4LYWA

Crystal structure of brd4(1) bound to inhibitor xd14
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
127
structure length
127
Chain Sequence
AMNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/inhibitor
molecule keywords Bromodomain-containing protein 4
publication title 4-Acyl pyrroles: mimicking acetylated lysines in histone code reading.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4lywA01
3HMFA 4O7BA 5DW1A 5E73A 5LKXA 5D3SA 4QUTA 4UIUA 4TU6A 4HXKA 2LSPB 5D0CA 4ZW1A 4YYNA 2I7KA 4DONA 4TZ8A 2DATA 4XUAA 5HELA 4YBSA 3UW9A 2D82A 4QC1A 5A85A 5IGNA 5DLXA 5HENA 5F60A 4YYKA 4UIVA 4AKNA 4LYWA 5J0DA 5F5ZA 5D3PA 5K29A 4PTBA 4YYJA 3P1FA 2E3KA 4X2IA 5EWWA 5G4SA 4QSUA 5HQ7A 3QZVA 4LR6A 5EI4A 1F68A 2L5EA 3QZSA 4WIVA 4O70A 2E7NA 4IOOA 4YBTA 4MR4A 4A9LA 4HXOA 4YH4A 5CZGA 5DFDA 4IR3A 3RCWA 3S91A 4OUFA 4QSWA 5ACYA 3S92A 5EPRA 5CUEA 4BW1A 3MB4A 5EM3A 5ENEA 5FE5A 5FE3A 4YATA 5CP5A 4A9FA 5E7DA 5LJ2A 4HXLA 4TQNA 5FE8A 4O7FA 5AMEA 5IG6A 4BW3A 4J0RA 4NYXA 4A9KA 4YAXA 5F1HA 5H1TA 4NR6A 5D3HA 5D3TA 2KTBB 5D3LA 5DKCA 4BW2A 5F25A 2E7OA 4LZRA 5FG6A 4LZSA 4O76A 2WP1A 5I89A 4KV1A 5FH7A 5LJ0A 2L84A 3O35A 4LZ2A 5A5SA 3UV5A 5KU3A 5CQ3A 5DKDA 2R0YA 3QZTA 4J3IA 5HLSA 3SVFA 4TYLA 3MQMA 4QR3A 5H1UA 5BT5A 4PY6A 4LYIA 5DKHA 1EQFA 3U5KA 5I1QA 4QSVA 4CFLA 4CURA 5TB6A 3ZYUA 5CUBA 4QR4A 4IR6A 4IR5A 2RNYA 5CUAA 5KTUA 5CQ4A 4PKLA 2I8NA 2RFJA 4LYSA 4UIXA 4QEUA 5AMFA 2F6JA 4WHWA 4YK0A 3MB3A 4NQMA 4HXPA 2OUOA 3K2JA 5FE7A 2RO1A 4TU4A 5E3DA 4Z1SA 4QSXA 4A9OA 1ZS5A 5I86A 5I83A 4QY4A 3UVDA 5IIDA 4A9NA 5HEMA 5LVRA 5F62A 4O75A 5II2A 5EICA 3MUKA 4PS5A 1WUMA 1WUGA 5IBNA 4YYHA 4RVRA 2DKWA 5TCMA 5LKTA 4QNSA 5LVQA 4UYHA 4NUCA 4IR4A 3UV2A 4QSPA 4UIYA 4MR3A 4UYDA 5E0RA 2OSSA 5D3NA 5F63A 4QEWA 5CUDA 4XY8A 5COIA 5C4QA 3U5LA 3HMHA 3O33A 3D7CA 4TT4A 4HBWA 5I80A 4CUUA 5DX4A 4ZC9A 5ENCA 3U5NA 4IORA 4N4GA 4QSQA 4NRCA 5FB0A 4NQNA 4BW4A 5EV9A 4MR5A 4MEQA 3U5OA 3P5OA 5CGPA 5FE2A 4UYEA 4C67A 3IU6A 4A9MA 3NXBA 2YEKA 5CQTA 2G4AA 5D3JA 3JVJA 4QYDA 4WHUA 4Z6IA 4QBMA 3TLPA 5A5RA 5HM0A 4HXNA 5A5QA 4YC9A 4A9EA 2D9EA 4QYLA 5FG5A 4TT2A 5KTWA 5KTXA 4HBYA 4TZ2A 4O7EA 5ENIA 5ENHA 5FE6A 5G4RA 5DYAA 5A7CA 4PCIA 4F3IA 5FDZA 3DWYA 5CQ5A 5I7XA 4YY6A 4QB3A 3O36A 2RNWA 4TT6A 3G0LA 4NR7A 5CRZA 5CUCA 5ENJA 5AD2A 4YH3A 4QC3A 5EK9A 5E74A 5CPEA 5A83A 3Q2EA 3LQJA 4O7AA 4YBMA 4BJXA 5ENGA 4YYDA 5E3GA 5HFQA 4CUQA 4O77A 5E9KA 4HXRA 5EGUA 5II1A 2DWWA 5CQ7A 3JVLA 5CQ8A 5A81A 4UIWA 2NXBA 4NXJA 4Z1QA 5HRVA 5LKUA 4MEOA 5DYCA 4UYFA 5LUUA 2OO1A 5HJCA 2R0VA 4UITA 5JI8A 3U5PA 5FH6A 2WP2A 4KV4A 3ONIA 5F2PA 5HFRA 2RI7A 5DFCA 4A9JA 5IGKA 3LXJA 5C89A 4A9IA 5L8TA 5L99A 4TTEA 2YQDA 1JM4B 4UYGA 2DVQA 4NRBA 2R10A 5CU8A 2YYNA 5EWDA 4HXSA 5FFVA 4NYWA 4CUSA 4N4FA 3FKMX 5HQ5A 5A5NA 4O7CA 4NYVA 5ENBA 5E9LA 2L85A 2R0SA 5CRMA 5FBXA 3AADA 4QSTA 4Q0OA 5EISA 5E9IA 5H1VA 3UVWA 4NR9A 2MJVB 4GPJA 4OGJA 5ETDA 5FB1A 4NS5A 5L96A 5F1LA 5DYXA 2GRCA 5ETBA 5C8GA 4O74A 5EWHA 3HMEA 5KO4A 5A82A 5I29A 5DW2A 4A9HA 5EPSA 4YABA 4ZQLA 4QSRA 5I40A 5A5PA 3I3JA 4Y03A 5L8UA 5EU1A 4O78A 5L97A 2YW5A 2F6NA 4KCXA 5DLZA 5FE4A 4YYIA 5C87A 4CL9A 5FG4A 3G0JA 5EWCA 4OGIA 4Q0NA 3P1DA 4HBVA 5DYUA 2DVSA 5CQ6A 4NR8A 5HRXA 5FE9A 4E96A 5EVAA 5L98A 5D7XA 5D26A 2FSAA 4NR5A 4QEVA 4TS8A 3Q2FA 5FH8A 5D25A 3MXFA 4YADA 5HCLA 5IGMA 2YDWA 4YY4A 4YYMA 5F61A 3JVMA 2YEMA 4HXMA 4QR5A 4CFKA 4O71A 4NRAA 5HQ6A 5C85A 4C66A 4J1PA 4O72A 4ALHA 5LJ1A 4CLBA 5BT4A 5F36A 4HBXA 5FFWA 4Z93A 4LDFA 4UIZA 4NUEA 5EA1A 1JSPB 5CTLA 5DY7A 4NUDA 3UV4A 5IGLA 