S92 A;  2E7O A;  5I89 A;  5EPB A;  5IG6 A;  4C66 A;  5DY7 A;  5I7Y A;  4YAX A;  5A81 A;  5E74 A;  5FE0 A;  4TS8 A;  4KV4 A;  3JVK A;  4QNS A;  5HLS A;  3DAI A;  4IR5 A;  5EU1 A;  5F1H A;  5EWV A;  5EWC A;  5KO4 A;  2YEL A;  4F3I A;  3UVX A;  3LJW A;  5DLZ A;  5D25 A;  5FE2 A;  5CUD A;  4NUD A;  2OO1 A;  4N4H A;  5CQ8 A;  4BHW A;  4X2I A;  5CQT A;  5FFV A;  5A5N A;  5A5S A;  5EP7 A;  3LXJ A;  5F3A A;  4TT2 A;  3SVF A;  4A9H A;  5F61 A;  4CUS A;  3P5O A;  3HME A;  3LQJ A;  4Z93 A;  5FG4 A;  2YYN A;  4J1P A;  4NQN A;  5DX4 A;  2FSA A;  4IOO A;  4TT6 A;  4LZR A;  2DVQ A;  2DKW A;  4TTE A;  3K2J A;  4CUT A;  4WHW A;  5CQ4 A;  5E9L A;  4OGJ A;  5HEN A;  5I40 A;  4XY8 A;  3O33 A;  5CTL A;  5EWD A;  4HBX A;  5IGL A;  5HRW A;  4XUB A;  4Q0N A;  5EI4 A;  5LKT A;  3P1F A;  4YYM A;  4HXL A;  3O35 A;  5L8T A;  4NRC A;  5HQ6 A;  5A5O A;  5E73 A;  5FE5 A;  5CQ7 A;  1JM4 B;  4QYD A;  5LJ0 A;  2WP1 A;  4QY4 A;  4IR4 A;  2GRC A;  5A85 A;  5FE3 A;  3HMH A;  4CLB A;  4XUA A;  2RO1 A;  5CQ6 A;  5C89 A;  4PY6 A;  4HXM A;  4QR3 A;  4ALH A;  4YYG A;  4O7C A;  4IOR A;  4QSX A;  5F63 A;  4IR3 A;  5F36 A;  4QR4 A;  5F62 A;  5F60 A;  5A5P A;  4HXK A;  3Q2F A;  5I86 A;  5FE1 A;  5IGM A;  1F68 A;  3GG3 A;  5DYX A;  5ENF A;  2E3K A;  3HMF A;  4LR6 A;  2D9E A;  5EPR A;  5ETB A;  3MXF A;  4QSV A; 
#chains in the Genus database with same CATH topology
 5EV9 A;  2YW5 A;  4ZW1 A;  3TLP A;  5L96 A;  4O76 A;  3MUK A;  5HM0 A;  4YBS A;  4MEN A;  5CU8 A;  3U5K A;  5II2 A;  4A9E A;  2DAT A;  5HRX A;  4NR9 A;  3D7C A;  5E9Y A;  4CUU A;  2DVV A;  5E3D A;  5FB0 A;  5CRZ A;  5FE8 A;  4YBT A;  3VKG A;  2RNW A;  5EWH A;  3LQH A;  5HFQ A;  5DFD A;  3MQM A;  4BW4 A;  2RFJ A;  1EQF A;  4MEQ A;  4TT4 A;  5CZG A;  4QEU A;  5DYC A;  4O7F A;  4UIT A;  4QUU A;  4BW2 A;  4YAD A;  5G4S A;  4BW1 A;  5IID A;  4PKL A;  4O7E A;  5AMF A;  5F5Z A;  4LYI A;  5ENG A;  5D3R A;  3FKM X;  5IGN A;  5KHM A;  3U5M A;  4YY6 A;  4MR6 A;  5D3S A;  5A5Q A;  5ENH A;  2L5E A;  4J0R A;  2R0S A;  4UYG A;  4PCE A;  5ACY A;  4QC3 