5EPSA

Crystal structure of the human brpf1 bromodomain in complex with seed10
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5epsA00
5LKUA 4Z93A 3ZYUA 4IR6A 3G0LA 1JSPB 4QSSA 5EQ1A 5E74A 5EA1A 5FH6A 4O74A 5F3AA 3FKMX 4NUDA 3RCWA 5A82A 4ALHA 4MR5A 4NYVA 4WIVA 5KTWA 4HXOA 3MUKA 3MXFA 2RFJA 5HFRA 5HCLA 4YYDA 5ENFA 2YYNA 5EISA 5FE2A 4QSTA 4O78A 4CUUA 2GRCA 2DVQA 5DLXA 5A5NA 3JVMA 5D3LA 4ZC9A 5KU3A 5HQ5A 4PTBA 2RNXA 4YBMA 4QZSA 2WP2A 4QUUA 5ETBA 4UIWA 4BW2A 4LC2A 5CQ5A 4LZSA 4BW1A 4E96A 4XYAA 5BT3A 3UV5A 4CL9A 2YEKA 3K2JA 5A81A 5A85A 5EV9A 4O72A 5IG6A 2G4AA 5EPBA 4NR5A 3Q2FA 5AD3A 5AMEA 4YYJA 5A5OA 2DATA 4HBWA 5LJ2A 2L85A 4HBXA 5D3TA 5EWWA 5BT4A 3O33A 5CQ4A 5A5PA 5KTXA 5CUBA 4QSQA 4A9LA 5CQ7A 5TB6A 4Y03A 5DKDA 5F36A 5F61A 4A9IA 5A5RA 4QSPA 5LUUA 5JI8A 5E3GA 5DY7A 2N9GA 4CLBA 5EP7A 1WUGA 4CUQA 4F3IA 4YBSA 2F6JA 5HJCA 5E0RA 5HRXA 4NRCA 3LJWA 5CPEA 5DYXA 4ZQLA 4KV4A 4UYGA 4MEQA 4Z1SA 5LVRA 4NR8A 4TZ2A 5D25A 3MB4A 4UYFA 4WHUA 5DFBA 2L5EA 5CY9A 5I88A 4FLPA 5CQ6A 4O7AA 5CP5A 5D7XA 4NR4A 4QSWA 5FG4A 5A83A 5KTUA 5DFDA 5AD2A 3S92A 5FE1A 4PKLA 2I7KA 5DYUA 2OSSA 5DX4A 3SVHA 4QY4A 3TLPA 2R0SA 2R0VA 5F25A 4N3WA 4XUBA 5F2PA 4YYIA 4KV1A 2RNYA 5EWCA 2RNWA 3SVFA 5C89A 4O7FA 2RS9B 3LQIA 4YH3A 4UYEA 4UIZA 4PY6A 4HXRA 3O37A 4NQMA 5F1LA 3U5NA 4HXKA 4C66A 4AKNA 4NXJA 5DW2A 3U5JA 5CUDA 5II2A 5FH8A 4MR3A 4Z6HA 4CFKA 2RI7A 4HXNA 4BW4A 5EWVA 3P5OA 4XY9A 5D0CA 3JVLA 4YYHA 5D3HA 3S91A 5HM0A 4UYHA 4NR6A 4QUTA 5L96A 2DVRA 2DWWA 5IIDA 4J0SA 3UV2A 5EK9A 4NQNA 4KCXA 4UIUA 4YK0A 3QZTA 4YYKA 5LJ1A 4QSXA 1X0JA 3QZSA 5EM3A 4IORA 5H1VA 4O76A 4CFLA 3LQHA 4PS5A 4TU6A 5EVAA 3O36A 5I7YA 2L84A 5CQ3A 4OUFA 5FE4A 2E7NA 4PCEA 5I86A 4O70A 4Q0OA 5DFCA 4A9HA 5CUGA 4YBTA 4NUEA 4YYGA 5D3RA 3U5MA 4NS5A 4QR4A 2YW5A 3LXJA 5ENJA 5D3PA 5EWHA 4A9OA 5FDZA 5LKTA 5CTLA 4X2IA 2E3KA 5HLSA 5EI4A 5D3NA 5E9LA 3IU6A 5HEMA 5E73A 3P1FA 3AQAA 4IR4A 4N4GA 4CURA 5D26A 4QNSA 4UYDA 4J3IA 5CUAA 4NRAA 4CUPA 4LYSA 5FFYA 5E9MA 4Z1QA 2E7OA 5E9VA 3UVXA 5FE9A 3MB3A 5FE8A 4QYLA 4YYNA 4QSRA 5F62A 3HMFA 3D7CA 5H1UA 5CUEA 5HRVA 5CGPA 5ENGA 4LYIA 4QBMA 3UVYA 3QZVA 4YAXA 4LDFA 3U5PA 