2DVRA 4QSSA 4MEPA 4PCEA 4CUTA 4XY9A 4MR6A 5CS8A 4N3WA 4BHWA 2RS9B 4CUPA 3SVGA 4XYAA 5A5OA 3U5JA 3GG3A 3JVKA 5CQAA 3UVYA 2H60A 5E9YA 5CUGA 3O37A 5EP7A 3IU5A 1E6IA 5DFBA 4LC2A 4NR4A 4ALGA 4Z6HA 4IOQA 5CFWA 5D3RA 5CY9A 5EWVA 3DAIA 3LQIA 5H85A 5D24A 5FE1A 4MENA 3MULA 5BT3A 5LKZA 5EQ1A 4J0SA 3AQAA 5E9VA 1X0JA 3P1EA 3P1CA 4FLPA 3LQHA 5EPBA 5C7NA 5F3AA 3O34A 2N9GA 4LRGA 4QUUA 4UYFB 5KHMA 4N4HA 4QZSA 5HRWA 3SVHA 5ENFA 5E9MA 5FFYA 5I7YA 5AD3A 2YELA 5FE0A 3U5MA 1N72A 4XUBA 2DVVA 3LJWA 2RNXA 4N4IA 5DBMA 5JWMA 4YYGA 5I88A 3UVXA
chains in the Genus database with same CATH superfamily
3HMFA 4O7BA 5DW1A 5E73A 5LKXA 5D3SA 4QUTA 4UIUA 4TU6A 4HXKA 2LSPB 5D0CA 4ZW1A 4YYNA 1ZKRA 2I7KA 4DONA 4TZ8A 2DATA 4XUAA 5HELA 4YBSA 3UW9A 2D82A 4QC1A 5A85A 3D1DA 5IGNA 5DLXA 5HENA 5F60A 4YYKA 4AKGA 4UIVA 4AKNA 4LYWA 5J0DA 5F5ZA 5D3PA 5K29A 4PTBA 4YYJA 3P1FA 2E3KA 4X2IA 5EWWA 5G4SA 3VKGA 4QSUA 5HQ7A 3QZVA 4AKIA 4LR6A 5EI4A 1F68A 2L5EA 3QZSA 4WIVA 3D1BA 4O70A 2E7NA 4IOOA 4YBTA 4MR4A 4A9LA 4HXOA 4YH4A 5CZGA 5DFDA 4IR3A 3RCWA 3S91A 4OUFA 4QSWA 5ACYA 3S92A 5EPRA 5CUEA 4BW1A 3MB4A 5EM3A 5ENEA 3VKHA 5FE5A 5FE3A 4YATA 5CP5A 4A9FA 5E7DA 5LJ2A 4HXLA 4TQNA 5FE8A 4O7FA 5AMEA 5IG6A 4BW3A 4J0RA 4NYXA 4A9KA 4AKHA 4YAXA 5F1HA 5H1TA 4NR6A 5D3HA 5D3TA 2KTBB 5D3LA 5DKCA 4BW2A 5F25A 2E7OA 4LZRA 5FG6A 4LZSA 4O76A 2WP1A 5I89A 4KV1A 5FH7A 5LJ0A 2L84A 3O35A 4LZ2A 5A5SA 3UV5A 5KU3A 5CQ3A 5DKDA 2R0YA 3QZTA 4J3IA 5HLSA 3SVFA 4TYLA 3MQMA 4QR3A 5H1UA 5BT5A 4PY6A 4LYIA 5DKHA 1EQFA 3U5KA 5I1QA 4QSVA 4CFLA 4CURA 5TB6A 3ZYUA 5CUBA 4QR4A 4IR6A 4IR5A 2RNYA 5CUAA 5KTUA 5CQ4A 4PKLA 2I8NA 2RFJA 4LYSA 4UIXA 4QEUA 5AMFA 2F6JA 4WHWA 4YK0A 3MB3A 4NQMA 4HXPA 2OUOA 3K2JA 5FE7A 2RO1A 4TU4A 5E3DA 4Z1SA 4QSXA 4A9OA 1ZS5A 5I86A 5I83A 4QY4A 3UVDA 5IIDA 4A9NA 5HEMA 5LVRA 5F62A 4O75A 5II2A 5EICA 3MUKA 4PS5A 1WUMA 1WUGA 5IBNA 4YYHA 4RVRA 2DKWA 5TCMA 5LKTA 4QNSA 5LVQA 4UYHA 4NUCA 4IR4A 3UV2A 4QSPA 4UIYA 4MR3A 4UYDA 5E0RA 2OSSA 5D3NA 5F63A 4QEWA 5CUDA 4XY8A 5COIA 5C4QA 3U5LA 3HMHA 3O33A 3D7CA 4TT4A 4HBWA 5I80A 4CUUA 5DX4A 4ZC9A 5ENCA 3U5NA 4IORA 4N4GA 4QSQA 4NRCA 5FB0A 4NQNA 4BW4A 5EV9A 4MR5A 4MEQA 3U5OA 3P5OA 5CGPA 5FE2A 4UYEA 4C67A 3IU6A 4A9MA 3NXBA 2YEKA 5CQTA 2G4AA 5D3JA 3JVJA 4QYDA 4WHUA 4Z6IA 4QBMA 3TLPA 5A5RA 5HM0A 4HXNA 5A5QA 4YC9A 4A9EA 2D9EA 4QYLA 5FG5A 4TT2A 5KTWA 5KTXA 4HBYA 4TZ2A 4O7EA 5ENIA 5ENHA 5FE6A 5G4RA 5DYAA 5A7CA 4PCIA 4F3IA 5FDZA 3DWYA 5CQ5A 5I7XA 4YY6A 4QB3A 3O36A 2RNWA 4TT6A 3G0LA 4NR7A 5CRZA 5CUCA 5ENJA 5AD2A 4YH3A 4AI6A 4QC3A 1PUOA 5EK9A 5E74A 5CPEA 5A83A 3Q2EA 3LQJA 4O7AA 4YBMA 4BJXA 5ENGA 4YYDA 5E3GA 5HFQA 4CUQA 4O77A 5E9KA 4HXRA 5EGUA 5II1A 2DWWA 5CQ7A 3JVLA 5CQ8A 5A81A 4UIWA 2NXBA 4NXJA 4Z1QA 5HRVA 5LKUA 4MEOA 5DYCA 4UYFA 5LUUA 2OO1A 5HJCA 2R0VA 4UITA 5JI8A 3U5PA 5FH6A 2WP2A 4KV4A 3ONIA 5F2PA 5HFRA 2RI7A 5DFCA 4A9JA 5IGKA 3LXJA 5C89A 4A9IA 5L8TA 5L99A 4TTEA 2YQDA 1JM4B 4UYGA 2DVQA 4NRBA 2R10A 5CU8A 2YYNA 5EWDA 4HXSA 5FFVA 4NYWA 4CUSA 4N4FA 3FKMX 5HQ5A 5A5NA 4O7CA 4NYVA 5ENBA 5E9LA 2L85A 2R0SA 5CRMA 5FBXA 3AADA 4QSTA 4Q0OA 5EISA 5E9IA 5H1VA 3UVWA 4NR9A 2MJVB 4GPJA 4OGJA 5ETDA 5FB1A 4NS5A 5L96A 5F1LA 5DYXA 2GRCA 5ETBA 5C8GA 4O74A 5EWHA 3HMEA 5KO4A 5A82A 5I29A 5DW2A 4A9HA 5EPSA 4YABA 4ZQLA 4QSRA 5I40A 5A5PA 3I3JA 4Y03A 5L8UA 5EU1A 4O78A 5L97A 2YW5A 2F6NA 4KCXA 5DLZA 5FE4A 4YYIA 5C87A 4CL9A 5FG4A 3G0JA 5EWCA 2EJNA 4OGIA 4Q0NA 3P1DA 4HBVA 5DYUA 2DVSA 5CQ6A 4NR8A 5HRXA 5FE9A 4E96A 5EVAA 5L98A 5D7XA 5D26A 2FSAA 4NR5A 4QEVA 4TS8A 3Q2FA 5FH8A 5D25A 3MXFA 