A;  4YYI A;  4QSS A;  4BW3 A;  4KV1 A;  3O36 A;  3S91 A;  2YDW A;  5FDZ A;  5CUE A;  4FLP A;  3P1D A;  3UW9 A;  5E7D A;  2L85 A;  4KCX A;  4YBM A;  5H1T A;  4UIU A;  5LVR A;  4Z6H A;  5HEL A;  2L84 A;  3QZT A;  4NYV A;  5FH7 A;  4CUR A;  5FH6 A;  5HQ7 A;  4CUQ A;  3SVH A;  5E9K A;  4O78 A;  5CUB A;  4RVR A;  5A7C A;  5ENE A;  4NR4 A;  5HQ5 A;  5EIS A;  5II1 A;  2NXB A;  5ENI A;  4E96 A;  2N9G A;  4N4I A;  5E0R A;  2LSP B;  5EA1 A;  3UVD A;  3RCW A;  5HFR A;  5CY9 A;  5H85 A;  5D3N A;  5FG6 A;  3LQI A;  3Q2E A;  4NRB A;  4UIW A;  4HBW A;  5HCL A;  4LRG A;  3U5J A;  2DVR A;  4NYW A;  5CFW A;  2G4A A;  2RNY A;  5FBX A;  5I88 A;  4TZ8 A;  4O74 A;  4O77 A;  1WUM A;  1WUG A;  5D0C A;  4YAT A;  4NR7 A;  4LYW A;  1X0J A;  5D26 A;  5KU3 A;  4QSP A;  4A9M A;  4QEV A;  5DFC A;  4N3W A;  5A83 A;  5KTW A;  5CP5 A;  3MB3 A;  5LKX A;  5JWM A;  4QR5 A;  4CFK A;  5CUC A;  2I7K A;  4A9N A;  5CUA A;  4MR3 A;  4CFL A;  4NQM A;  4YC9 A;  5E3G A;  5L8U A;  5KTU A;  4Y03 A;  5E9I A;  4YYD A;  3I3J A;  4HBV A;  2WP2 A;  4TQN A;  4MR4 A;  2D82 A;  4NR6 A;  5ENJ A;  5F1L A;  5IGK A;  2DVS A;  4NS5 A;  4AKN A;  4CL9 A;  3D1B A;  5FG5 A;  5D3T A;  2R0Y A;  4NR8 A;  5FFY A;  5LJ2 A;  5FH8 A;  5LUU A;  3UV4 A;  5CQA A;  5FE4 A;  4BJX A;  4QB3 A;  5CPE A;  5J0D A;  2RS9 B;  4Z1Q A;  5FFW A;  3IU5 A;  2F6J A;  3SVG A;  4QST A;  5G4R A;  2RI7 A;  5JI8 A;  4PS5 A;  3P1C A;  4A9J A;  5EGU A;  4QYL A;  3UV2 A;  4YH3 A;  3ZYU A;  5I29 A;  3G0L A;  3IU6 A;  5D3P A;  5EM3 A;  4LZ2 A;  4PTB A;  3D1D A;  3MUL A;  4O71 A;  4O7A A;  4YYK A;  4UYH A;  4QEW A;  4UYD A;  4NUC A;  5AD2 A;  5FB1 A;  5AME A;  5D24 A;  1PUO A;  5A5R A;  4WIV A;  4LDF A;  4A9K A;  5EWW A;  3P1E A;  5BT3 A;  4J3I A;  3JVJ A;  5I83 A;  5C85 A;  3AAD A;  3O34 A;  2YQD A;  5IBN A;  4O75 A;  5FE7 A;  5TCM A;  4A9I A;  4Z6I A;  4C67 A;  5DBM A;  5EPS A;  4YYN A;  4TU6 A;  5LKZ A;  4HXO A;  5BT4 A;  4PCI A;  5ETD A;  4CUP A;  4A9F A;  4A9L A;  5D3L A;  5KTX A;  4MR5 A;  5LVQ A;  5FE6 A;  5DLX A;  5D3H A;  5L98 A;  3MB4 A;  