2YEMA 4LR6A 4IR3A 3NXBA 2R10A 4BW3A 5ENIA 5I7XA 5LJ0A 3O35A 5L97A 3I3JA 4XUAA 3JVJA 1N72A 4LZ2A 4MENA 5L8UA 5CU8A 1ZS5A 4O7BA 4YATA 5CZGA 3JVKA 4HBYA 4QC1A 4QSVA 4TYLA 3Q2EA 4TU4A 1F68A 5F63A 5CRMA 5CS8A 5ENBA 4QYDA 4QEWA 5F1HA 5DBMA 4N4HA 5ETDA 5FE5A 4TZ8A 4LZRA 4Z6IA 5CQAA 4YY6A 3O34A 5CFWA 4QR3A 5I1QA 4CUTA 5E7DA 5KHMA 4A9JA 5E9IA 4UIYA 5F5ZA 5LKZA 4NUCA 2DVSA 4QR5A 5DYCA 5IGKA 5C85A 5FB1A 5L8TA 3P1EA 2D9EA 4MR4A 2R0YA 4YH4A 1JM4B 4YY4A 5ENCA 4A9FA 5JWMA 4TS8A 5ACYA 3LQJA 4QC3A 4J1PA 5EPSA 4IR5A 3U5OA 4UYFB 2OO1A 2RO1A 4HBVA 3U5LA 5EU1A 5FE7A 4O7CA 4WHWA 4TTEA 5CUCA 4BHWA 5HELA 5DLZA 4IOQA 5BT5A 2MJVB 3MULA 4A9MA 4HXSA 3UVDA 4TQNA 4O71A 4UIXA 2OUOA 4LYWA 4OGJA 5EGUA 4N4FA 5DKHA 5CQTA 4NR7A 5C7NA 4BJXA 5FE0A 5FB0A 4YC9A 5IGLA 4MEOA 5A7CA 3SVGA 5FE3A 3DAIA 3IU5A 4ZW1A 5E3DA 4NRBA 5C4QA 2I8NA 3HMEA 5FBXA 4QEUA 4UIVA 4C67A 1EQFA 4MEPA 4HXLA 3GG3A 5C87A 5IGMA 5L99A 4N4IA 5FE6A 4PCIA 2YELA 4NYWA 4RVRA 4O77A 4NYXA 2YDWA 5I89A 5L98A 5HRWA 4YABA 2D82A 2KTBB 5HENA 5HQ7A 1WUMA 4LRGA 5KO4A 5FFWA 3HMHA 5LVQA 5EICA 5C8GA 5CQ8A 4CUSA 5E9KA 3P1DA 5D24A 3UV4A 2FSAA 3ONIA 5FG6A 5DYAA 4YYMA 5G4SA 5F60A 4YADA 4A9KA 5A5SA 4TT2A 5ENHA 5D3SA 4ALGA 5HFQA 4TT4A 4Q0NA 4HXMA 4XY8A 5A5QA 5G4RA 3U5KA 2H60A 4MR6A 4TT6A 4UITA 5DW1A 2YQDA 5AMFA 3AADA 5EWDA 5COIA 5K29A 5I40A 5II1A 5D3JA 3UVWA 4A9EA 2DKWA 4NR9A 3G0JA 5J0DA 5CRZA 5E9YA 1E6IA 5H1TA 4IOOA 4J0RA 5I83A 5LKXA 5FFVA 5HQ6A 5ENEA 4A9NA 5IGNA 4O75A 5FH7A 5IBNA 3DWYA 4QSUA 4OGIA 3P1CA 5FG5A 5I29A 4HXPA 2F6NA 5EPRA 4O7EA 3MQMA 5H85A 2NXBA 4DONA 4QB3A 4GPJA 2LSPB 3UW9A 2DVVA 5DKCA 4QEVA 2WP1A 5TCMA 5I80A
chains in the Genus database with same CATH superfamily
5LKUA 4Z93A 3ZYUA 4IR6A 3G0LA 1JSPB 3D1BA 4QSSA 5EQ1A 5E74A 5EA1A 5FH6A 4AKHA 4O74A 5F3AA 3FKMX 4NUDA 3RCWA 3D1DA 5A82A 4ALHA 4MR5A 4NYVA 4WIVA 5KTWA 4HXOA 3MUKA 3MXFA 2RFJA 5HFRA 5HCLA 4YYDA 3ERRA 5ENFA 2YYNA 5EISA 5FE2A 4QSTA 4O78A 4CUUA 2GRCA 2DVQA 5DLXA 5A5NA 3JVMA 5D3LA 4ZC9A 5KU3A 5HQ5A 4PTBA 2RNXA 4YBMA 4QZSA 2WP2A 4QUUA 5ETBA 4UIWA 3VKGA 4BW2A 4LC2A 5CQ5A 4LZSA 4BW1A 4E96A 4XYAA 5BT3A 3UV5A 4CL9A 2YEKA 3K2JA 5A81A 