4YADA 5HCLA 5IGMA 2YDWA 4YY4A 4YYMA 5F61A 3JVMA 2YEMA 4HXMA 4QR5A 4CFKA 4O71A 4NRAA 5HQ6A 5C85A 4C66A 4J1PA 4O72A 4ALHA 5LJ1A 4CLBA 5BT4A 5F36A 4HBXA 5FFWA 4Z93A 4LDFA 4UIZA 4NUEA 5EA1A 1JSPB 5CTLA 5DY7A 4NUDA 3UV4A 5IGLA 2DVRA 4QSSA 4MEPA 4PCEA 4CUTA 4XY9A 4MR6A 5CS8A 4N3WA 4BHWA 2RS9B 4CUPA 3SVGA 4XYAA 5A5OA 3U5JA 3GG3A 3JVKA 5CQAA 3UVYA 2H60A 5E9YA 5CUGA 3ERRA 3O37A 5EP7A 3IU5A 1E6IA 5DFBA 4LC2A 4NR4A 4ALGA 4Z6HA 4IOQA 5CFWA 5D3RA 5CY9A 5EWVA 3DAIA 3LQIA 5H85A 5D24A 5FE1A 4MENA 3MULA 5BT3A 5LKZA 5EQ1A 4J0SA 3AQAA 5E9VA 1X0JA 3P1EA 3P1CA 4FLPA 3LQHA 5EPBA 5C7NA 5F3AA 3O34A 2N9GA 4LRGA 4QUUA 4UYFB 5KHMA 4N4HA 4QZSA 5HRWA 3SVHA 5ENFA 5E9MA 5FFYA 5I7YA 5AD3A 2YELA 5FE0A 3U5MA 1N72A 4XUBA 2DVVA 3LJWA 2RNXA 4N4IA 5DBMA 5JWMA 4YYGA 5I88A 3UVXA
chains in the Genus database with same CATH topology
3HMFA 4O7BA 5DW1A 5E73A 5LKXA 5D3SA 4QUTA 4UIUA 4TU6A 4HXKA 2LSPB 5D0CA 4ZW1A 4YYNA 2I7KA 4DONA 4TZ8A 2DATA 4XUAA 5HELA 4YBSA 3UW9A 2D82A 4QC1A 5A85A 5IGNA 5DLXA 5HENA 5F60A 4YYKA 4UIVA 4AKNA 4LYWA 5J0DA 5F5ZA 5D3PA 5K29A 4PTBA 4YYJA 3P1FA 2E3KA 4X2IA 5EWWA 5G4SA 4QSUA 5HQ7A 3QZVA 4LR6A 5EI4A 1F68A 2L5EA 3QZSA 4WIVA 4O70A 2E7NA 4IOOA 4YBTA 4MR4A 4A9LA 4HXOA 4YH4A 5CZGA 5DFDA 4IR3A 3RCWA 3S91A 4OUFA 4QSWA 5ACYA 3S92A 5EPRA 5CUEA 4BW1A 3MB4A 5EM3A 5ENEA 5FE5A 5FE3A 4YATA 5CP5A 4A9FA 5E7DA 5LJ2A 4HXLA 4TQNA 5FE8A 4O7FA 5AMEA 5IG6A 4BW3A 4J0RA 4NYXA 4A9KA 4YAXA 5F1HA 5H1TA 4NR6A 5D3HA 5D3TA 2KTBB 5D3LA 5DKCA 4BW2A 5F25A 2E7OA 4LZRA 5FG6A 4LZSA 4O76A 2WP1A 5I89A 4KV1A 5FH7A 5LJ0A 2L84A 3O35A 4LZ2A 5A5SA 3UV5A 5KU3A 5CQ3A 5DKDA 2R0YA 3QZTA 4J3IA 5HLSA 3SVFA 4TYLA 3MQMA 4QR3A 5H1UA 5BT5A 4PY6A 4LYIA 5DKHA 1EQFA 3U5KA 5I1QA 4QSVA 4CFLA 4CURA 5TB6A 3ZYUA 5CUBA 4QR4A 4IR6A 4IR5A 2RNYA 5CUAA 5KTUA 5CQ4A 4PKLA 2I8NA 2RFJA 4LYSA 4UIXA 4QEUA 5AMFA 2F6JA 4WHWA 4YK0A 3MB3A 4NQMA 4HXPA 2OUOA 3K2JA 5FE7A 2RO1A 4TU4A 5E3DA 4Z1SA 4QSXA 4A9OA 1ZS5A 5I86A 5I83A 4QY4A 3UVDA 5IIDA 4A9NA 5HEMA 5LVRA 5F62A 4O75A 5II2A 5EICA 3MUKA 4PS5A 1WUMA 1WUGA 5IBNA 4YYHA 4RVRA 2DKWA 5TCMA 5LKTA 4QNSA 5LVQA 4UYHA 4NUCA 4IR4A 3UV2A 4QSPA 4UIYA 4MR3A 4UYDA 5E0RA 2OSSA 5D3NA 5F63A 4QEWA 5CUDA 4XY8A 5COIA 5C4QA 3U5LA 3HMHA 3O33A 3D7CA 4TT4A 4HBWA 5I80A 4CUUA 5DX4A 4ZC9A 5ENCA 3U5NA 4IORA 4N4GA 4QSQA 4NRCA 5FB0A 4NQNA 4BW4A 5EV9A 4MR5A 4MEQA 3U5OA 3P5OA 5CGPA 5FE2A 4UYEA 4C67A 3IU6A 4A9MA 3NXBA 2YEKA 5CQTA 2G4AA 5D3JA 3JVJA 4QYDA 4WHUA 4Z6IA 4QBMA 3TLPA 5A5RA 5HM0A 4HXNA 5A5QA 4YC9A 4A9EA 2D9EA 4QYLA 5FG5A 4TT2A 5KTWA 5KTXA 4HBYA 4TZ2A 4O7EA 5ENIA 5ENHA 5FE6A 5G4RA 5DYAA 5A7CA 4PCIA 4F3IA 5FDZA 3DWYA 5CQ5A 5I7XA 4YY6A 4QB3A 3O36A 2RNWA 4TT6A 3G0LA 4NR7A 5CRZA 5CUCA 5ENJA 5AD2A 4YH3A 4QC3A 5EK9A 5E74A 5CPEA 5A83A 3Q2EA 3LQJA 4O7AA 4YBMA 4BJXA 5ENGA 4YYDA 5E3GA 5HFQA 4CUQA 4O77A 5E9KA 4HXRA 5EGUA 5II1A 2DWWA 5CQ7A 3JVLA 5CQ8A 5A81A 4UIWA 2NXBA 4NXJA 4Z1QA 5HRVA 5LKUA 4MEOA 5DYCA 4UYFA 5LUUA 2OO1A 5HJCA 2R0VA 4UITA 5JI8A 3U5PA 5FH6A 2WP2A 4KV4A 3ONIA 5F2PA 5HFRA 2RI7A 5DFCA 4A9JA 5IGKA 3LXJA 5C89A 4A9IA 5L8TA 5L99A 4TTEA 2YQDA 1JM4B 4UYGA 2DVQA 4NRBA 2R10A 5CU8A 2YYNA 5EWDA 4HXSA 5FFVA 4NYWA 4CUSA 4N4FA 3FKMX 5HQ5A 5A5NA 4O7CA 4NYVA 5ENBA 5E9LA 2L85A 2R0SA 5CRMA 5FBXA 3AADA 4QSTA 4Q0OA 5EISA 5E9IA 5H1VA 3UVWA 4NR9A 2MJVB 4GPJA 4OGJA 5ETDA 5FB1A 4NS5A 5L96A 5F1LA 5DYXA 2GRCA 5ETBA 5C8GA 4O74A 5EWHA 3HMEA 5KO4A 5A82A 5I29A 5DW2A 4A9HA 5EPSA 4YABA 4ZQLA 4QSRA 5I40A 5A5PA 3I3JA 4Y03A 5L8UA 5EU1A 4O78A 5L97A 2YW5A 2F6NA 4KCXA 5DLZA 5FE4A 4YYIA 5C87A 