5EVA A;  3DWY A;  5D3J A;  4HXP A;  3U5O A;  5DKH A;  5I7X A;  1ZS5 A;  5F2P A;  5L99 A;  4QSR A;  5CRM A;  2I8N A;  5COI A;  4HBY A;  5K29 A;  4UYE A;  3JVM A;  5CUG A;  3ONI A;  4O72 A;  4UIZ A;  2E7N A;  4XYA A;  3UVY A;  4ALG A;  5HRV A;  4QSQ A;  5I1Q A;  4AKI A;  5BT5 A;  5I80 A;  2OUO A;  5LJ1 A;  5FE9 A;  5F25 A;  4NYX A;  1JSP B;  4ZQL A;  1N72 A;  5CS8 A;  3UV5 A;  4TZ2 A;  5C8G A;  5EIC A;  4XY9 A;  4QC1 A;  4QUT A;  4YY4 A;  2DWW A;  2R10 A;  2YEM A;  4O7B A;  2R0V A;  4YYJ A;  5CGP A;  5ENC A;  3AQA A;  4IOQ A;  3U5L A;  4LYS A;  5DW2 A;  5L97 A;  2KTB B;  3UVW A;  2OSS A;  4ZC9 A;  5E9V A;  3U5N A;  4A9O A;  4YYH A;  4QZS A;  4YAB A;  3QZV A;  4HXS A;  5DFB A;  3U5P A;  4NR5 A;  2MJV B;  4HXN A;  4UYF B;  4NRA A;  5AD3 A;  5EQ1 A;  4AI6 A;  5DKC A;  3ERR A;  4MEO A;  5C7N A;  4N4G A;  4MEP A;  1ZKR A;  3O37 A;  4QBM A;  5EK9 A;  4OUF A;  5D7X A;  5CQ3 A;  4Q0O A;  5C4Q A;  5TB6 A;  4UIY A;  4UYF A;  4IR6 A;  4LC2 A;  4WHU A;  3QZS A;  5ENB A;  5HJC A;  4NXJ A;  2F6N A;  4DON A;  4GPJ A;  1E6I A;  4LZS A;  3NXB A;  4UIV A;  4NUE A;  4OGI A;  4TYL A;  2YEK A;  2RNX A;  2H60 A;  5E9M A;  5A82 A;  4Z1S A;  5DYU A;  4QSW A;  3JVL A;  4AKG A;  4N4F A;  4QSU A;  4AKH A;  5H1V A;  5DKD A;  5DW1 A;  5C87 A;  5DYA A;  5CQ5 A;  4YK0 A;  4J0S A;  4O70 A;  4UIX A;  4TU4 A;  4YH4 A;  3G0J A;  5LKU A;  4HXR A;  5H1U A;  5HEM A;  3S92 A;  2E7O A;  5I89 A;  5EPB A;  5IG6 A;  4C66 A;  5DY7 A;  5I7Y A;  4YAX A;  5A81 A;  5E74 A;  5FE0 A;  4TS8 A;  4KV4 A;  3JVK A;  4QNS A;  5HLS A;  3DAI A;  4IR5 A;  5EU1 A;  5F1H A;  5EWV A;  5EWC A;  5KO4 A;  2YEL A;  4F3I A;  3UVX A;  3LJW A;  5DLZ A;  5D25 A;  5FE2 A;  5CUD A;  4NUD A;  2OO1 A;  4N4H A;  5CQ8 A;  4BHW A;  4X2I A;  5CQT A;  5FFV A;  5A5N A;  5A5S A;  5EP7 A;  3LXJ A;  5F3A A;  4TT2 A;  3SVF A;  4A9H A;  5F61 A;  4CUS A;  3P5O A;  3HME A;  3LQJ A;  4Z93 A;  5FG4 A;  2YYN A;  4J1P A;  4NQN A;  5DX4 A;  2FSA A;  4IOO A;  4TT6 A;  4LZR A;  2DVQ A;  2DKW A;  4TTE A;  3K2J A;  4CUT A;  4WHW A;  5CQ4 A;  5E9L