4LYWA

Crystal structure of brd4(1) bound to inhibitor xd14
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
127
structure length
127
Chain Sequence
AMNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title 4-Acyl pyrroles: mimicking acetylated lysines in histone code reading.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/inhibitor
total genus 40
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4lywA01
5LKUA 5LVQA 4O74A 4YYDA 4YYHA 4CFKA 4HXOA 4QC3A 5BT3A 4O78A 5ETBA 4NUDA 5EWWA 5DFBA 5CTLA 4QSPA 4NUEA 5HFQA 5HM0A 4YK0A 2DATA 2MJVB 5CQTA 5KTWA 4QSQA 4J0SA 5I7XA 5FE7A 4N4IA 4WIVA 2L5EA 5IGNA 4CLBA 5E74A 2L84A 5CFWA 5LJ1A 3MXFA 5E9KA 2D82A 4TU4A 3U5OA 3ZYUA 5I80A 2RO1A 4YBMA 5II1A 4TT4A 5CP5A 3U5NA 2D9EA 1N72A 4YC9A 5L99A 5BT5A 5EQ1A 5L98A 4QR3A 4PCIA 4TT2A 2DWWA 3UVXA 5F25A 5FH8A 5CUBA 5CGPA 5HJCA 4NYXA 3IU6A 4KCXA 4BW1A 4MEQA 4NRCA 2E3KA 5D3JA 5LKXA 5FH7A 4BW4A 4HBXA 4NR9A 4NS5A 5HFRA 5ENHA 5EI4A 5C7NA 4ZW1A 4LYSA 5K29A 5LVRA 3QZSA 5ENFA 5LUUA 4CUQA 3JVKA 2R10A 3G0LA 4YH3A 4PKLA 5A5PA 3G0JA 4J1PA 4UYFB 5CQ7A 4BJXA 5AMFA 3AADA 5EISA 5F62A 4YBSA 2E7OA 5EPRA 5E9LA 2YDWA 4HXNA 3QZTA 4LR6A 3NXBA 4J0RA 3ONIA 1ZS5A 4UITA 2YEMA 4KV4A 4BW3A 5ENEA 2YW5A 4IR4A 4DONA 4LRGA 5AMEA 5EVAA 3U5KA 4YADA 4Y03A 3UV5A 5KTUA 4QR4A 4Z93A 5DLXA 5EK9A 5I7YA 4XY8A 1E6IA 5DYXA 4IR5A 4XUAA 5HEMA 4A9JA 4YYNA 5DFCA 4A9FA 5L8TA 4YYGA 5IIDA 4MR5A 5CUCA 2H60A 4QUUA 5CQ3A 2L85A 4UYEA 3HMHA 5CY9A 4CUPA 4MEPA 4CUTA 4NYWA 4NR6A 5FE1A 5L96A 5HQ6A 5I1QA 5FB1A 5IGKA 4MR3A 4BHWA 4QY4A 5A7CA 3MQMA 5DBMA 5HRWA 5F60A 5E7DA 4TYLA 5FFWA 2DVSA 4MEOA 5D3RA 3S91A 4O7EA 3P1DA 3TLPA 2I8NA 3O34A 5F5ZA 5FE9A 2KTBB 5TCMA 3P1FA 4NXJA 4YH4A 5ACYA 4QC1A 4UIXA 4NR4A 5DW2A 5EA1A 3HMFA 4C67A 4N4GA 5HQ5A 5ENBA 4NR7A 5DW1A 5D3SA 5D7XA 4WHUA 5I89A 3SVGA 1EQFA 4IR6A 4Z6IA 5FDZA 3JVLA 5BT4A 4O7FA 5G4RA 5E3DA 4LC2A 5D26A 5FE3A 3DWYA 4TS8A 5CUEA 4Q0NA 4HBVA 5DYAA 2RNWA 4A9MA 2N9GA 5DLZA 4CFLA 5F3AA 5E9VA 5EICA 4O71A 3RCWA 4OGIA 3MB4A 5F1LA 3LXJA 4XUBA 5DKHA 4LYIA 5CRMA 4NRBA 4QSVA 4UIVA 4TU6A 5IG6A 2YEKA 2NXBA 5CUGA 5D24A 2WP2A 4HXRA 2RNXA 4NRAA 5FG4A 4LDFA 4XY9A 5COIA 1X0JA 4BW2A 2DVVA 4HBYA 5EU1A 5FE0A 4O77A 4XYAA 5AD3A 5JWMA 5DKDA 4O7AA 4QSTA 4HXMA 4LZSA 3UW9A 5EWCA 4YATA 3GG3A 3P5OA 4GPJA 4J3IA 1JM4B 3QZVA 2R0SA 5F63A 3S92A 5CZGA 3O36A 3U5MA 5DYCA 4QEUA 5ENJA 5L8UA 5I83A 5LKZA 5ETDA 5FH6A 5ENCA 5II2A 4PY6A 4O70A 5D3NA 5HRXA 4A9IA 4YYKA 3AQAA 4NUCA 2R0YA 5J0DA 5D0CA 4A9NA 4QUTA 3MB3A 4PTBA 4X2IA 2OSSA 2R0VA 4IOOA 3DAIA 4QR5A 5HELA 2F6NA 3HMEA 4ALHA 4Z1SA 4NR8A 5FFYA 5LJ0A 5DYUA 5C85A 5FG5A 5CQ8A 2YELA 3MUKA 5IGMA 4UYDA 4UIZA 5G4SA 3P1CA 4YY6A 5H1UA 5A5NA 5FE4A 4A9KA 4QZSA 3UV2A 5A5SA 4WHWA 5D3LA 4NR5A 5FB0A 4YYJA 4E96A 4PCEA 4TZ8A 4ZC9A 5EPSA 4O72A 5E9MA 4O75A 3UVYA 5F61A 3MULA 4ALGA 3O35A 5CS8A 3U5JA 2RNYA 5I29A 4A9LA 2G4AA 5HCLA 5FG6A 5EWHA 2GRCA 4Q0OA 5L97A 4TZ2A 3LQHA 4TT6A 5A5OA 5HLSA 5JI8A 5CQAA 4QSXA 5H85A 2RI7A 4MR4A 1F68A 2FSAA 4UIYA 4O7BA 5F2PA 3O37A 4A9HA 5HQ7A 5IGLA 5KO4A 3SVHA 4PS5A 4CUSA 4YYMA 4IORA 4QEVA 4CL9A 3SVFA 5FFVA 5C89A 3D7CA 4OUFA 3I3JA 5E3GA 2E7NA 4LZRA 5AD2A 4QSSA 4TTEA 5I86A 1WUMA 4UIUA 5A85A 4YYIA 2YQDA 3JVJA 4NYVA 4HXKA 5EV9A 4IOQA 4LYWA 3FKMX 2DVRA 2DKWA 5ENIA 3UV4A 4TQNA 4A9EA 5FE6A 5C4QA 4MR6A 4YAXA 5EPBA 5H1VA 5DFDA 4ZQLA 2RFJA 5LJ2A 4UYHA 4MENA 3UVDA 3K2JA 4UYGA 5EWDA 5FE5A 1JSPB 2OUOA 3P1EA 4N4FA 4NQNA 4A9OA 4YY4A 5D3TA 5H1TA 5EP7A 5C87A 4Z6HA 3LJWA 5E0RA 4IR3A 4F3IA 3JVMA 4QYLA 3UVWA 5EM3A 5FE2A 