4CL9A 5FG4A 3G0JA 5EWCA 4OGIA 4Q0NA 3P1DA 4HBVA 5DYUA 2DVSA 5CQ6A 4NR8A 5HRXA 5FE9A 4E96A 5EVAA 5L98A 5D7XA 5D26A 2FSAA 4NR5A 4QEVA 4TS8A 3Q2FA 5FH8A 5D25A 3MXFA 4YADA 5HCLA 5IGMA 2YDWA 4YY4A 4YYMA 5F61A 3JVMA 2YEMA 4HXMA 4QR5A 4CFKA 4O71A 4NRAA 5HQ6A 5C85A 4C66A 4J1PA 4O72A 4ALHA 5LJ1A 4CLBA 5BT4A 5F36A 4HBXA 5FFWA 4Z93A 4LDFA 4UIZA 4NUEA 5EA1A 1JSPB 5CTLA 5DY7A 4NUDA 3UV4A 5IGLA 2DVRA 4QSSA 4MEPA 4PCEA 4CUTA 4XY9A 4MR6A 5CS8A 4N3WA 4BHWA 2RS9B 4CUPA 3SVGA 4XYAA 5A5OA 3U5JA 3GG3A 3JVKA 5CQAA 3UVYA 2H60A 5E9YA 5CUGA 3O37A 5EP7A 3IU5A 1E6IA 5DFBA 4LC2A 4NR4A 4ALGA 4Z6HA 4IOQA 5CFWA 5D3RA 5CY9A 5EWVA 3DAIA 3LQIA 5H85A 5D24A 5FE1A 4MENA 3MULA 5BT3A 5LKZA 5EQ1A 4J0SA 3AQAA 5E9VA 1X0JA 3P1EA 3P1CA 4FLPA 3LQHA 5EPBA 5C7NA 5F3AA 3O34A 2N9GA 4LRGA 4QUUA 4UYFB 5KHMA 4N4HA 4QZSA 5HRWA 3SVHA 5ENFA 5E9MA 5FFYA 5I7YA 5AD3A 2YELA 5FE0A 3U5MA 1N72A 4XUBA 2DVVA 3LJWA 2RNXA 4N4IA 5DBMA 5JWMA 4YYGA 5I88A 3UVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HMF A;  4O7B A;  5DW1 A;  5E73 A;  5LKX A;  5D3S A;  4QUT A;  4UIU A;  4TU6 A;  4HXK A;  2LSP B;  5D0C A;  4ZW1 A;  4YYN A;  2I7K A;  4DON A;  4TZ8 A;  2DAT A;  4XUA A;  5HEL A;  4YBS A;  3UW9 A;  2D82 A;  4QC1 A;  5A85 A;  5IGN A;  5DLX A;  5HEN A;  5F60 A;  4YYK A;  4UIV A;  4AKN A;  4LYW A;  5J0D A;  5F5Z A;  5D3P A;  5K29 A;  4PTB A;  4YYJ A;  3P1F A;  2E3K A;  4X2I A;  5EWW A;  5G4S A;  4QSU A;  5HQ7 A;  3QZV A;  4LR6 A;  5EI4 A;  1F68 A;  2L5E A;  3QZS A;  4WIV A;  4O70 A;  2E7N A;  4IOO A;  4YBT A;  4MR4 A;  4A9L A;  4HXO A;  4YH4 A;  5CZG A;  5DFD A;  4IR3 A;  3RCW A;  3S91 A;  4OUF A;  4QSW A;  5ACY A;  3S92 A;  5EPR A;  5CUE A;  4BW1 A;  3MB4 A;  5EM3 A;  5ENE A;  5FE5 A;  5FE3 A;  4YAT A;  5CP5 A;  4A9F A;  5E7D A;  5LJ2 A;  4HXL A;  4TQN A;  5FE8 A;  4O7F A;  5AME A;  5IG6 A;  4BW3 A;  4J0R A;  4NYX A;  4A9K A;  4YAX A;  5F1H A;  5H1T A;  4NR6 A;  5D3H A;  5D3T A;  2KTB B;  5D3L A;  5DKC A;  4BW2 A;  5F25 A;  2E7O A;  4LZR A;  5FG6 A;  4LZS A;  4O76 A;  2WP1 A;  5I89 A;  4KV1 A;  5FH7 A;  5LJ0 A;  2L84 A;  3O35 A;  4LZ2 A;  5A5S A;  3UV5 A;  5KU3 A;  5CQ3 A;  5DKD A;  2R0Y A;  3QZT A;  4J3I A;  5HLS A;  3SVF A;  4TYL A;  3MQM A;  4QR3 A;  5H1U A;  5BT5 A;  4PY6 A;  4LYI A;  5DKH A;  1EQF A;  3U5K A;  5I1Q A;  4QSV A;  4CFL A;  4CUR A;  5TB6 A;  3ZYU A;  5CUB A;  4QR4 A;  4IR6 A;  4IR5 A;  2RNY A;  5CUA A;  5KTU A;  5CQ4 A;  4PKL A;  2I8N A;  2RFJ A;  4LYS A;  4UIX A;  4QEU A;  5AMF A;  2F6J A;  4WHW A;  4YK0 A;  3MB3 A;  4NQM A;  4HXP A;  2OUO A;  3K2J A;  5FE7 A;  2RO1 A;  4TU4 A;  5E3D A;  4Z1S A;  4QSX A;  4A9O A;  1ZS5 A;  5I86 A;  5I83 A;  4QY4 A;  3UVD A;  5IID A;  4A9N A;  5HEM A;  5LVR A;  5F62 A;  4O75 A;  5II2 A;  5EIC A;  3MUK A;  4PS5 A;  1WUM A;  1WUG A;  5IBN A;  4YYH A;  4RVR A;  2DKW A;  5TCM A;  5LKT A;  4QNS A;  5LVQ A;  4UYH A;  4NUC A;  4IR4 A;  3UV2 A;  4QSP A;  4UIY A;  4MR3 A;  4UYD A;  5E0R A;  2OSS A;  5D3N A;  5F63 A;  4QEW A;  5CUD A;  4XY8 A;  5COI A;  5C4Q A;  3U5L A;  3HMH A;  3O33 A;  3D7C A;  4TT4 A;  4HBW A;  5I80 A;  4CUU A;  5DX4 A;  4ZC9 A;  5ENC A;  3U5N A;  4IOR A;  4N4G A;  4QSQ A;  4NRC A;  5FB0 A;  4NQN A;  4BW4 A;  5EV9 A;  4MR5 A;  4MEQ A;  3U5O A;  3P5O A;  5CGP A;  5FE2 A;  4UYE A;  4C67 A;  3IU6 A;  4A9M A;  3NXB A;  2YEK A;  5CQT A;  2G4A A;  5D3J A;  3JVJ A;  4QYD A;  4WHU A;  4Z6I A;  4QBM A;  3TLP A;  5A5R A;  5HM0 A;  4HXN A;  5A5Q A;  4YC9 A;  4A9E A;  2D9E A;  4QYL A;  5FG5 A;  4TT2 A;  