A;  4OGJ A;  5HEN A;  5I40 A;  4XY8 A;  3O33 A;  5CTL A;  5EWD A;  4HBX A;  5IGL A;  5HRW A;  4XUB A;  4Q0N A;  5EI4 A;  5LKT A;  3P1F A;  4YYM A;  4HXL A;  3O35 A;  5L8T A;  4NRC A;  5HQ6 A;  5A5O A;  5E73 A;  5FE5 A;  5CQ7 A;  1JM4 B;  4QYD A;  5LJ0 A;  2WP1 A;  4QY4 A;  4IR4 A;  2GRC A;  5A85 A;  5FE3 A;  3HMH A;  4CLB A;  4XUA A;  2RO1 A;  5CQ6 A;  5C89 A;  4PY6 A;  4HXM A;  4QR3 A;  4ALH A;  4YYG A;  4O7C A;  3VKH A;  4IOR A;  4QSX A;  5F63 A;  2EJN A;  4IR3 A;  5F36 A;  4QR4 A;  5F62 A;  5F60 A;  5A5P A;  4HXK A;  3Q2F A;  5I86 A;  5FE1 A;  5IGM A;  1F68 A;  3GG3 A;  5DYX A;  5ENF A;  2E3K A;  3HMF A;  4LR6 A;  2D9E A;  5EPR A;  5ETB A;  3MXF A;  4QSV A; 
#chains in the Genus database with same CATH homology
 5EV9 A;  2YW5 A;  4ZW1 A;  3TLP A;  5L96 A;  4O76 A;  3MUK A;  5HM0 A;  4YBS A;  4MEN A;  5CU8 A;  3U5K A;  5II2 A;  4A9E A;  2DAT A;  5HRX A;  4NR9 A;  3D7C A;  5E9Y A;  4CUU A;  2DVV A;  5E3D A;  5FB0 A;  5CRZ A;  5FE8 A;  4YBT A;  2RNW A;  5EWH A;  3LQH A;  5HFQ A;  5DFD A;  3MQM A;  4BW4 A;  2RFJ A;  1EQF A;  4MEQ A;  4TT4 A;  5CZG A;  4QEU A;  5DYC A;  4O7F A;  4UIT A;  4QUU A;  4BW2 A;  4YAD A;  5G4S A;  4BW1 A;  5IID A;  4PKL A;  4O7E A;  5AMF A;  5F5Z A;  4LYI A;  5ENG A;  5D3R A;  3FKM X;  5IGN A;  5KHM A;  3U5M A;  4YY6 A;  4MR6 A;  5D3S A;  5A5Q A;  5ENH A;  2L5E A;  4J0R A;  2R0S A;  4UYG A;  4PCE A;  5ACY A;  4QC3 A;  4YYI A;  4QSS A;  4BW3 A;  4KV1 A;  3O36 A;  3S91 A;  2YDW A;  5FDZ A;  5CUE A;  4FLP A;  3P1D A;  3UW9 A;  5E7D A;  2L85 A;  4KCX A;  4YBM A;  5H1T A;  4UIU A;  5LVR A;  4Z6H A;  5HEL A;  2L84 A;  3QZT A;  4NYV A;  5FH7 A;  4CUR A;  5FH6 A;  5HQ7 A;  4CUQ A;  3SVH A;  5E9K A;  4O78 A;  5CUB A;  4RVR A;  5A7C A;  5ENE A;  4NR4 A;  5HQ5 A;  5EIS A;  5II1 A;  2NXB A;  5ENI A;  4E96 A;  2N9G A;  4N4I A;  5E0R A;  2LSP B;  5EA1 A;  3UVD A;  3RCW A;  5HFR A;  5CY9 A;  5H85 A;  5D3N A;  5FG6 A;  3LQI A;  3Q2E A;  4NRB A;  4UIW A;  4HBW A;  5HCL A;  4LRG A;  3U5J A;  2DVR A;  4NYW A;  5CFW A;  2G4A A;  2RNY A;  5FBX