5A85A 5EV9A 4O72A 5IG6A 2G4AA 5EPBA 4NR5A 3Q2FA 5AD3A 5AMEA 4YYJA 5A5OA 2DATA 4HBWA 5LJ2A 2L85A 4HBXA 5D3TA 5EWWA 5BT4A 3O33A 5CQ4A 5A5PA 5KTXA 5CUBA 4QSQA 4A9LA 5CQ7A 5TB6A 4Y03A 5DKDA 5F36A 5F61A 4A9IA 5A5RA 4QSPA 5LUUA 5JI8A 5E3GA 5DY7A 2N9GA 4CLBA 5EP7A 1WUGA 4CUQA 4F3IA 4YBSA 2F6JA 5HJCA 5E0RA 5HRXA 4NRCA 1ZKRA 3LJWA 5CPEA 5DYXA 4ZQLA 4KV4A 4UYGA 4MEQA 4Z1SA 5LVRA 4NR8A 4TZ2A 5D25A 3MB4A 4UYFA 4WHUA 5DFBA 2L5EA 5CY9A 5I88A 4FLPA 5CQ6A 4O7AA 5CP5A 5D7XA 4NR4A 4QSWA 5FG4A 5A83A 5KTUA 5DFDA 5AD2A 3S92A 5FE1A 4PKLA 2I7KA 5DYUA 2OSSA 5DX4A 3SVHA 4QY4A 3TLPA 2R0SA 2R0VA 5F25A 4N3WA 4XUBA 5F2PA 4YYIA 4KV1A 2RNYA 5EWCA 2RNWA 3SVFA 5C89A 4O7FA 2RS9B 3LQIA 4YH3A 4UYEA 4UIZA 4PY6A 4HXRA 3O37A 4NQMA 5F1LA 3U5NA 4HXKA 4C66A 1PUOA 4AKNA 4NXJA 5DW2A 3U5JA 5CUDA 5II2A 5FH8A 4MR3A 4Z6HA 4CFKA 2RI7A 4HXNA 4BW4A 5EWVA 3P5OA 4XY9A 5D0CA 3JVLA 4YYHA 5D3HA 3S91A 5HM0A 4UYHA 4NR6A 4QUTA 5L96A 2DVRA 2DWWA 5IIDA 4J0SA 3UV2A 5EK9A 4NQNA 4KCXA 4UIUA 4YK0A 3QZTA 4YYKA 5LJ1A 4QSXA 1X0JA 3QZSA 5EM3A 4IORA 4AI6A 5H1VA 4O76A 4CFLA 3LQHA 4PS5A 4TU6A 5EVAA 3O36A 5I7YA 2L84A 5CQ3A 4OUFA 5FE4A 2E7NA 4PCEA 5I86A 4O70A 4Q0OA 5DFCA 4A9HA 5CUGA 4YBTA 4NUEA 4YYGA 5D3RA 3U5MA 4NS5A 4QR4A 2YW5A 3LXJA 5ENJA 5D3PA 5EWHA 4A9OA 5FDZA 5LKTA 5CTLA 4X2IA 2E3KA 5HLSA 5EI4A 5D3NA 5E9LA 3IU6A 5HEMA 5E73A 3P1FA 3AQAA 4IR4A 4N4GA 4CURA 5D26A 4QNSA 4UYDA 4J3IA 5CUAA 4NRAA 4CUPA 4LYSA 5FFYA 5E9MA 4Z1QA 2E7OA 5E9VA 3UVXA 5FE9A 3MB3A 5FE8A 4QYLA 4YYNA 4QSRA 5F62A 3HMFA 3D7CA 5H1UA 5CUEA 5HRVA 5CGPA 5ENGA 4LYIA 4QBMA 3UVYA 3QZVA 4YAXA 4LDFA 3U5PA 2YEMA 4LR6A 4IR3A 3NXBA 4AKGA 2R10A 4BW3A 5ENIA 5I7XA 5LJ0A 3O35A 5L97A 3I3JA 4XUAA 3JVJA 1N72A 4LZ2A 4MENA 5L8UA 5CU8A 1ZS5A 4O7BA 4YATA 5CZGA 3JVKA 4HBYA 4QC1A 4QSVA 2EJNA 4TYLA 3Q2EA 4TU4A 1F68A 5F63A 5CRMA 5CS8A 5ENBA 4QYDA 4QEWA 5F1HA 5DBMA 4N4HA 5ETDA 5FE5A 4TZ8A 4LZRA 4Z6IA 5CQAA 4YY6A 3O34A 5CFWA 4QR3A 5I1QA 4CUTA 5E7DA 5KHMA 4A9JA 5E9IA 4UIYA 5F5ZA 5LKZA 4NUCA 2DVSA 4QR5A 5DYCA 5IGKA 5C85A 5FB1A 5L8TA 3P1EA 2D9EA 4MR4A 2R0YA 4YH4A 1JM4B 4YY4A 5ENCA 4A9FA 5JWMA 4TS8A 5ACYA 3LQJA 4QC3A 4J1PA 5EPSA 4IR5A 