4HXSA 5ENGA 5C8GA 5FBXA 5F1HA 5KTXA 4AKNA 5CQ4A 5CU8A 5DKCA 5EWVA 4HXLA 3LQIA 5DY7A 4UIWA 3Q2FA 4UYFA 4CURA 2I7KA 5A5QA 5HENA 3Q2EA 4YBTA 5CQ5A 5TB6A 4HBWA 4QSUA 5A82A 4QBMA 3U5LA 5EGUA 5D3PA 4FLPA 5I88A 2YYNA 2OO1A 4O76A 4QB3A 5A83A 5CPEA 2RS9B 5D25A 5LKTA 3LQJA 5KU3A 4QEWA 5CRZA 5HRVA 5E9YA 5CUAA 3U5PA 5A5RA 5KHMA 4QNSA 4NQMA 3IU5A 4KV1A 5FE8A 4N4HA 5A81A 5D3HA 4CUUA 4QSWA 4QSRA 2DVQA 2F6JA 4OGJA 4N3WA 4HXPA 5I40A 4C66A 1WUGA 5E9IA 5DX4A 4YABA 4Z1QA 5IBNA 2LSPB 4QYDA 5CUDA 4O7CA 2WP1A 4RVRA 3O33A 5E73A 4LZ2A 5F36A 5CQ6A
chains in the Genus database with same CATH superfamily
5LKUA 5LVQA 4O74A 4YYDA 4YYHA 4CFKA 4HXOA 4QC3A 5BT3A 4O78A 5ETBA 4NUDA 5EWWA 5DFBA 5CTLA 4QSPA 4NUEA 5HFQA 5HM0A 4YK0A 2DATA 2MJVB 5CQTA 5KTWA 4QSQA 4J0SA 5I7XA 4AKHA 5FE7A 4N4IA 4WIVA 2L5EA 5IGNA 4CLBA 5E74A 2L84A 5CFWA 5LJ1A 3MXFA 5E9KA 2D82A 4TU4A 3U5OA 3ZYUA 5I80A 2RO1A 4YBMA 5II1A 4TT4A 5CP5A 3U5NA 2D9EA 1N72A 4YC9A 5L99A 5BT5A 5EQ1A 5L98A 4QR3A 4PCIA 4TT2A 2DWWA 3UVXA 5F25A 5FH8A 5CUBA 5CGPA 5HJCA 4NYXA 3IU6A 4KCXA 4BW1A 4MEQA 4NRCA 2E3KA 5D3JA 5LKXA 5FH7A 4BW4A 4HBXA 4NR9A 4NS5A 5HFRA 5ENHA 5EI4A 5C7NA 4ZW1A 4LYSA 5K29A 5LVRA 3QZSA 5ENFA 5LUUA 4CUQA 3JVKA 2R10A 3G0LA 4YH3A 4PKLA 5A5PA 3G0JA 4J1PA 4UYFB 5CQ7A 4BJXA 5AMFA 3AADA 5EISA 5F62A 4YBSA 2E7OA 5EPRA 5E9LA 2YDWA 4HXNA 3QZTA 4LR6A 3NXBA 4J0RA 3ONIA 1ZS5A 4UITA 2YEMA 4KV4A 4BW3A 5ENEA 2YW5A 4IR4A 4DONA 4LRGA 5AMEA 5EVAA 3U5KA 4YADA 4Y03A 3UV5A 5KTUA 4QR4A 4Z93A 1PUOA 5DLXA 5EK9A 5I7YA 4XY8A 1E6IA 5DYXA 4IR5A 4XUAA 5HEMA 4A9JA 4YYNA 5DFCA 4A9FA 5L8TA 4YYGA 5IIDA 4MR5A 5CUCA 2H60A 4QUUA 5CQ3A 2L85A 4UYEA 3HMHA 5CY9A 4CUPA 4MEPA 4CUTA 4NYWA 4NR6A 5FE1A 5L96A 5HQ6A 5I1QA 5FB1A 5IGKA 4MR3A 4BHWA 4QY4A 5A7CA 3MQMA 5DBMA 5HRWA 5F60A 5E7DA 4TYLA 5FFWA 2DVSA 4MEOA 5D3RA 3S91A 4O7EA 3P1DA 3TLPA 3ERRA 2I8NA 3O34A 5F5ZA 5FE9A 2KTBB 5TCMA 3P1FA 4NXJA 4YH4A 5ACYA 4QC1A 4UIXA 4NR4A 5DW2A 5EA1A 3HMFA 4C67A 4N4GA 5HQ5A 5ENBA 4NR7A 5DW1A 5D3SA 5D7XA 4WHUA 5I89A 3SVGA 1EQFA 4IR6A 4Z6IA 5FDZA 3JVLA 5BT4A 4O7FA 5G4RA 5E3DA 4LC2A 5D26A 5FE3A 3DWYA 4TS8A 5CUEA 4Q0NA 4HBVA 5DYAA 2RNWA 4A9MA 2N9GA 5DLZA 4CFLA 5F3AA 5E9VA 5EICA 4O71A 3RCWA 3VKGA 4OGIA 3MB4A 5F1LA 3LXJA 4XUBA 5DKHA 4LYIA 5CRMA 4NRBA 4QSVA 4UIVA 4TU6A 5IG6A 2YEKA 2NXBA 5CUGA 5D24A 2WP2A 4HXRA 2RNXA 4NRAA 5FG4A 4LDFA 4XY9A 5COIA 1X0JA 4BW2A 2DVVA 4HBYA 5EU1A 5FE0A 4O77A 4XYAA 5AD3A 5JWMA 5DKDA 4O7AA 4QSTA 4HXMA 4LZSA 3UW9A 5EWCA 4YATA 3GG3A 3P5OA 4GPJA 4J3IA 1JM4B 4AKIA 3QZVA 2R0SA 5F63A 3S92A 5CZGA 3O36A 3U5MA 5DYCA 4QEUA 5ENJA 5L8UA 5I83A 5LKZA 5ETDA 5FH6A 5ENCA 5II2A 4PY6A 4O70A 5D3NA 5HRXA 4A9IA 4YYKA 3AQAA 4NUCA 2R0YA 5J0DA 5D0CA 4A9NA 4QUTA 3MB3A 4PTBA 4X2IA 2OSSA 2R0VA 4IOOA 3DAIA 4QR5A 5HELA 2F6NA 3HMEA 4ALHA 4Z1SA 4NR8A 5FFYA 5LJ0A 5DYUA 5C85A 4AKGA 5FG5A 5CQ8A 2YELA 3MUKA 5IGMA 4UYDA 4UIZA 5G4SA 3P1CA 4YY6A 5H1UA 5A5NA 5FE4A 4A9KA 2EJNA 4QZSA 3UV2A 5A5SA 4WHWA 5D3LA 4NR5A 5FB0A 4YYJA 4E96A 4PCEA 4TZ8A 4ZC9A 5EPSA 4O72A 5E9MA 4O75A 3UVYA 5F61A 3MULA 4ALGA 3O35A 5CS8A 3U5JA 2RNYA 5I29A 4A9LA 2G4AA 5HCLA 5FG6A 5EWHA 2GRCA 4Q0OA 5L97A 4TZ2A 3LQHA 4TT6A 5A5OA 5HLSA 5JI8A 5CQAA 4QSXA 5H85A 2RI7A 4MR4A 1F68A 2FSAA 4UIYA 4O7BA 5F2PA 3O37A 4A9HA 5HQ7A 5IGLA 5KO4A 3SVHA 4PS5A 4CUSA 4YYMA 4IORA 4QEVA 4CL9A 3SVFA 5FFVA 5C89A 3D7CA 4OUFA 3I3JA 5E3GA 2E7NA 4LZRA 5AD2A 4QSSA 4TTEA 5I86A 4AI6A 1WUMA 4UIUA 5A85A 4YYIA 2YQDA 3JVJA 3D1DA 4NYVA 4HXKA 5EV9A 4IOQA 4LYWA 3FKMX 2DVRA 2DKWA 5ENIA 3UV4A 4TQNA 4A9EA 5FE6A 5C4QA 4MR6A 