A;  5I88 A;  4TZ8 A;  4O74 A;  4O77 A;  1WUM A;  1WUG A;  5D0C A;  4YAT A;  4NR7 A;  4LYW A;  1X0J A;  5D26 A;  5KU3 A;  4QSP A;  4A9M A;  4QEV A;  5DFC A;  4N3W A;  5A83 A;  5KTW A;  5CP5 A;  3MB3 A;  5LKX A;  5JWM A;  4QR5 A;  4CFK A;  5CUC A;  2I7K A;  4A9N A;  5CUA A;  4MR3 A;  4CFL A;  4NQM A;  4YC9 A;  5E3G A;  5L8U A;  5KTU A;  4Y03 A;  5E9I A;  4YYD A;  3I3J A;  4HBV A;  2WP2 A;  4TQN A;  4MR4 A;  2D82 A;  4NR6 A;  5ENJ A;  5F1L A;  5IGK A;  2DVS A;  4NS5 A;  4AKN A;  4CL9 A;  5FG5 A;  5D3T A;  2R0Y A;  4NR8 A;  5FFY A;  5LJ2 A;  5FH8 A;  5LUU A;  3UV4 A;  5CQA A;  5FE4 A;  4BJX A;  4QB3 A;  5CPE A;  5J0D A;  2RS9 B;  4Z1Q A;  5FFW A;  3IU5 A;  2F6J A;  3SVG A;  4QST A;  5G4R A;  2RI7 A;  5JI8 A;  4PS5 A;  3P1C A;  4A9J A;  5EGU A;  4QYL A;  3UV2 A;  4YH3 A;  3ZYU A;  5I29 A;  3IU6 A;  3G0L A;  5D3P A;  5EM3 A;  4LZ2 A;  4PTB A;  3MUL A;  4O71 A;  4O7A A;  4YYK A;  4UYH A;  4QEW A;  4UYD A;  4NUC A;  5AD2 A;  5FB1 A;  5AME A;  5D24 A;  5A5R A;  4WIV A;  4LDF A;  4A9K A;  5EWW A;  3P1E A;  5BT3 A;  4J3I A;  3JVJ A;  5I83 A;  5C85 A;  3AAD A;  3O34 A;  2YQD A;  5IBN A;  4O75 A;  5FE7 A;  5TCM A;  4A9I A;  4Z6I A;  4C67 A;  5DBM A;  5EPS A;  4YYN A;  4TU6 A;  5LKZ A;  4HXO A;  5BT4 A;  4PCI A;  5ETD A;  4CUP A;  4A9F A;  4A9L A;  5D3L A;  5KTX A;  4MR5 A;  5LVQ A;  5FE6 A;  5DLX A;  5D3H A;  5L98 A;  3MB4 A;  5EVA A;  3DWY A;  5D3J A;  4HXP A;  3U5O A;  5DKH A;  5I7X A;  1ZS5 A;  5F2P A;  5L99 A;  4QSR A;  5CRM A;  2I8N A;  5COI A;  4HBY A;  5K29 A;  4UYE A;  3JVM A;  5CUG A;  3ONI A;  4O72 A;  4UIZ A;  2E7N A;  4XYA A;  3UVY A;  4ALG A;  5HRV A;  4QSQ A;  5I1Q A;  5BT5 A;  5I80 A;  2OUO A;  5LJ1 A;  5FE9 A;  5F25 A;  4NYX A;  1JSP B;  4ZQL A;  1N72 A;  5CS8 A;  3UV5 A;  4TZ2 A;  5C8G A;  5EIC A;  4XY9 A;  4QC1 A;  4QUT A;  4YY4 A;  2DWW A;  2R10 A;  2YEM A;  4O7B A;  2R0V A;  4YYJ A;  5CGP A;  5ENC A;  3AQA A;  4IOQ A;  3U5L A;  4LYS A;  5DW2 A;  5L97 A;  2KTB B;  3UVW A;  2OSS A;  4ZC9 A;  5E9V A;  3U5N A;  4A9O A;  4YYH A;  4QZS A;  4YAB A;  