5KTW A;  5KTX A;  4HBY A;  4TZ2 A;  4O7E A;  5ENI A;  5ENH A;  5FE6 A;  5G4R A;  5DYA A;  5A7C A;  4PCI A;  4F3I A;  5FDZ A;  3DWY A;  5CQ5 A;  5I7X A;  4YY6 A;  4QB3 A;  3O36 A;  2RNW A;  4TT6 A;  3G0L A;  4NR7 A;  5CRZ A;  5CUC A;  5ENJ A;  5AD2 A;  4YH3 A;  4QC3 A;  5EK9 A;  5E74 A;  5CPE A;  5A83 A;  3Q2E A;  3LQJ A;  4O7A A;  4YBM A;  4BJX A;  5ENG A;  4YYD A;  5E3G A;  5HFQ A;  4CUQ A;  4O77 A;  5E9K A;  4HXR A;  5EGU A;  5II1 A;  2DWW A;  5CQ7 A;  3JVL A;  5CQ8 A;  5A81 A;  4UIW A;  2NXB A;  4NXJ A;  4Z1Q A;  5HRV A;  5LKU A;  4MEO A;  5DYC A;  4UYF A;  5LUU A;  2OO1 A;  5HJC A;  2R0V A;  4UIT A;  5JI8 A;  3U5P A;  5FH6 A;  2WP2 A;  4KV4 A;  3ONI A;  5F2P A;  5HFR A;  2RI7 A;  5DFC A;  4A9J A;  5IGK A;  3LXJ A;  5C89 A;  4A9I A;  5L8T A;  5L99 A;  4TTE A;  2YQD A;  1JM4 B;  4UYG A;  2DVQ A;  4NRB A;  2R10 A;  5CU8 A;  2YYN A;  5EWD A;  4HXS A;  5FFV A;  4NYW A;  4CUS A;  4N4F A;  3FKM X;  5HQ5 A;  5A5N A;  4O7C A;  4NYV A;  5ENB A;  5E9L A;  2L85 A;  2R0S A;  5CRM A;  5FBX A;  3AAD A;  4QST A;  4Q0O A;  5EIS A;  5E9I A;  5H1V A;  3UVW A;  4NR9 A;  2MJV B;  4GPJ A;  4OGJ A;  5ETD A;  5FB1 A;  4NS5 A;  5L96 A;  5F1L A;  5DYX A;  2GRC A;  5ETB A;  5C8G A;  4O74 A;  5EWH A;  3HME A;  5KO4 A;  5A82 A;  5I29 A;  5DW2 A;  4A9H A;  5EPS A;  4YAB A;  4ZQL A;  4QSR A;  5I40 A;  5A5P A;  3I3J A;  4Y03 A;  5L8U A;  5EU1 A;  4O78 A;  5L97 A;  2YW5 A;  2F6N A;  4KCX A;  5DLZ A;  5FE4 A;  4YYI A;  5C87 A;  4CL9 A;  5FG4 A;  3G0J A;  5EWC A;  4OGI A;  4Q0N A;  3P1D A;  4HBV A;  5DYU A;  2DVS A;  5CQ6 A;  4NR8 A;  5HRX A;  5FE9 A;  4E96 A;  5EVA A;  5L98 A;  5D7X A;  5D26 A;  2FSA A;  4NR5 A;  4QEV A;  4TS8 A;  3Q2F A;  5FH8 A;  5D25 A;  3MXF A;  4YAD A;  5HCL A;  5IGM A;  2YDW A;  4YY4 A;  4YYM A;  5F61 A;  3JVM A;  2YEM A;  4HXM A;  4QR5 A;  4CFK A;  4O71 A;  4NRA A;  5HQ6 A;  5C85 A;  4C66 A;  4J1P A;  4O72 A;  4ALH A;  5LJ1 A;  4CLB A;  5BT4 A;  5F36 A;  4HBX A;  5FFW A;  4Z93 A;  4LDF A;  4UIZ A;  4NUE A;  5EA1 A;  1JSP B;  5CTL A;  5DY7 A;  4NUD A;  3UV4 A;  5IGL A;  2DVR A;  4QSS A;  4MEP A;  4PCE A;  4CUT A;  4XY9 A;  4MR6 A;  5CS8 A;  4N3W A;  4BHW A;  2RS9 B;  4CUP A;  3SVG A;  4XYA A;  5A5O A;  3U5J A;  3GG3 A;  3JVK A;  5CQA A;  3UVY A;  2H60 A;  5E9Y A;  5CUG A;  3O37 A;  5EP7 A;  3IU5 A;  1E6I A;  5DFB A;  4LC2 A;  4NR4 A;  4ALG A;  4Z6H A;  4IOQ A;  5CFW A;  5D3R A;  5CY9 A;  5EWV A;  3DAI A;  3LQI A;  5H85 A;  5D24 A;  5FE1 A;  4MEN A;  3MUL A;  5BT3 A;  5LKZ A;  5EQ1 A;  4J0S A;  3AQA A;  5E9V A;  1X0J A;  3P1E A;  3P1C A;  4FLP A;  3LQH A;  5EPB A;  5C7N A;  5F3A A;  3O34 A;  2N9G A;  4LRG A;  4QUU A;  4UYF B;  5KHM A;  4N4H A;  4QZS A;  5HRW A;  3SVH A;  5ENF A;  5E9M A;  5FFY A;  5I7Y A;  5AD3 A;  2YEL A;  5FE0 A;  3U5M A;  1N72 A;  4XUB A;  2DVV A;  3LJW A;  2RNX A;  4N4I A;  5DBM A;  5JWM A;  4YYG A;  5I88 A;  3UVX A; 
#chains in the Genus database with same CATH topology
 3HMF A;  4O7B A;  5DW1 A;  5E73 A;  5LKX A;  5D3S A;  4QUT A;  4UIU A;  4TU6 A;  4HXK A;  2LSP B;  5D0C A;  4ZW1 A;  4YYN A;  1ZKR A;  2I7K A;  4DON A;  4TZ8 A;  2DAT A;  4XUA A;  5HEL A;  4YBS A;  3UW9 A;  2D82 A;  4QC1 A;  5A85 A;  3D1D A;  5IGN A;  5DLX A;  5HEN A;  5F60 A;  4YYK A;  4AKG A;  4UIV A;  4AKN A;  4LYW A;  5J0D A;  5F5Z A;  5D3P A;  5K29 A;  4PTB A;  4YYJ A;  3P1F A;  2E3K A;  4X2I A;  5EWW A;  5G4S A;  3VKG A;  4QSU A;  5HQ7 A;  3QZV A;  4AKI A;  4LR6 A;  5EI4 A;  1F68 A;  2L5E A;  3QZS A;  