4YAXA 5EPBA 5H1VA 5DFDA 4ZQLA 2RFJA 5LJ2A 4UYHA 4MENA 3UVDA 3K2JA 4UYGA 5EWDA 5FE5A 1JSPB 3D1BA 2OUOA 3P1EA 4N4FA 4NQNA 4A9OA 4YY4A 5D3TA 5H1TA 5EP7A 1ZKRA 5C87A 4Z6HA 3LJWA 5E0RA 4IR3A 4F3IA 3JVMA 4QYLA 3UVWA 5EM3A 5FE2A 4HXSA 5ENGA 5C8GA 5FBXA 5F1HA 5KTXA 4AKNA 5CQ4A 5CU8A 5DKCA 5EWVA 4HXLA 3LQIA 5DY7A 4UIWA 3Q2FA 4UYFA 4CURA 2I7KA 5A5QA 5HENA 3Q2EA 4YBTA 5CQ5A 5TB6A 4HBWA 4QSUA 5A82A 4QBMA 3U5LA 5EGUA 5D3PA 4FLPA 5I88A 2YYNA 2OO1A 4O76A 4QB3A 5A83A 5CPEA 2RS9B 5D25A 5LKTA 3LQJA 5KU3A 4QEWA 5CRZA 5HRVA 5E9YA 5CUAA 3U5PA 5A5RA 5KHMA 4QNSA 4NQMA 3IU5A 4KV1A 5FE8A 4N4HA 5A81A 5D3HA 4CUUA 4QSWA 4QSRA 2DVQA 2F6JA 4OGJA 4N3WA 4HXPA 5I40A 4C66A 1WUGA 5E9IA 5DX4A 4YABA 4Z1QA 5IBNA 2LSPB 4QYDA 5CUDA 4O7CA 2WP1A 4RVRA 3O33A 5E73A 3VKHA 4LZ2A 5F36A 5CQ6A
chains in the Genus database with same CATH topology
5LKUA 5LVQA 4O74A 4YYDA 4YYHA 4CFKA 4HXOA 4QC3A 5BT3A 4O78A 5ETBA 4NUDA 5EWWA 5DFBA 5CTLA 4QSPA 4NUEA 5HFQA 5HM0A 4YK0A 2DATA 2MJVB 5CQTA 5KTWA 4QSQA 4J0SA 5I7XA 5FE7A 4N4IA 4WIVA 2L5EA 5IGNA 4CLBA 5E74A 2L84A 5CFWA 5LJ1A 3MXFA 5E9KA 2D82A 4TU4A 3U5OA 3ZYUA 5I80A 2RO1A 4YBMA 5II1A 4TT4A 5CP5A 3U5NA 2D9EA 1N72A 4YC9A 5L99A 5BT5A 5EQ1A 5L98A 4QR3A 4PCIA 4TT2A 2DWWA 3UVXA 5F25A 5FH8A 5CUBA 5CGPA 5HJCA 4NYXA 3IU6A 4KCXA 4BW1A 4MEQA 4NRCA 2E3KA 5D3JA 5LKXA 5FH7A 4BW4A 4HBXA 4NR9A 4NS5A 5HFRA 5ENHA 5EI4A 5C7NA 4ZW1A 4LYSA 5K29A 5LVRA 3QZSA 5ENFA 5LUUA 4CUQA 3JVKA 2R10A 3G0LA 4YH3A 4PKLA 5A5PA 3G0JA 4J1PA 4UYFB 5CQ7A 4BJXA 5AMFA 3AADA 5EISA 5F62A 4YBSA 2E7OA 5EPRA 5E9LA 2YDWA 4HXNA 3QZTA 4LR6A 3NXBA 4J0RA 3ONIA 1ZS5A 4UITA 2YEMA 4KV4A 4BW3A 5ENEA 2YW5A 4IR4A 4DONA 4LRGA 5AMEA 5EVAA 3U5KA 4YADA 4Y03A 3UV5A 5KTUA 4QR4A 4Z93A 5DLXA 5EK9A 5I7YA 4XY8A 1E6IA 5DYXA 4IR5A 4XUAA 5HEMA 4A9JA 4YYNA 5DFCA 4A9FA 5L8TA 4YYGA 5IIDA 4MR5A 5CUCA 2H60A 4QUUA 5CQ3A 2L85A 4UYEA 3HMHA 5CY9A 4CUPA 4MEPA 4CUTA 4NYWA 4NR6A 5FE1A 5L96A 5HQ6A 5I1QA 5FB1A 5IGKA 4MR3A 4BHWA 4QY4A 5A7CA 3MQMA 5DBMA 5HRWA 5F60A 5E7DA 4TYLA 5FFWA 2DVSA 4MEOA 5D3RA 3S91A 4O7EA 3P1DA 3TLPA 2I8NA 3O34A 5F5ZA 5FE9A 2KTBB 5TCMA 3P1FA 4NXJA 4YH4A 5ACYA 4QC1A 4UIXA 4NR4A 5DW2A 5EA1A 3HMFA 4C67A 4N4GA 5HQ5A 5ENBA 4NR7A 5DW1A 5D3SA 5D7XA 4WHUA 5I89A 3SVGA 1EQFA 4IR6A 4Z6IA 5FDZA 3JVLA 5BT4A 4O7FA 5G4RA 5E3DA 4LC2A 5D26A 5FE3A 3DWYA 4TS8A 5CUEA 4Q0NA 4HBVA 5DYAA 2RNWA 4A9MA 2N9GA 5DLZA 4CFLA 5F3AA 5E9VA 5EICA 4O71A 3RCWA 4OGIA 3MB4A 5F1LA 3LXJA 4XUBA 5DKHA 4LYIA 5CRMA 4NRBA 4QSVA 4UIVA 4TU6A 5IG6A 2YEKA 2NXBA 5CUGA 5D24A 2WP2A 4HXRA 2RNXA 4NRAA 5FG4A 4LDFA 4XY9A 5COIA 1X0JA 4BW2A 2DVVA 4HBYA 5EU1A 5FE0A 4O77A 4XYAA 5AD3A 5JWMA 5DKDA 4O7AA 4QSTA 4HXMA 4LZSA 3UW9A 5EWCA 4YATA 3GG3A 3P5OA 4GPJA 4J3IA 1JM4B 3QZVA 2R0SA 5F63A 3S92A 5CZGA 3O36A 3U5MA 5DYCA 4QEUA 5ENJA 5L8UA 5I83A 5LKZA 5ETDA 5FH6A 5ENCA 5II2A 4PY6A 4O70A 5D3NA 5HRXA 4A9IA 4YYKA 3AQAA 4NUCA 2R0YA 5J0DA 5D0CA 4A9NA 4QUTA 3MB3A 4PTBA 4X2IA 2OSSA 2R0VA 4IOOA 3DAIA 4QR5A 5HELA 2F6NA 3HMEA 4ALHA 4Z1SA 4NR8A 5FFYA 5LJ0A 5DYUA 5C85A 5FG5A 5CQ8A 2YELA 3MUKA 5IGMA 4UYDA 4UIZA 5G4SA 3P1CA 4YY6A 5H1UA 5A5NA 5FE4A 4A9KA 4QZSA 3UV2A 5A5SA 4WHWA 5D3LA 4NR5A 5FB0A 4YYJA 4E96A 4PCEA 4TZ8A 4ZC9A 5EPSA 4O72A 5E9MA 4O75A 3UVYA 5F61A 3MULA 4ALGA 3O35A 5CS8A 3U5JA 2RNYA 5I29A 4A9LA 2G4AA 5HCLA 5FG6A 5EWHA 2GRCA 4Q0OA 5L97A 4TZ2A 3LQHA 4TT6A 5A5OA 5HLSA 5JI8A 5CQAA 4QSXA 5H85A 2RI7A 4MR4A 1F68A 2FSAA 4UIYA 4O7BA 5F2PA 3O37A 4A9HA 5HQ7A 5IGLA 5KO4A 3SVHA 4PS5A 4CUSA 4YYMA 4IORA 4QEVA 4CL9A 3SVFA 5FFVA 5C89A 3D7CA 4OUFA 3I3JA 