3VKHA 3U5OA 4UYFB 2OO1A 2RO1A 4HBVA 3U5LA 5EU1A 5FE7A 4O7CA 4WHWA 4TTEA 5CUCA 4BHWA 5HELA 5DLZA 4IOQA 5BT5A 2MJVB 3MULA 4A9MA 4HXSA 3UVDA 4TQNA 4O71A 4UIXA 2OUOA 4LYWA 4OGJA 5EGUA 4N4FA 5DKHA 5CQTA 4NR7A 5C7NA 4BJXA 5FE0A 5FB0A 4YC9A 5IGLA 4MEOA 5A7CA 3SVGA 5FE3A 3DAIA 3IU5A 4ZW1A 5E3DA 4NRBA 5C4QA 2I8NA 3HMEA 5FBXA 4QEUA 4UIVA 4C67A 1EQFA 4MEPA 4HXLA 3GG3A 5C87A 5IGMA 5L99A 4N4IA 5FE6A 4PCIA 4AKIA 2YELA 4NYWA 4RVRA 4O77A 4NYXA 2YDWA 5I89A 5L98A 5HRWA 4YABA 2D82A 2KTBB 5HENA 5HQ7A 1WUMA 4LRGA 5KO4A 5FFWA 3HMHA 5LVQA 5EICA 5C8GA 5CQ8A 4CUSA 5E9KA 3P1DA 5D24A 3UV4A 2FSAA 3ONIA 5FG6A 5DYAA 4YYMA 5G4SA 5F60A 4YADA 4A9KA 5A5SA 4TT2A 5ENHA 5D3SA 4ALGA 5HFQA 4TT4A 4Q0NA 4HXMA 4XY8A 5A5QA 5G4RA 3U5KA 2H60A 4MR6A 4TT6A 4UITA 5DW1A 2YQDA 5AMFA 3AADA 5EWDA 5COIA 5K29A 5I40A 5II1A 5D3JA 3UVWA 4A9EA 2DKWA 4NR9A 3G0JA 5J0DA 5CRZA 5E9YA 1E6IA 5H1TA 4IOOA 4J0RA 5I83A 5LKXA 5FFVA 5HQ6A 5ENEA 4A9NA 5IGNA 4O75A 5FH7A 5IBNA 3DWYA 4QSUA 4OGIA 3P1CA 5FG5A 5I29A 4HXPA 2F6NA 5EPRA 4O7EA 3MQMA 5H85A 2NXBA 4DONA 4QB3A 4GPJA 2LSPB 3UW9A 2DVVA 5DKCA 4QEVA 2WP1A 5TCMA 5I80A
chains in the Genus database with same CATH topology
5LKUA 4Z93A 3ZYUA 4IR6A 3G0LA 1JSPB 4QSSA 5EQ1A 5E74A 5EA1A 5FH6A 4O74A 5F3AA 3FKMX 4NUDA 3RCWA 5A82A 4ALHA 4MR5A 4NYVA 4WIVA 5KTWA 4HXOA 3MUKA 3MXFA 2RFJA 5HFRA 5HCLA 4YYDA 5ENFA 2YYNA 5EISA 5FE2A 4QSTA 4O78A 4CUUA 2GRCA 2DVQA 5DLXA 5A5NA 3JVMA 5D3LA 4ZC9A 5KU3A 5HQ5A 4PTBA 2RNXA 4YBMA 4QZSA 2WP2A 4QUUA 5ETBA 4UIWA 4BW2A 4LC2A 5CQ5A 4LZSA 4BW1A 4E96A 4XYAA 5BT3A 3UV5A 4CL9A 2YEKA 3K2JA 5A81A 5A85A 5EV9A 4O72A 5IG6A 2G4AA 5EPBA 4NR5A 3Q2FA 5AD3A 5AMEA 4YYJA 5A5OA 2DATA 4HBWA 5LJ2A 2L85A 4HBXA 5D3TA 5EWWA 5BT4A 3O33A 5CQ4A 5A5PA 5KTXA 5CUBA 4QSQA 4A9LA 5CQ7A 5TB6A 4Y03A 5DKDA 5F36A 5F61A 4A9IA 5A5RA 4QSPA 5LUUA 5JI8A 5E3GA 5DY7A 2N9GA 4CLBA 5EP7A 1WUGA 4CUQA 4F3IA 4YBSA 2F6JA 5HJCA 5E0RA 5HRXA 4NRCA 3LJWA 5CPEA 5DYXA 4ZQLA 4KV4A 4UYGA 4MEQA 4Z1SA 5LVRA 4NR8A 4TZ2A 5D25A 3MB4A 4UYFA 4WHUA 5DFBA 2L5EA 5CY9A 5I88A 4FLPA 5CQ6A 4O7AA 5CP5A 5D7XA 4NR4A 4QSWA 5FG4A 5A83A 5KTUA 5DFDA 5AD2A 3S92A 5FE1A 4PKLA 2I7KA 