4WIV A;  3D1B A;  4O70 A;  2E7N A;  4IOO A;  4YBT A;  4MR4 A;  4A9L A;  4HXO A;  4YH4 A;  5CZG A;  5DFD A;  4IR3 A;  3RCW A;  3S91 A;  4OUF A;  4QSW A;  5ACY A;  3S92 A;  5EPR A;  5CUE A;  4BW1 A;  3MB4 A;  5EM3 A;  5ENE A;  3VKH A;  5FE5 A;  5FE3 A;  4YAT A;  5CP5 A;  4A9F A;  5E7D A;  5LJ2 A;  4HXL A;  4TQN A;  5FE8 A;  4O7F A;  5AME A;  5IG6 A;  4BW3 A;  4J0R A;  4NYX A;  4A9K A;  4AKH A;  4YAX A;  5F1H A;  5H1T A;  4NR6 A;  5D3H A;  5D3T A;  2KTB B;  5D3L A;  5DKC A;  4BW2 A;  5F25 A;  2E7O A;  4LZR A;  5FG6 A;  4LZS A;  4O76 A;  2WP1 A;  5I89 A;  4KV1 A;  5FH7 A;  5LJ0 A;  2L84 A;  3O35 A;  4LZ2 A;  5A5S A;  3UV5 A;  5KU3 A;  5CQ3 A;  5DKD A;  2R0Y A;  3QZT A;  4J3I A;  5HLS A;  3SVF A;  4TYL A;  3MQM A;  4QR3 A;  5H1U A;  5BT5 A;  4PY6 A;  4LYI A;  5DKH A;  1EQF A;  3U5K A;  5I1Q A;  4QSV A;  4CFL A;  4CUR A;  5TB6 A;  3ZYU A;  5CUB A;  4QR4 A;  4IR6 A;  4IR5 A;  2RNY A;  5CUA A;  5KTU A;  5CQ4 A;  4PKL A;  2I8N A;  2RFJ A;  4LYS A;  4UIX A;  4QEU A;  5AMF A;  2F6J A;  4WHW A;  4YK0 A;  3MB3 A;  4NQM A;  4HXP A;  2OUO A;  3K2J A;  5FE7 A;  2RO1 A;  4TU4 A;  5E3D A;  4Z1S A;  4QSX A;  4A9O A;  1ZS5 A;  5I86 A;  5I83 A;  4QY4 A;  3UVD A;  5IID A;  4A9N A;  5HEM A;  5LVR A;  5F62 A;  4O75 A;  5II2 A;  5EIC A;  3MUK A;  4PS5 A;  1WUM A;  1WUG A;  5IBN A;  4YYH A;  4RVR A;  2DKW A;  5TCM A;  5LKT A;  4QNS A;  5LVQ A;  4UYH A;  4NUC A;  4IR4 A;  3UV2 A;  4QSP A;  4UIY A;  4MR3 A;  4UYD A;  5E0R A;  2OSS A;  5D3N A;  5F63 A;  4QEW A;  5CUD A;  4XY8 A;  5COI A;  5C4Q A;  3U5L A;  3HMH A;  3O33 A;  3D7C A;  4TT4 A;  4HBW A;  5I80 A;  4CUU A;  5DX4 A;  4ZC9 A;  5ENC A;  3U5N A;  4IOR A;  4N4G A;  4QSQ A;  4NRC A;  5FB0 A;  4NQN A;  4BW4 A;  5EV9 A;  4MR5 A;  4MEQ A;  3U5O A;  3P5O A;  5CGP A;  5FE2 A;  4UYE A;  4C67 A;  3IU6 A;  4A9M A;  3NXB A;  2YEK A;  5CQT A;  2G4A A;  5D3J A;  3JVJ A;  4QYD A;  4WHU A;  4Z6I A;  4QBM A;  3TLP A;  5A5R A;  5HM0 A;  4HXN A;  5A5Q A;  4YC9 A;  4A9E A;  2D9E A;  4QYL A;  5FG5 A;  4TT2 A;  5KTW A;  5KTX A;  4HBY A;  4TZ2 A;  4O7E A;  5ENI A;  5ENH A;  5FE6 A;  5G4R A;  5DYA A;  5A7C A;  4PCI A;  4F3I A;  5FDZ A;  3DWY A;  5CQ5 A;  5I7X A;  4YY6 A;  4QB3 A;  3O36 A;  2RNW A;  4TT6 A;  3G0L A;  4NR7 A;  5CRZ A;  5CUC A;  5ENJ A;  5AD2 A;  4YH3 A;  4AI6 A;  4QC3 A;  1PUO A;  5EK9 A;  5E74 A;  5CPE A;  5A83 A;  3Q2E A;  3LQJ A;  4O7A A;  4YBM A;  4BJX A;  5ENG A;  4YYD A;  5E3G A;  5HFQ A;  4CUQ A;  4O77 A;  5E9K A;  4HXR A;  5EGU A;  5II1 A;  2DWW A;  5CQ7 A;  3JVL A;  5CQ8 A;  5A81 A;  4UIW A;  2NXB A;  4NXJ A;  4Z1Q A;  5HRV A;  5LKU A;  4MEO A;  5DYC A;  4UYF A;  5LUU A;  2OO1 A;  5HJC A;  2R0V A;  4UIT A;  5JI8 A;  3U5P A;  5FH6 A;  2WP2 A;  4KV4 A;  3ONI A;  5F2P A;  5HFR A;  2RI7 A;  5DFC A;  4A9J A;  5IGK A;  3LXJ A;  5C89 A;  4A9I A;  5L8T A;  5L99 A;  4TTE A;  2YQD A;  1JM4 B;  4UYG A;  2DVQ A;  4NRB A;  2R10 A;  5CU8 A;  2YYN A;  5EWD A;  4HXS A;  5FFV A;  4NYW A;  4CUS A;  4N4F A;  3FKM X;  5HQ5 A;  5A5N A;  4O7C A;  4NYV A;  5ENB A;  5E9L A;  2L85 A;  2R0S A;  5CRM A;  5FBX A;  3AAD A;  4QST A;  4Q0O A;  5EIS A;  5E9I A;  5H1V A;  3UVW A;  4NR9 A;  2MJV B;  4GPJ A;  4OGJ A;  5ETD A;  5FB1 A;  4NS5 A;  5L96 A;  5F1L A;  5DYX A;  2GRC A;  5ETB A;  5C8G A;  4O74 A;  5EWH A;  3HME A;  5KO4 A;  5A82 A;  5I29 A;  5DW2 A;  4A9H A;  5EPS A;  4YAB A;  4ZQL A;  4QSR A;  5I40 A;  5A5P A;  3I3J A;  4Y03 A;  5L8U A;  5EU1 A;  4O78 A;  5L97 A;  2YW5 A;  2F6N A;  4KCX