5E3GA 2E7NA 4LZRA 5AD2A 4QSSA 4TTEA 5I86A 1WUMA 4UIUA 5A85A 4YYIA 2YQDA 3JVJA 4NYVA 4HXKA 5EV9A 4IOQA 4LYWA 3FKMX 2DVRA 2DKWA 5ENIA 3UV4A 4TQNA 4A9EA 5FE6A 5C4QA 4MR6A 4YAXA 5EPBA 5H1VA 5DFDA 4ZQLA 2RFJA 5LJ2A 4UYHA 4MENA 3UVDA 3K2JA 4UYGA 5EWDA 5FE5A 1JSPB 2OUOA 3P1EA 4N4FA 4NQNA 4A9OA 4YY4A 5D3TA 5H1TA 5EP7A 5C87A 4Z6HA 3LJWA 5E0RA 4IR3A 4F3IA 3JVMA 4QYLA 3UVWA 5EM3A 5FE2A 4HXSA 5ENGA 5C8GA 5FBXA 5F1HA 5KTXA 4AKNA 5CQ4A 5CU8A 5DKCA 5EWVA 4HXLA 3LQIA 5DY7A 4UIWA 3Q2FA 4UYFA 4CURA 2I7KA 5A5QA 5HENA 3Q2EA 4YBTA 5CQ5A 5TB6A 4HBWA 4QSUA 5A82A 4QBMA 3U5LA 5EGUA 5D3PA 4FLPA 5I88A 2YYNA 2OO1A 4O76A 4QB3A 5A83A 5CPEA 2RS9B 5D25A 5LKTA 3LQJA 5KU3A 4QEWA 5CRZA 5HRVA 5E9YA 5CUAA 3U5PA 5A5RA 5KHMA 4QNSA 4NQMA 3IU5A 4KV1A 5FE8A 4N4HA 5A81A 5D3HA 4CUUA 4QSWA 4QSRA 2DVQA 2F6JA 4OGJA 4N3WA 4HXPA 5I40A 4C66A 1WUGA 5E9IA 5DX4A 4YABA 4Z1QA 5IBNA 2LSPB 4QYDA 5CUDA 4O7CA 2WP1A 4RVRA 3O33A 5E73A 4LZ2A 5F36A 5CQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LKU A;  5LVQ A;  4O74 A;  4YYD A;  4YYH A;  4CFK A;  4HXO A;  4QC3 A;  5BT3 A;  4O78 A;  5ETB A;  4NUD A;  5EWW A;  5DFB A;  5CTL A;  4QSP A;  4NUE A;  5HFQ A;  5HM0 A;  4YK0 A;  2DAT A;  2MJV B;  5CQT A;  5KTW A;  4QSQ A;  4J0S A;  5I7X A;  5FE7 A;  4N4I A;  4WIV A;  2L5E A;  5IGN A;  4CLB A;  5E74 A;  2L84 A;  5CFW A;  5LJ1 A;  3MXF A;  5E9K A;  2D82 A;  4TU4 A;  3U5O A;  3ZYU A;  5I80 A;  2RO1 A;  4YBM A;  5II1 A;  4TT4 A;  5CP5 A;  3U5N A;  2D9E A;  1N72 A;  4YC9 A;  5L99 A;  5BT5 A;  5EQ1 A;  5L98 A;  4QR3 A;  4PCI A;  4TT2 A;  2DWW A;  3UVX A;  5F25 A;  5FH8 A;  5CUB A;  5CGP A;  5HJC A;  4NYX A;  3IU6 A;  4KCX A;  4BW1 A;  4MEQ A;  4NRC A;  2E3K A;  5D3J A;  5LKX A;  5FH7 A;  4BW4 A;  4HBX A;  4NR9 A;  4NS5 A;  5HFR A;  5ENH A;  5EI4 A;  5C7N A;  4ZW1 A;  4LYS A;  5K29 A;  5LVR A;  3QZS A;  5ENF A;  5LUU A;  4CUQ A;  3JVK A;  2R10 A;  3G0L A;  4YH3 A;  4PKL A;  5A5P A;  3G0J A;  4J1P A;  4UYF B;  5CQ7 A;  4BJX A;  5AMF A;  3AAD A;  5EIS A;  5F62 A;  4YBS A;  2E7O A;  5EPR A;  5E9L A;  2YDW A;  4HXN A;  3QZT A;  4LR6 A;  3NXB A;  4J0R A;  3ONI A;  1ZS5 A;  4UIT A;  2YEM A;  4KV4 A;  4BW3 A;  5ENE A;  2YW5 A;  4IR4 A;  4DON A;  4LRG A;  5AME A;  5EVA A;  3U5K A;  4YAD A;  4Y03 A;  3UV5 A;  5KTU A;  4QR4 A;  4Z93 A;  5DLX A;  5EK9 A;  5I7Y A;  4XY8 A;  1E6I A;  5DYX A;  4IR5 A;  4XUA A;  5HEM A;  4A9J A;  4YYN A;  5DFC A;  4A9F A;  5L8T A;  4YYG A;  5IID A;  4MR5 A;  5CUC A;  2H60 A;  4QUU A;  5CQ3 A;  2L85 A;  4UYE A;  3HMH A;  5CY9 A;  4CUP A;  4MEP A;  4CUT A;  4NYW A;  4NR6 A;  5FE1 A;  5L96 A;  5HQ6 A;  5I1Q A;  5FB1 A;  5IGK A;  4MR3 A;  4BHW A;  4QY4 A;  5A7C A;  3MQM A;  5DBM A;  5HRW A;  5F60 A;  5E7D A;  4TYL A;  5FFW A;  2DVS A;  4MEO A;  5D3R A;  3S91 A;  4O7E A;  3P1D A;  3TLP A;  2I8N A;  3O34 A;  5F5Z A;  5FE9 A;  2KTB B;  5TCM A;  3P1F A;  4NXJ A;  4YH4 A;  5ACY A;  4QC1 A;  4UIX A;  4NR4 A;  5DW2 A;  5EA1 A;  3HMF A;  4C67 A;  4N4G A;  5HQ5 A;  5ENB A;  4NR7 A;  5DW1 A;  5D3S A;  5D7X A;  4WHU A;  5I89 A;  3SVG A;  1EQF A;  4IR6 A;  4Z6I A;  5FDZ A;  3JVL A;  5BT4 A;  4O7F A;  5G4R A;  5E3D A;  4LC2 A;  5D26 A;  5FE3 A;  3DWY A;  4TS8 A;  5CUE A;  4Q0N A;  4HBV A;  5DYA A;  2RNW A;  4A9M A;  2N9G A;  5DLZ A;  4CFL A;  5F3A A;  5E9V A;  5EIC A;  4O71 A;  3RCW A;  4OGI A;  3MB4 A;  5F1L A;  3LXJ A;  4XUB A;  5DKH A;  4LYI A;  5CRM A;  4NRB A;  4QSV A;  4UIV A;  4TU6 A;  5IG6 A;  2YEK A;  2NXB A;  5CUG A;  5D24 A;  2WP2 A;  4HXR A;  