5DYUA 2OSSA 5DX4A 3SVHA 4QY4A 3TLPA 2R0SA 2R0VA 5F25A 4N3WA 4XUBA 5F2PA 4YYIA 4KV1A 2RNYA 5EWCA 2RNWA 3SVFA 5C89A 4O7FA 2RS9B 3LQIA 4YH3A 4UYEA 4UIZA 4PY6A 4HXRA 3O37A 4NQMA 5F1LA 3U5NA 4HXKA 4C66A 4AKNA 4NXJA 5DW2A 3U5JA 5CUDA 5II2A 5FH8A 4MR3A 4Z6HA 4CFKA 2RI7A 4HXNA 4BW4A 5EWVA 3P5OA 4XY9A 5D0CA 3JVLA 4YYHA 5D3HA 3S91A 5HM0A 4UYHA 4NR6A 4QUTA 5L96A 2DVRA 2DWWA 5IIDA 4J0SA 3UV2A 5EK9A 4NQNA 4KCXA 4UIUA 4YK0A 3QZTA 4YYKA 5LJ1A 4QSXA 1X0JA 3QZSA 5EM3A 4IORA 5H1VA 4O76A 4CFLA 3LQHA 4PS5A 4TU6A 5EVAA 3O36A 5I7YA 2L84A 5CQ3A 4OUFA 5FE4A 2E7NA 4PCEA 5I86A 4O70A 4Q0OA 5DFCA 4A9HA 5CUGA 4YBTA 4NUEA 4YYGA 5D3RA 3U5MA 4NS5A 4QR4A 2YW5A 3LXJA 5ENJA 5D3PA 5EWHA 4A9OA 5FDZA 5LKTA 5CTLA 4X2IA 2E3KA 5HLSA 5EI4A 5D3NA 5E9LA 3IU6A 5HEMA 5E73A 3P1FA 3AQAA 4IR4A 4N4GA 4CURA 5D26A 4QNSA 4UYDA 4J3IA 5CUAA 4NRAA 4CUPA 4LYSA 5FFYA 5E9MA 4Z1QA 2E7OA 5E9VA 3UVXA 5FE9A 3MB3A 5FE8A 4QYLA 4YYNA 4QSRA 5F62A 3HMFA 3D7CA 5H1UA 5CUEA 5HRVA 5CGPA 5ENGA 4LYIA 4QBMA 3UVYA 3QZVA 4YAXA 4LDFA 3U5PA 2YEMA 4LR6A 4IR3A 3NXBA 2R10A 4BW3A 5ENIA 5I7XA 5LJ0A 3O35A 5L97A 3I3JA 4XUAA 3JVJA 1N72A 4LZ2A 4MENA 5L8UA 5CU8A 1ZS5A 4O7BA 4YATA 5CZGA 3JVKA 4HBYA 4QC1A 4QSVA 4TYLA 3Q2EA 4TU4A 1F68A 5F63A 5CRMA 5CS8A 5ENBA 4QYDA 4QEWA 5F1HA 5DBMA 4N4HA 5ETDA 5FE5A 4TZ8A 4LZRA 4Z6IA 5CQAA 4YY6A 3O34A 5CFWA 4QR3A 5I1QA 4CUTA 5E7DA 5KHMA 4A9JA 5E9IA 4UIYA 5F5ZA 5LKZA 4NUCA 2DVSA 4QR5A 5DYCA 5IGKA 5C85A 5FB1A 5L8TA 3P1EA 2D9EA 4MR4A 2R0YA 4YH4A 1JM4B 4YY4A 5ENCA 4A9FA 5JWMA 4TS8A 5ACYA 3LQJA 4QC3A 4J1PA 5EPSA 4IR5A 3U5OA 4UYFB 2OO1A 2RO1A 4HBVA 3U5LA 5EU1A 5FE7A 4O7CA 4WHWA 4TTEA 5CUCA 4BHWA 5HELA 5DLZA 4IOQA 5BT5A 2MJVB 3MULA 4A9MA 4HXSA 3UVDA 4TQNA 4O71A 4UIXA 2OUOA 4LYWA 4OGJA 5EGUA 4N4FA 5DKHA 5CQTA 4NR7A 5C7NA 4BJXA 5FE0A 5FB0A 4YC9A 5IGLA 4MEOA 5A7CA 3SVGA 5FE3A 3DAIA 3IU5A 4ZW1A 5E3DA 4NRBA 5C4QA 2I8NA 3HMEA 5FBXA 4QEUA 4UIVA 4C67A 1EQFA 4MEPA 4HXLA 3GG3A 5C87A 5IGMA 5L99A 4N4IA 5FE6A 4PCIA 2YELA 4NYWA 4RVRA 4O77A 4NYXA 2YDWA 5I89A 5L98A 5HRWA 4YABA 2D82A 2KTBB 5HENA 5HQ7A 1WUMA 4LRGA 5KO4A 5FFWA 3HMHA 5LVQA 5EICA 5C8GA 5CQ8A 4CUSA 5E9KA 3P1DA 5D24A 