3QZV A;  4HXS A;  5DFB A;  3U5P A;  4NR5 A;  2MJV B;  4HXN A;  4UYF B;  4NRA A;  5AD3 A;  5EQ1 A;  5DKC A;  4MEO A;  5C7N A;  4N4G A;  4MEP A;  3O37 A;  4QBM A;  5EK9 A;  4OUF A;  5D7X A;  5CQ3 A;  4Q0O A;  5C4Q A;  5TB6 A;  4UIY A;  4UYF A;  4IR6 A;  4LC2 A;  4WHU A;  3QZS A;  5ENB A;  5HJC A;  4NXJ A;  2F6N A;  4DON A;  4GPJ A;  1E6I A;  4LZS A;  3NXB A;  4UIV A;  4NUE A;  4OGI A;  4TYL A;  2YEK A;  2RNX A;  2H60 A;  5E9M A;  5A82 A;  4Z1S A;  5DYU A;  4QSW A;  3JVL A;  4N4F A;  4QSU A;  5H1V A;  5DKD A;  5DW1 A;  5C87 A;  5DYA A;  5CQ5 A;  4YK0 A;  4J0S A;  4O70 A;  4UIX A;  4TU4 A;  4YH4 A;  3G0J A;  5LKU A;  4HXR A;  5H1U A;  5HEM A;  3S92 A;  2E7O A;  5I89 A;  5EPB A;  5IG6 A;  4C66 A;  5DY7 A;  5I7Y A;  4YAX A;  5A81 A;  5E74 A;  5FE0 A;  4TS8 A;  4KV4 A;  3JVK A;  4QNS A;  5HLS A;  3DAI A;  4IR5 A;  5EU1 A;  5F1H A;  5EWV A;  5EWC A;  5KO4 A;  2YEL A;  4F3I A;  3UVX A;  3LJW A;  5DLZ A;  5D25 A;  5FE2 A;  5CUD A;  4NUD A;  2OO1 A;  4N4H A;  5CQ8 A;  4BHW A;  4X2I A;  5CQT A;  5FFV A;  5A5N A;  5A5S A;  5EP7 A;  3LXJ A;  5F3A A;  4TT2 A;  3SVF A;  4A9H A;  5F61 A;  4CUS A;  3P5O A;  3HME A;  3LQJ A;  4Z93 A;  5FG4 A;  2YYN A;  4J1P A;  4NQN A;  5DX4 A;  2FSA A;  4IOO A;  4TT6 A;  4LZR A;  2DVQ A;  2DKW A;  4TTE A;  3K2J A;  4CUT A;  4WHW A;  5CQ4 A;  5E9L A;  4OGJ A;  5HEN A;  5I40 A;  4XY8 A;  3O33 A;  5CTL A;  5EWD A;  4HBX A;  5IGL A;  5HRW A;  4XUB A;  4Q0N A;  5EI4 A;  5LKT A;  3P1F A;  4YYM A;  4HXL A;  3O35 A;  5L8T A;  4NRC A;  5HQ6 A;  5A5O A;  5E73 A;  5FE5 A;  5CQ7 A;  1JM4 B;  4QYD A;  5LJ0 A;  2WP1 A;  4QY4 A;  4IR4 A;  2GRC A;  5A85 A;  5FE3 A;  3HMH A;  4CLB A;  4XUA A;  2RO1 A;  5CQ6 A;  5C89 A;  4PY6 A;  4HXM A;  4QR3 A;  4ALH A;  4YYG A;  4O7C A;  4IOR A;  4QSX A;  5F63 A;  4IR3 A;  5F36 A;  4QR4 A;  5F62 A;  5F60 A;  5A5P A;  4HXK A;  3Q2F A;  5I86 A;  5FE1 A;  5IGM A;  1F68 A;  3GG3 A;  5DYX A;  5ENF A;  2E3K A;  3HMF A;  4LR6 A;  2D9E A;  5EPR A;  5ETB A;  3MXF A;  4QSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...