2RNX A;  4NRA A;  5FG4 A;  4LDF A;  4XY9 A;  5COI A;  1X0J A;  4BW2 A;  2DVV A;  4HBY A;  5EU1 A;  5FE0 A;  4O77 A;  4XYA A;  5AD3 A;  5JWM A;  5DKD A;  4O7A A;  4QST A;  4HXM A;  4LZS A;  3UW9 A;  5EWC A;  4YAT A;  3GG3 A;  3P5O A;  4GPJ A;  4J3I A;  1JM4 B;  3QZV A;  2R0S A;  5F63 A;  3S92 A;  5CZG A;  3O36 A;  3U5M A;  5DYC A;  4QEU A;  5ENJ A;  5L8U A;  5I83 A;  5LKZ A;  5ETD A;  5FH6 A;  5ENC A;  5II2 A;  4PY6 A;  4O70 A;  5D3N A;  5HRX A;  4A9I A;  4YYK A;  3AQA A;  4NUC A;  2R0Y A;  5J0D A;  5D0C A;  4A9N A;  4QUT A;  3MB3 A;  4PTB A;  4X2I A;  2OSS A;  2R0V A;  4IOO A;  3DAI A;  4QR5 A;  5HEL A;  2F6N A;  3HME A;  4ALH A;  4Z1S A;  4NR8 A;  5FFY A;  5LJ0 A;  5DYU A;  5C85 A;  5FG5 A;  5CQ8 A;  2YEL A;  3MUK A;  5IGM A;  4UYD A;  4UIZ A;  5G4S A;  3P1C A;  4YY6 A;  5H1U A;  5A5N A;  5FE4 A;  4A9K A;  4QZS A;  3UV2 A;  5A5S A;  4WHW A;  5D3L A;  4NR5 A;  5FB0 A;  4YYJ A;  4E96 A;  4PCE A;  4TZ8 A;  4ZC9 A;  5EPS A;  4O72 A;  5E9M A;  4O75 A;  3UVY A;  5F61 A;  3MUL A;  4ALG A;  3O35 A;  5CS8 A;  3U5J A;  2RNY A;  5I29 A;  4A9L A;  2G4A A;  5HCL A;  5FG6 A;  5EWH A;  2GRC A;  4Q0O A;  5L97 A;  4TZ2 A;  3LQH A;  4TT6 A;  5A5O A;  5HLS A;  5JI8 A;  5CQA A;  4QSX A;  5H85 A;  2RI7 A;  4MR4 A;  1F68 A;  2FSA A;  4UIY A;  4O7B A;  5F2P A;  3O37 A;  4A9H A;  5HQ7 A;  5IGL A;  5KO4 A;  3SVH A;  4PS5 A;  4CUS A;  4YYM A;  4IOR A;  4QEV A;  4CL9 A;  3SVF A;  5FFV A;  5C89 A;  3D7C A;  4OUF A;  3I3J A;  5E3G A;  2E7N A;  4LZR A;  5AD2 A;  4QSS A;  4TTE A;  5I86 A;  1WUM A;  4UIU A;  5A85 A;  4YYI A;  2YQD A;  3JVJ A;  4NYV A;  4HXK A;  5EV9 A;  4IOQ A;  4LYW A;  3FKM X;  2DVR A;  2DKW A;  5ENI A;  3UV4 A;  4TQN A;  4A9E A;  5FE6 A;  5C4Q A;  4MR6 A;  4YAX A;  5EPB A;  5H1V A;  5DFD A;  4ZQL A;  2RFJ A;  5LJ2 A;  4UYH A;  4MEN A;  3UVD A;  3K2J A;  4UYG A;  5EWD A;  5FE5 A;  1JSP B;  2OUO A;  3P1E A;  4N4F A;  4NQN A;  4A9O A;  4YY4 A;  5D3T A;  5H1T A;  5EP7 A;  5C87 A;  4Z6H A;  3LJW A;  5E0R A;  4IR3 A;  4F3I A;  3JVM A;  4QYL A;  3UVW A;  5EM3 A;  5FE2 A;  4HXS A;  5ENG A;  5C8G A;  5FBX A;  5F1H A;  5KTX A;  4AKN A;  5CQ4 A;  5CU8 A;  5DKC A;  5EWV A;  4HXL A;  3LQI A;  5DY7 A;  4UIW A;  3Q2F A;  4UYF A;  4CUR A;  2I7K A;  5A5Q A;  5HEN A;  3Q2E A;  4YBT A;  5CQ5 A;  5TB6 A;  4HBW A;  4QSU A;  5A82 A;  4QBM A;  3U5L A;  5EGU A;  5D3P A;  4FLP A;  5I88 A;  2YYN A;  2OO1 A;  4O76 A;  4QB3 A;  5A83 A;  5CPE A;  2RS9 B;  5D25 A;  5LKT A;  3LQJ A;  5KU3 A;  4QEW A;  5CRZ A;  5HRV A;  5E9Y A;  5CUA A;  3U5P A;  5A5R A;  5KHM A;  4QNS A;  4NQM A;  3IU5 A;  4KV1 A;  5FE8 A;  4N4H A;  5A81 A;  5D3H A;  4CUU A;  4QSW A;  4QSR A;  2DVQ A;  2F6J A;  4OGJ A;  4N3W A;  4HXP A;  5I40 A;  4C66 A;  1WUG A;  5E9I A;  5DX4 A;  4YAB A;  4Z1Q A;  5IBN A;  2LSP B;  4QYD A;  5CUD A;  4O7C A;  2WP1 A;  4RVR A;  3O33 A;  5E73 A;  4LZ2 A;  5F36 A;  5CQ6 A; 
#chains in the Genus database with same CATH topology
 5LKU A;  5LVQ A;  4O74 A;  4YYD A;  4YYH A;  4CFK A;  4HXO A;  4QC3 A;  5BT3 A;  4O78 A;  5ETB A;  4NUD A;  5EWW A;  5DFB A;  5CTL A;  4QSP A;  4NUE A;  5HFQ A;  5HM0 A;  4YK0 A;  2DAT A;  2MJV B;  5CQT A;  5KTW A;  4QSQ A;  4J0S A;  5I7X A;  4AKH A;  5FE7 A;  4N4I A;  4WIV A;  2L5E A;  5IGN A;  4CLB A;  5E74 A;  2L84 A;  5CFW A;  5LJ1 A;  3MXF A;  5E9K A;  2D82 A;  4TU4 A;  3U5O A;  3ZYU A;  5I80 A;  2RO1 A;  4YBM A;  5II1 A;  4TT4 A;  5CP5 A;  3U5N A;  2D9E A;  1N72 A;  4YC9 A;  5L99 A;  5BT5 A;  5EQ1 A;  