3UV4A 2FSAA 3ONIA 5FG6A 5DYAA 4YYMA 5G4SA 5F60A 4YADA 4A9KA 5A5SA 4TT2A 5ENHA 5D3SA 4ALGA 5HFQA 4TT4A 4Q0NA 4HXMA 4XY8A 5A5QA 5G4RA 3U5KA 2H60A 4MR6A 4TT6A 4UITA 5DW1A 2YQDA 5AMFA 3AADA 5EWDA 5COIA 5K29A 5I40A 5II1A 5D3JA 3UVWA 4A9EA 2DKWA 4NR9A 3G0JA 5J0DA 5CRZA 5E9YA 1E6IA 5H1TA 4IOOA 4J0RA 5I83A 5LKXA 5FFVA 5HQ6A 5ENEA 4A9NA 5IGNA 4O75A 5FH7A 5IBNA 3DWYA 4QSUA 4OGIA 3P1CA 5FG5A 5I29A 4HXPA 2F6NA 5EPRA 4O7EA 3MQMA 5H85A 2NXBA 4DONA 4QB3A 4GPJA 2LSPB 3UW9A 2DVVA 5DKCA 4QEVA 2WP1A 5TCMA 5I80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LKU A;  4Z93 A;  3ZYU A;  4IR6 A;  3G0L A;  1JSP B;  4QSS A;  5EQ1 A;  5E74 A;  5EA1 A;  5FH6 A;  4O74 A;  5F3A A;  3FKM X;  4NUD A;  3RCW A;  5A82 A;  4ALH A;  4MR5 A;  4NYV A;  4WIV A;  5KTW A;  4HXO A;  3MUK A;  3MXF A;  2RFJ A;  5HFR A;  5HCL A;  4YYD A;  5ENF A;  2YYN A;  5EIS A;  5FE2 A;  4QST A;  4O78 A;  4CUU A;  2GRC A;  2DVQ A;  5DLX A;  5A5N A;  3JVM A;  5D3L A;  4ZC9 A;  5KU3 A;  5HQ5 A;  4PTB A;  2RNX A;  4YBM A;  4QZS A;  2WP2 A;  4QUU A;  5ETB A;  4UIW A;  4BW2 A;  4LC2 A;  5CQ5 A;  4LZS A;  4BW1 A;  4E96 A;  4XYA A;  5BT3 A;  3UV5 A;  4CL9 A;  2YEK A;  3K2J A;  5A81 A;  5A85 A;  5EV9 A;  4O72 A;  5IG6 A;  2G4A A;  5EPB A;  4NR5 A;  3Q2F A;  5AD3 A;  5AME A;  4YYJ A;  5A5O A;  2DAT A;  4HBW A;  5LJ2 A;  2L85 A;  4HBX A;  5D3T A;  5EWW A;  5BT4 A;  3O33 A;  5CQ4 A;  5A5P A;  5KTX A;  5CUB A;  4QSQ A;  4A9L A;  5CQ7 A;  5TB6 A;  4Y03 A;  5DKD A;  5F36 A;  5F61 A;  4A9I A;  5A5R A;  4QSP A;  5LUU A;  5JI8 A;  5E3G A;  5DY7 A;  2N9G A;  4CLB A;  5EP7 A;  1WUG A;  4CUQ A;  4F3I A;  4YBS A;  2F6J A;  5HJC A;  5E0R A;  5HRX A;  4NRC A;  3LJW A;  5CPE A;  5DYX A;  4ZQL A;  4KV4 A;  4UYG A;  4MEQ A;  4Z1S A;  5LVR A;  4NR8 A;  4TZ2 A;  5D25 A;  3MB4 A;  4UYF A;  4WHU A;  5DFB A;  2L5E A;  5CY9 A;  5I88 A;  4FLP A;  5CQ6 A;  4O7A A;  5CP5 A;  5D7X A;  4NR4 A;  4QSW A;  5FG4 A;  5A83 A;  5KTU A;  5DFD A;  5AD2 A;  3S92 A;  5FE1 A;  4PKL A;  2I7K A;  5DYU A;  2OSS A;  5DX4 A;  3SVH A;  4QY4 A;  3TLP A;  2R0S A;  2R0V A;  5F25 A;  4N3W A;  4XUB A;  5F2P A;  4YYI