A;  5DLZ A;  5FE4 A;  4YYI A;  5C87 A;  4CL9 A;  5FG4 A;  3G0J A;  5EWC A;  2EJN A;  4OGI A;  4Q0N A;  3P1D A;  4HBV A;  5DYU A;  2DVS A;  5CQ6 A;  4NR8 A;  5HRX A;  5FE9 A;  4E96 A;  5EVA A;  5L98 A;  5D7X A;  5D26 A;  2FSA A;  4NR5 A;  4QEV A;  4TS8 A;  3Q2F A;  5FH8 A;  5D25 A;  3MXF A;  4YAD A;  5HCL A;  5IGM A;  2YDW A;  4YY4 A;  4YYM A;  5F61 A;  3JVM A;  2YEM A;  4HXM A;  4QR5 A;  4CFK A;  4O71 A;  4NRA A;  5HQ6 A;  5C85 A;  4C66 A;  4J1P A;  4O72 A;  4ALH A;  5LJ1 A;  4CLB A;  5BT4 A;  5F36 A;  4HBX A;  5FFW A;  4Z93 A;  4LDF A;  4UIZ A;  4NUE A;  5EA1 A;  1JSP B;  5CTL A;  5DY7 A;  4NUD A;  3UV4 A;  5IGL A;  2DVR A;  4QSS A;  4MEP A;  4PCE A;  4CUT A;  4XY9 A;  4MR6 A;  5CS8 A;  4N3W A;  4BHW A;  2RS9 B;  4CUP A;  3SVG A;  4XYA A;  5A5O A;  3U5J A;  3GG3 A;  3JVK A;  5CQA A;  3UVY A;  2H60 A;  5E9Y A;  5CUG A;  3ERR A;  3O37 A;  5EP7 A;  3IU5 A;  1E6I A;  5DFB A;  4LC2 A;  4NR4 A;  4ALG A;  4Z6H A;  4IOQ A;  5CFW A;  5D3R A;  5CY9 A;  5EWV A;  3DAI A;  3LQI A;  5H85 A;  5D24 A;  5FE1 A;  4MEN A;  3MUL A;  5BT3 A;  5LKZ A;  5EQ1 A;  4J0S A;  3AQA A;  5E9V A;  1X0J A;  3P1E A;  3P1C A;  4FLP A;  3LQH A;  5EPB A;  5C7N A;  5F3A A;  3O34 A;  2N9G A;  4LRG A;  4QUU A;  4UYF B;  5KHM A;  4N4H A;  4QZS A;  5HRW A;  3SVH A;  5ENF A;  5E9M A;  5FFY A;  5I7Y A;  5AD3 A;  2YEL A;  5FE0 A;  3U5M A;  1N72 A;  4XUB A;  2DVV A;  3LJW A;  2RNX A;  4N4I A;  5DBM A;  5JWM A;  4YYG A;  5I88 A;  3UVX A; 
#chains in the Genus database with same CATH homology
 3HMF A;  4O7B A;  5DW1 A;  5E73 A;  5LKX A;  5D3S A;  4QUT A;  4UIU A;  4TU6 A;  4HXK A;  2LSP B;  5D0C A;  4ZW1 A;  4YYN A;  2I7K A;  4DON A;  4TZ8 A;  2DAT A;  4XUA A;  5HEL A;  4YBS A;  3UW9 A;  2D82 A;  4QC1 A;  5A85 A;  5IGN A;  5DLX A;  5HEN A;  5F60 A;  4YYK A;  4UIV A;  4AKN A;  4LYW A;  5J0D A;  5F5Z A;  5D3P A;  5K29 A;  4PTB A;  4YYJ A;  3P1F A;  2E3K A;  4X2I A;  5EWW A;  5G4S A;  4QSU A;  5HQ7 A;  3QZV A;  4LR6 A;  5EI4 A;  1F68 A;  2L5E A;  3QZS A;  4WIV A;  4O70 A;  2E7N A;  4IOO A;  4YBT A;  4MR4 A;  4A9L A;  4HXO A;  4YH4 A;  5CZG A;  5DFD A;  4IR3 A;  3RCW A;  3S91 A;  4OUF A;  4QSW A;  5ACY A;  3S92 A;  5EPR A;  5CUE A;  4BW1 A;  3MB4 A;  5EM3 A;  5ENE A;  5FE5 A;  5FE3 A;  4YAT A;  5CP5 A;  4A9F A;  5E7D A;  5LJ2 A;  4HXL A;  4TQN A;  5FE8 A;  4O7F A;  5AME A;  5IG6 A;  4BW3 A;  4J0R A;  4NYX A;  4A9K A;  4YAX A;  5F1H A;  5H1T A;  4NR6 A;  5D3H A;  5D3T A;  2KTB B;  5D3L A;  5DKC A;  4BW2 A;  5F25 A;  2E7O A;  4LZR A;  5FG6 A;  4LZS A;  4O76 A;  2WP1 A;  5I89 A;  4KV1 A;  5FH7 A;  5LJ0 A;  2L84 A;  3O35 A;  4LZ2 A;  5A5S A;  3UV5 A;  5KU3 A;  5CQ3 A;  5DKD A;  2R0Y A;  3QZT A;  4J3I A;  5HLS A;  3SVF A;  4TYL A;  3MQM A;  4QR3 A;  5H1U A;  5BT5 A;  4PY6 A;  4LYI A;  5DKH A;  1EQF A;  3U5K A;  5I1Q A;  4QSV A;  4CFL A;  4CUR A;  5TB6 A;  3ZYU A;  5CUB A;  4QR4 A;  4IR6 A;  4IR5 A;  2RNY A;  5CUA A;  5KTU A;  5CQ4 A;  4PKL A;  2I8N A;  2RFJ A;  4LYS A;  4UIX A;  4QEU A;  5AMF A;  2F6J A;  4WHW A;  4YK0 A;  3MB3 A;  4NQM A;  4HXP A;  2OUO A;  3K2J A;  5FE7 A;  2RO1 A;  4TU4 A;  5E3D A;  4Z1S A;  4QSX A;  4A9O A;  1ZS5 A;  5I86 A;  5I83 A;  4QY4 A;  3UVD A;  5IID A;  4A9N A;  5HEM A;  5LVR A;  5F62 A;  4O75 A;  5II2 A;  5EIC A;  3MUK A;  4PS5 A;  1WUM A;  1WUG A;  5IBN A;  4YYH A;  4RVR A;  2DKW A;  5TCM A;  5LKT A;  4QNS A;  5LVQ A;  4UYH A;  4NUC A;  4IR4 A;  3UV2 A;  4QSP A;  4UIY A;  4MR3 A;  4UYD A;  5E0R A;  2OSS A;  5D3N