5L98 A;  4QR3 A;  4PCI A;  4TT2 A;  2DWW A;  3UVX A;  5F25 A;  5FH8 A;  5CUB A;  5CGP A;  5HJC A;  4NYX A;  3IU6 A;  4KCX A;  4BW1 A;  4MEQ A;  4NRC A;  2E3K A;  5D3J A;  5LKX A;  5FH7 A;  4BW4 A;  4HBX A;  4NR9 A;  4NS5 A;  5HFR A;  5ENH A;  5EI4 A;  5C7N A;  4ZW1 A;  4LYS A;  5K29 A;  5LVR A;  3QZS A;  5ENF A;  5LUU A;  4CUQ A;  3JVK A;  2R10 A;  3G0L A;  4YH3 A;  4PKL A;  5A5P A;  3G0J A;  4J1P A;  4UYF B;  5CQ7 A;  4BJX A;  5AMF A;  3AAD A;  5EIS A;  5F62 A;  4YBS A;  2E7O A;  5EPR A;  5E9L A;  2YDW A;  4HXN A;  3QZT A;  4LR6 A;  3NXB A;  4J0R A;  3ONI A;  1ZS5 A;  4UIT A;  2YEM A;  4KV4 A;  4BW3 A;  5ENE A;  2YW5 A;  4IR4 A;  4DON A;  4LRG A;  5AME A;  5EVA A;  3U5K A;  4YAD A;  4Y03 A;  3UV5 A;  5KTU A;  4QR4 A;  4Z93 A;  1PUO A;  5DLX A;  5EK9 A;  5I7Y A;  4XY8 A;  1E6I A;  5DYX A;  4IR5 A;  4XUA A;  5HEM A;  4A9J A;  4YYN A;  5DFC A;  4A9F A;  5L8T A;  4YYG A;  5IID A;  4MR5 A;  5CUC A;  2H60 A;  4QUU A;  5CQ3 A;  2L85 A;  4UYE A;  3HMH A;  5CY9 A;  4CUP A;  4MEP A;  4CUT A;  4NYW A;  4NR6 A;  5FE1 A;  5L96 A;  5HQ6 A;  5I1Q A;  5FB1 A;  5IGK A;  4MR3 A;  4BHW A;  4QY4 A;  5A7C A;  3MQM A;  5DBM A;  5HRW A;  5F60 A;  5E7D A;  4TYL A;  5FFW A;  2DVS A;  4MEO A;  5D3R A;  3S91 A;  4O7E A;  3P1D A;  3TLP A;  3ERR A;  2I8N A;  3O34 A;  5F5Z A;  5FE9 A;  2KTB B;  5TCM A;  3P1F A;  4NXJ A;  4YH4 A;  5ACY A;  4QC1 A;  4UIX A;  4NR4 A;  5DW2 A;  5EA1 A;  3HMF A;  4C67 A;  4N4G A;  5HQ5 A;  5ENB A;  4NR7 A;  5DW1 A;  5D3S A;  5D7X A;  4WHU A;  5I89 A;  3SVG A;  1EQF A;  4IR6 A;  4Z6I A;  5FDZ A;  3JVL A;  5BT4 A;  4O7F A;  5G4R A;  5E3D A;  4LC2 A;  5D26 A;  5FE3 A;  3DWY A;  4TS8 A;  5CUE A;  4Q0N A;  4HBV A;  5DYA A;  2RNW A;  4A9M A;  2N9G A;  5DLZ A;  4CFL A;  5F3A A;  5E9V A;  5EIC A;  4O71 A;  3RCW A;  3VKG A;  4OGI A;  3MB4 A;  5F1L A;  3LXJ A;  4XUB A;  5DKH A;  4LYI A;  5CRM A;  4NRB A;  4QSV A;  4UIV A;  4TU6 A;  5IG6 A;  2YEK A;  2NXB A;  5CUG A;  5D24 A;  2WP2 A;  4HXR A;  2RNX A;  4NRA A;  5FG4 A;  4LDF A;  4XY9 A;  5COI A;  1X0J A;  4BW2 A;  2DVV A;  4HBY A;  5EU1 A;  5FE0 A;  4O77 A;  4XYA A;  5AD3 A;  5JWM A;  5DKD A;  4O7A A;  4QST A;  4HXM A;  4LZS A;  3UW9 A;  5EWC A;  4YAT A;  3GG3 A;  3P5O A;  4GPJ A;  4J3I A;  1JM4 B;  4AKI A;  3QZV A;  2R0S A;  5F63 A;  3S92 A;  5CZG A;  3O36 A;  3U5M A;  5DYC A;  4QEU A;  5ENJ A;  5L8U A;  5I83 A;  5LKZ A;  5ETD A;  5FH6 A;  5ENC A;  5II2 A;  4PY6 A;  4O70 A;  5D3N A;  5HRX A;  4A9I A;  4YYK A;  3AQA A;  4NUC A;  2R0Y A;  5J0D A;  5D0C A;  4A9N A;  4QUT A;  3MB3 A;  4PTB A;  4X2I A;  2OSS A;  2R0V A;  4IOO A;  3DAI A;  4QR5 A;  5HEL A;  2F6N A;  3HME A;  4ALH A;  4Z1S A;  4NR8 A;  5FFY A;  5LJ0 A;  5DYU A;  5C85 A;  4AKG A;  5FG5 A;  5CQ8 A;  2YEL A;  3MUK A;  5IGM A;  4UYD A;  4UIZ A;  5G4S A;  3P1C A;  4YY6 A;  5H1U A;  5A5N A;  5FE4 A;  4A9K A;  2EJN A;  4QZS A;  3UV2 A;  5A5S A;  4WHW A;  5D3L A;  4NR5 A;  5FB0 A;  4YYJ A;  4E96 A;  4PCE A;  4TZ8 A;  4ZC9 A;  5EPS A;  4O72 A;  5E9M A;  4O75 A;  3UVY A;  5F61 A;  3MUL A;  4ALG A;  3O35 A;  5CS8 A;  3U5J A;  2RNY A;  5I29 A;  4A9L A;  2G4A A;  5HCL A;  5FG6 A;  5EWH A;  2GRC A;  4Q0O A;  5L97 A;  4TZ2 A;  3LQH A;  4TT6 A;  5A5O A;  5HLS A;  5JI8 A;  5CQA A;  4QSX A;  5H85 A;  2RI7 A;  4MR4 A;  1F68 A;  2FSA A;  4UIY A;  4O7B A;  5F2P A;  3O37 A;  4A9H A;  5HQ7 A;  5IGL A;  5KO4 A;  3SVH A;  4PS5 A;  4CUS A;  4YYM A;  4IOR A;  4QEV A;  4CL9 A;  3SVF A;  5FFV A;  5C89 A;  3D7C A;  