A;  4KV1 A;  2RNY A;  5EWC A;  2RNW A;  3SVF A;  5C89 A;  4O7F A;  2RS9 B;  3LQI A;  4YH3 A;  4UYE A;  4UIZ A;  4PY6 A;  4HXR A;  3O37 A;  4NQM A;  5F1L A;  3U5N A;  4HXK A;  4C66 A;  4AKN A;  4NXJ A;  5DW2 A;  3U5J A;  5CUD A;  5II2 A;  5FH8 A;  4MR3 A;  4Z6H A;  4CFK A;  2RI7 A;  4HXN A;  4BW4 A;  5EWV A;  3P5O A;  4XY9 A;  5D0C A;  3JVL A;  4YYH A;  5D3H A;  3S91 A;  5HM0 A;  4UYH A;  4NR6 A;  4QUT A;  5L96 A;  2DVR A;  2DWW A;  5IID A;  4J0S A;  3UV2 A;  5EK9 A;  4NQN A;  4KCX A;  4UIU A;  4YK0 A;  3QZT A;  4YYK A;  5LJ1 A;  4QSX A;  1X0J A;  3QZS A;  5EM3 A;  4IOR A;  5H1V A;  4O76 A;  4CFL A;  3LQH A;  4PS5 A;  4TU6 A;  5EVA A;  3O36 A;  5I7Y A;  2L84 A;  5CQ3 A;  4OUF A;  5FE4 A;  2E7N A;  4PCE A;  5I86 A;  4O70 A;  4Q0O A;  5DFC A;  4A9H A;  5CUG A;  4YBT A;  4NUE A;  4YYG A;  5D3R A;  3U5M A;  4NS5 A;  4QR4 A;  2YW5 A;  3LXJ A;  5ENJ A;  5D3P A;  5EWH A;  4A9O A;  5FDZ A;  5LKT A;  5CTL A;  4X2I A;  2E3K A;  5HLS A;  5EI4 A;  5D3N A;  5E9L A;  3IU6 A;  5HEM A;  5E73 A;  3P1F A;  3AQA A;  4IR4 A;  4N4G A;  4CUR A;  5D26 A;  4QNS A;  4UYD A;  4J3I A;  5CUA A;  4NRA A;  4CUP A;  4LYS A;  5FFY A;  5E9M A;  4Z1Q A;  2E7O A;  5E9V A;  3UVX A;  5FE9 A;  3MB3 A;  5FE8 A;  4QYL A;  4YYN A;  4QSR A;  5F62 A;  3HMF A;  3D7C A;  5H1U A;  5CUE A;  5HRV A;  5CGP A;  5ENG A;  4LYI A;  4QBM A;  3UVY A;  3QZV A;  4YAX A;  4LDF A;  3U5P A;  2YEM A;  4LR6 A;  4IR3 A;  3NXB A;  2R10 A;  4BW3 A;  5ENI A;  5I7X A;  5LJ0 A;  3O35 A;  5L97 A;  3I3J A;  4XUA A;  3JVJ A;  1N72 A;  4LZ2 A;  4MEN A;  5L8U A;  5CU8 A;  1ZS5 A;  4O7B A;  4YAT A;  5CZG A;  3JVK A;  4HBY A;  4QC1 A;  4QSV A;  4TYL A;  3Q2E A;  4TU4 A;  1F68 A;  5F63 A;  5CRM A;  5CS8 A;  5ENB A;  4QYD A;  4QEW A;  5F1H A;  5DBM A;  4N4H A;  5ETD A;  5FE5 A;  4TZ8 A;  4LZR A;  4Z6I A;  5CQA A;  4YY6 A;  3O34 A;  5CFW A;  4QR3 A;  5I1Q A;  4CUT A;  5E7D A;  5KHM A;  4A9J A;  5E9I A;  4UIY A;  5F5Z A;  5LKZ A;  4NUC A;  2DVS A;  4QR5 A;  5DYC A;  5IGK A;  5C85 A;  5FB1 A;  5L8T A;  3P1E A;  2D9E A;  4MR4 A;  2R0Y A;  4YH4 A;  1JM4 B;  4YY4 A;  5ENC A;  4A9F