A;  5F63 A;  4QEW A;  5CUD A;  4XY8 A;  5COI A;  5C4Q A;  3U5L A;  3HMH A;  3O33 A;  3D7C A;  4TT4 A;  4HBW A;  5I80 A;  4CUU A;  5DX4 A;  4ZC9 A;  5ENC A;  3U5N A;  4IOR A;  4N4G A;  4QSQ A;  4NRC A;  5FB0 A;  4NQN A;  4BW4 A;  5EV9 A;  4MR5 A;  4MEQ A;  3U5O A;  3P5O A;  5CGP A;  5FE2 A;  4UYE A;  4C67 A;  3IU6 A;  4A9M A;  3NXB A;  2YEK A;  5CQT A;  2G4A A;  5D3J A;  3JVJ A;  4QYD A;  4WHU A;  4Z6I A;  4QBM A;  3TLP A;  5A5R A;  5HM0 A;  4HXN A;  5A5Q A;  4YC9 A;  4A9E A;  2D9E A;  4QYL A;  5FG5 A;  4TT2 A;  5KTW A;  5KTX A;  4HBY A;  4TZ2 A;  4O7E A;  5ENI A;  5ENH A;  5FE6 A;  5G4R A;  5DYA A;  5A7C A;  4PCI A;  4F3I A;  5FDZ A;  3DWY A;  5CQ5 A;  5I7X A;  4YY6 A;  4QB3 A;  3O36 A;  2RNW A;  4TT6 A;  3G0L A;  4NR7 A;  5CRZ A;  5CUC A;  5ENJ A;  5AD2 A;  4YH3 A;  4QC3 A;  5EK9 A;  5E74 A;  5CPE A;  5A83 A;  3Q2E A;  3LQJ A;  4O7A A;  4YBM A;  4BJX A;  5ENG A;  4YYD A;  5E3G A;  5HFQ A;  4CUQ A;  4O77 A;  5E9K A;  4HXR A;  5EGU A;  5II1 A;  2DWW A;  5CQ7 A;  3JVL A;  5CQ8 A;  5A81 A;  4UIW A;  2NXB A;  4NXJ A;  4Z1Q A;  5HRV A;  5LKU A;  4MEO A;  5DYC A;  4UYF A;  5LUU A;  2OO1 A;  5HJC A;  2R0V A;  4UIT A;  5JI8 A;  3U5P A;  5FH6 A;  2WP2 A;  4KV4 A;  3ONI A;  5F2P A;  5HFR A;  2RI7 A;  5DFC A;  4A9J A;  5IGK A;  3LXJ A;  5C89 A;  4A9I A;  5L8T A;  5L99 A;  4TTE A;  2YQD A;  1JM4 B;  4UYG A;  2DVQ A;  4NRB A;  2R10 A;  5CU8 A;  2YYN A;  5EWD A;  4HXS A;  5FFV A;  4NYW A;  4CUS A;  4N4F A;  3FKM X;  5HQ5 A;  5A5N A;  4O7C A;  4NYV A;  5ENB A;  5E9L A;  2L85 A;  2R0S A;  5CRM A;  5FBX A;  3AAD A;  4QST A;  4Q0O A;  5EIS A;  5E9I A;  5H1V A;  3UVW A;  4NR9 A;  2MJV B;  4GPJ A;  4OGJ A;  5ETD A;  5FB1 A;  4NS5 A;  5L96 A;  5F1L A;  5DYX A;  2GRC A;  5ETB A;  5C8G A;  4O74 A;  5EWH A;  3HME A;  5KO4 A;  5A82 A;  5I29 A;  5DW2 A;  4A9H A;  5EPS A;  4YAB A;  4ZQL A;  4QSR A;  5I40 A;  5A5P A;  3I3J A;  4Y03 A;  5L8U A;  5EU1 A;  4O78 A;  5L97 A;  2YW5 A;  2F6N A;  4KCX A;  5DLZ A;  5FE4 A;  4YYI A;  5C87 A;  4CL9 A;  5FG4 A;  3G0J A;  5EWC A;  4OGI A;  4Q0N A;  3P1D A;  4HBV A;  5DYU A;  2DVS A;  5CQ6 A;  4NR8 A;  5HRX A;  5FE9 A;  4E96 A;  5EVA A;  5L98 A;  5D7X A;  5D26 A;  2FSA A;  4NR5 A;  4QEV A;  4TS8 A;  3Q2F A;  5FH8 A;  5D25 A;  3MXF A;  4YAD A;  5HCL A;  5IGM A;  2YDW A;  4YY4 A;  4YYM A;  5F61 A;  3JVM A;  2YEM A;  4HXM A;  4QR5 A;  4CFK A;  4O71 A;  4NRA A;  5HQ6 A;  5C85 A;  4C66 A;  4J1P A;  4O72 A;  4ALH A;  5LJ1 A;  4CLB A;  5BT4 A;  5F36 A;  4HBX A;  5FFW A;  4Z93 A;  4LDF A;  4UIZ A;  4NUE A;  5EA1 A;  1JSP B;  5CTL A;  5DY7 A;  4NUD A;  3UV4 A;  5IGL A;  2DVR A;  4QSS A;  4MEP A;  4PCE A;  4CUT A;  4XY9 A;  4MR6 A;  5CS8 A;  4N3W A;  4BHW A;  2RS9 B;  4CUP A;  3SVG A;  4XYA A;  5A5O A;  3U5J A;  3GG3 A;  3JVK A;  5CQA A;  3UVY A;  2H60 A;  5E9Y A;  5CUG A;  3O37 A;  5EP7 A;  3IU5 A;  1E6I A;  5DFB A;  4LC2 A;  4NR4 A;  4ALG A;  4Z6H A;  4IOQ A;  5CFW A;  5D3R A;  5CY9 A;  5EWV A;  3DAI A;  3LQI A;  5H85 A;  5D24 A;  5FE1 A;  4MEN A;  3MUL A;  5BT3 A;  5LKZ A;  5EQ1 A;  4J0S A;  3AQA A;  5E9V A;  1X0J A;  3P1E A;  3P1C A;  4FLP A;  3LQH A;  5EPB A;  5C7N A;  5F3A A;  3O34 A;  2N9G A;  4LRG A;  4QUU A;  4UYF B;  5KHM A;  4N4H A;  4QZS A;  5HRW A;  3SVH A;  5ENF A;  5E9M A;  5FFY A;  5I7Y A;  5AD3 A;  2YEL A;  5FE0 A;  3U5M A;  1N72 A;  4XUB A;  2DVV A;  3LJW A;  2RNX A;  4N4I A;  5DBM A;  5JWM A;  4YYG A;  5I88 A;  3UVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...