4OUF A;  3I3J A;  5E3G A;  2E7N A;  4LZR A;  5AD2 A;  4QSS A;  4TTE A;  5I86 A;  4AI6 A;  1WUM A;  4UIU A;  5A85 A;  4YYI A;  2YQD A;  3JVJ A;  3D1D A;  4NYV A;  4HXK A;  5EV9 A;  4IOQ A;  4LYW A;  3FKM X;  2DVR A;  2DKW A;  5ENI A;  3UV4 A;  4TQN A;  4A9E A;  5FE6 A;  5C4Q A;  4MR6 A;  4YAX A;  5EPB A;  5H1V A;  5DFD A;  4ZQL A;  2RFJ A;  5LJ2 A;  4UYH A;  4MEN A;  3UVD A;  3K2J A;  4UYG A;  5EWD A;  5FE5 A;  1JSP B;  3D1B A;  2OUO A;  3P1E A;  4N4F A;  4NQN A;  4A9O A;  4YY4 A;  5D3T A;  5H1T A;  5EP7 A;  1ZKR A;  5C87 A;  4Z6H A;  3LJW A;  5E0R A;  4IR3 A;  4F3I A;  3JVM A;  4QYL A;  3UVW A;  5EM3 A;  5FE2 A;  4HXS A;  5ENG A;  5C8G A;  5FBX A;  5F1H A;  5KTX A;  4AKN A;  5CQ4 A;  5CU8 A;  5DKC A;  5EWV A;  4HXL A;  3LQI A;  5DY7 A;  4UIW A;  3Q2F A;  4UYF A;  4CUR A;  2I7K A;  5A5Q A;  5HEN A;  3Q2E A;  4YBT A;  5CQ5 A;  5TB6 A;  4HBW A;  4QSU A;  5A82 A;  4QBM A;  3U5L A;  5EGU A;  5D3P A;  4FLP A;  5I88 A;  2YYN A;  2OO1 A;  4O76 A;  4QB3 A;  5A83 A;  5CPE A;  2RS9 B;  5D25 A;  5LKT A;  3LQJ A;  5KU3 A;  4QEW A;  5CRZ A;  5HRV A;  5E9Y A;  5CUA A;  3U5P A;  5A5R A;  5KHM A;  4QNS A;  4NQM A;  3IU5 A;  4KV1 A;  5FE8 A;  4N4H A;  5A81 A;  5D3H A;  4CUU A;  4QSW A;  4QSR A;  2DVQ A;  2F6J A;  4OGJ A;  4N3W A;  4HXP A;  5I40 A;  4C66 A;  1WUG A;  5E9I A;  5DX4 A;  4YAB A;  4Z1Q A;  5IBN A;  2LSP B;  4QYD A;  5CUD A;  4O7C A;  2WP1 A;  4RVR A;  3O33 A;  5E73 A;  3VKH A;  4LZ2 A;  5F36 A;  5CQ6 A; 
#chains in the Genus database with same CATH homology
 5LKU A;  5LVQ A;  4O74 A;  4YYD A;  4YYH A;  4CFK A;  4HXO A;  4QC3 A;  5BT3 A;  4O78 A;  5ETB A;  4NUD A;  5EWW A;  5DFB A;  5CTL A;  4QSP A;  4NUE A;  5HFQ A;  5HM0 A;  4YK0 A;  2DAT A;  2MJV B;  5CQT A;  5KTW A;  4QSQ A;  4J0S A;  5I7X A;  5FE7 A;  4N4I A;  4WIV A;  2L5E A;  5IGN A;  4CLB A;  5E74 A;  2L84 A;  5CFW A;  5LJ1 A;  3MXF A;  5E9K A;  2D82 A;  4TU4 A;  3U5O A;  3ZYU A;  5I80 A;  2RO1 A;  4YBM A;  5II1 A;  4TT4 A;  5CP5 A;  3U5N A;  2D9E A;  1N72 A;  4YC9 A;  5L99 A;  5BT5 A;  5EQ1 A;  5L98 A;  4QR3 A;  4PCI A;  4TT2 A;  2DWW A;  3UVX A;  5F25 A;  5FH8 A;  5CUB A;  5CGP A;  5HJC A;  4NYX A;  3IU6 A;  4KCX A;  4BW1 A;  4MEQ A;  4NRC A;  2E3K A;  5D3J A;  5LKX A;  5FH7 A;  4BW4 A;  4HBX A;  4NR9 A;  4NS5 A;  5HFR A;  5ENH A;  5EI4 A;  5C7N A;  4ZW1 A;  4LYS A;  5K29 A;  5LVR A;  3QZS A;  5ENF A;  5LUU A;  4CUQ A;  3JVK A;  2R10 A;  3G0L A;  4YH3 A;  4PKL A;  5A5P A;  3G0J A;  4J1P A;  4UYF B;  5CQ7 A;  4BJX A;  5AMF A;  3AAD A;  5EIS A;  5F62 A;  4YBS A;  2E7O A;  5EPR A;  5E9L A;  2YDW A;  4HXN A;  3QZT A;  4LR6 A;  3NXB A;  4J0R A;  3ONI A;  1ZS5 A;  4UIT A;  2YEM A;  4KV4 A;  4BW3 A;  5ENE A;  2YW5 A;  4IR4 A;  4DON A;  4LRG A;  5AME A;  5EVA A;  3U5K A;  4YAD A;  4Y03 A;  3UV5 A;  5KTU A;  4QR4 A;  4Z93 A;  5DLX A;  5EK9 A;  5I7Y A;  4XY8 A;  1E6I A;  5DYX A;  4IR5 A;  4XUA A;  5HEM A;  4A9J A;  4YYN A;  5DFC A;  4A9F A;  5L8T A;  4YYG A;  5IID A;  4MR5 A;  5CUC A;  2H60 A;  4QUU A;  5CQ3 A;  2L85 A;  4UYE A;  3HMH A;  5CY9 A;  4CUP A;  4MEP A;  4CUT A;  4NYW A;  4NR6 A;  5FE1 A;  5L96 A;  5HQ6 A;  5I1Q A;  5FB1 A;  5IGK A;  4MR3 A;  4BHW A;  4QY4 A;  5A7C A;  3MQM A;  5DBM A;  5HRW A;  5F60 A;  5E7D A;  4TYL A;  5FFW A;  2DVS A;  4MEO A;  5D3R A;  3S91 A;  4O7E A;  3P1D A;  3TLP A;  2I8N A;  3O34 A;  5F5Z A;  5FE9 A;  2KTB B;  5TCM A;  3P1F A;  4NXJ A;  4YH4 A;  5ACY A;  4QC1 A;  4UIX A;  4NR4 A;  5DW2 A;  5EA1 A;  3HMF A;  4C67 A;  4N4G A;  5HQ5 A;  5ENB A;  4NR7 A;  5DW1 A;  5D3S A;  5D7X A;  4WHU A;  5I89 A;  3SVG A;  1EQF A;  4IR6 A;  4Z6I A;  5FDZ A;  3JVL A;  5BT4 A;  4O7F A;  5G4R A;  5E3D A;  4LC2 A;  5D26 A;  5FE3 A;  3DWY A;  4TS8 A;  5CUE A;  4Q0N A;  4HBV A;  5DYA A;  2RNW A;  4A9M A;  2N9G A;  5DLZ A;  4CFL A;  5F3A A;  5E9V A;  5EIC A;  4O71 A;  3RCW A;  4OGI A;  3MB4 A;  5F1L A;  3LXJ A;  4XUB A;  5DKH A;  4LYI A;  5CRM A;  4NRB A;  4QSV A;  4UIV A;  4TU6 A;  5IG6 A;  2YEK A;  2NXB A;  5CUG A;  5D24 A;  2WP2 A;  4HXR A;  2RNX A;  4NRA A;  5FG4 A;  4LDF A;  4XY9 A;  5COI A;  1X0J A;  4BW2 A;  2DVV A;  4HBY A;  5EU1 A;  5FE0 A;  4O77 A;  4XYA A;  5AD3 A;  5JWM A;  5DKD A;  4O7A A;  4QST A;  4HXM A;  4LZS A;  3UW9 A;  5EWC A;  4YAT A;  3GG3 A;  3P5O A;  4GPJ A;  4J3I A;  1JM4 B;  3QZV A;  2R0S A;  5F63 A;  3S92 A;  5CZG A;  3O36 A;  3U5M A;  5DYC A;  4QEU A;  5ENJ A;  5L8U A;  5I83 A;  5LKZ A;  5ETD A;  5FH6 A;  5ENC A;  5II2 A;  4PY6 A;  4O70 A;  5D3N A;  5HRX A;  4A9I A;  4YYK A;  3AQA A;  4NUC A;  2R0Y A;  5J0D A;  5D0C A;  4A9N A;  4QUT A;  3MB3 A;  4PTB A;  4X2I A;  2OSS A;  2R0V A;  4IOO A;  3DAI A;  4QR5 A;  5HEL A;  2F6N A;  3HME A;  4ALH A;  4Z1S A;  4NR8 A;  5FFY A;  5LJ0 A;  5DYU A;  5C85 A;  5FG5 A;  5CQ8 A;  2YEL A;  3MUK A;  5IGM A;  4UYD A;  4UIZ A;  5G4S A;  3P1C A;  4YY6 A;  5H1U A;  5A5N A;  5FE4 A;  4A9K A;  4QZS A;  3UV2 A;  5A5S A;  4WHW A;  5D3L A;  4NR5 A;  5FB0 A;  4YYJ A;  4E96 A;  4PCE A;  4TZ8 A;  4ZC9 A;  5EPS A;  4O72 A;  5E9M A;  4O75 A;  3UVY A;  5F61 A;  3MUL A;  4ALG A;  3O35 A;  5CS8 A;  3U5J A;  2RNY A;  5I29 A;  4A9L A;  2G4A A;  5HCL A;  5FG6 A;  5EWH A;  2GRC A;  4Q0O A;  5L97 A;  4TZ2 A;  3LQH A;  4TT6 A;  5A5O A;  5HLS A;  5JI8 A;  5CQA A;  4QSX A;  5H85 A;  2RI7 A;  4MR4 A;  1F68 A;  2FSA A;  4UIY A;  4O7B A;  5F2P A;  3O37 A;  4A9H A;  5HQ7 A;  5IGL A;  5KO4 A;  3SVH A;  4PS5 A;  4CUS A;  4YYM A;  4IOR A;  4QEV A;  4CL9 A;  3SVF A;  5FFV A;  5C89 A;  3D7C A;  4OUF A;  3I3J A;  5E3G A;  2E7N A;  4LZR A;  5AD2 A;  4QSS A;  4TTE A;  5I86 A;  1WUM A;  4UIU A;  5A85 A;  4YYI A;  2YQD A;  3JVJ A;  4NYV A;  4HXK A;  5EV9 A;  4IOQ A;  4LYW A;  3FKM X;  2DVR A;  2DKW A;  5ENI A;  3UV4 A;  4TQN A;  4A9E A;  5FE6 A;  5C4Q A;  4MR6 A;  4YAX A;  5EPB A;  5H1V A;  5DFD A;  4ZQL A;  2RFJ A;  5LJ2 A;  4UYH A;  4MEN A;  3UVD A;  3K2J A;  4UYG A;  5EWD A;  5FE5 A;  1JSP B;  2OUO A;  3P1E A;  4N4F A;  4NQN A;  4A9O A;  4YY4 A;  5D3T A;  5H1T A;  5EP7 A;  5C87 A;  4Z6H A;  3LJW A;  5E0R A;  4IR3 A;  4F3I A;  3JVM A;  4QYL A;  3UVW A;  5EM3 A;  5FE2 A;  4HXS A;  5ENG A;  5C8G A;  5FBX A;  5F1H A;  5KTX A;  4AKN A;  5CQ4 A;  5CU8 A;  5DKC A;  5EWV A;  4HXL A;  3LQI A;  5DY7 A;  4UIW A;  3Q2F A;  4UYF A;  4CUR A;  2I7K A;  5A5Q A;  5HEN A;  3Q2E A;  4YBT A;  5CQ5 A;  5TB6 A;  4HBW A;  4QSU A;  5A82 A;  4QBM A;  3U5L A;  5EGU A;  5D3P A;  4FLP A;  5I88 A;  2YYN A;  2OO1 A;  4O76 A;  4QB3 A;  5A83 A;  5CPE A;  2RS9 B;  5D25 A;  5LKT A;  3LQJ A;  5KU3 A;  4QEW A;  5CRZ A;  5HRV A;  5E9Y A;  5CUA A;  3U5P A;  5A5R A;  5KHM A;  4QNS A;  4NQM A;  3IU5 A;  4KV1 A;  5FE8 A;  4N4H A;  5A81 A;  5D3H A;  4CUU A;  4QSW A;  4QSR A;  2DVQ A;  2F6J A;  4OGJ A;  4N3W A;  4HXP A;  5I40 A;  4C66 A;  1WUG A;  5E9I A;  5DX4 A;  4YAB A;  4Z1Q A;  5IBN A;  2LSP B;  4QYD A;  5CUD A;  4O7C A;  2WP1 A;  4RVR A;  3O33 A;  5E73 A;  4LZ2 A;  5F36 A;  5CQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...