A;  5JWM A;  4TS8 A;  5ACY A;  3LQJ A;  4QC3 A;  4J1P A;  5EPS A;  4IR5 A;  3U5O A;  4UYF B;  2OO1 A;  2RO1 A;  4HBV A;  3U5L A;  5EU1 A;  5FE7 A;  4O7C A;  4WHW A;  4TTE A;  5CUC A;  4BHW A;  5HEL A;  5DLZ A;  4IOQ A;  5BT5 A;  2MJV B;  3MUL A;  4A9M A;  4HXS A;  3UVD A;  4TQN A;  4O71 A;  4UIX A;  2OUO A;  4LYW A;  4OGJ A;  5EGU A;  4N4F A;  5DKH A;  5CQT A;  4NR7 A;  5C7N A;  4BJX A;  5FE0 A;  5FB0 A;  4YC9 A;  5IGL A;  4MEO A;  5A7C A;  3SVG A;  5FE3 A;  3DAI A;  3IU5 A;  4ZW1 A;  5E3D A;  4NRB A;  5C4Q A;  2I8N A;  3HME A;  5FBX A;  4QEU A;  4UIV A;  4C67 A;  1EQF A;  4MEP A;  4HXL A;  3GG3 A;  5C87 A;  5IGM A;  5L99 A;  4N4I A;  5FE6 A;  4PCI A;  2YEL A;  4NYW A;  4RVR A;  4O77 A;  4NYX A;  2YDW A;  5I89 A;  5L98 A;  5HRW A;  4YAB A;  2D82 A;  2KTB B;  5HEN A;  5HQ7 A;  1WUM A;  4LRG A;  5KO4 A;  5FFW A;  3HMH A;  5LVQ A;  5EIC A;  5C8G A;  5CQ8 A;  4CUS A;  5E9K A;  3P1D A;  5D24 A;  3UV4 A;  2FSA A;  3ONI A;  5FG6 A;  5DYA A;  4YYM A;  5G4S A;  5F60 A;  4YAD A;  4A9K A;  5A5S A;  4TT2 A;  5ENH A;  5D3S A;  4ALG A;  5HFQ A;  4TT4 A;  4Q0N A;  4HXM A;  4XY8 A;  5A5Q A;  5G4R A;  3U5K A;  2H60 A;  4MR6 A;  4TT6 A;  4UIT A;  5DW1 A;  2YQD A;  5AMF A;  3AAD A;  5EWD A;  5COI A;  5K29 A;  5I40 A;  5II1 A;  5D3J A;  3UVW A;  4A9E A;  2DKW A;  4NR9 A;  3G0J A;  5J0D A;  5CRZ A;  5E9Y A;  1E6I A;  5H1T A;  4IOO A;  4J0R A;  5I83 A;  5LKX A;  5FFV A;  5HQ6 A;  5ENE A;  4A9N A;  5IGN A;  4O75 A;  5FH7 A;  5IBN A;  3DWY A;  4QSU A;  4OGI A;  3P1C A;  5FG5 A;  5I29 A;  4HXP A;  2F6N A;  5EPR A;  4O7E A;  3MQM A;  5H85 A;  2NXB A;  4DON A;  4QB3 A;  4GPJ A;  2LSP B;  3UW9 A;  2DVV A;  5DKC A;  4QEV A;  2WP1 A;  5TCM A;  5I80 A; 
#chains in the Genus database with same CATH topology
 5LKU A;  4Z93 A;  3ZYU A;  4IR6 A;  3G0L A;  1JSP B;  3D1B A;  4QSS A;  5EQ1 A;  5E74 A;  5EA1 A;  5FH6 A;  4AKH A;  4O74 A;  5F3A A;  3FKM X;  4NUD A;  3RCW A;  3D1D A;  5A82 A;  4ALH A;  4MR5 A;  4NYV A;  4WIV A;  5KTW A;  4HXO A;  3MUK A;  3MXF A;  2RFJ A;  5HFR A;  5HCL A;  4YYD A;  3ERR A;  5ENF A;  2YYN A;  5EIS A;  5FE2 A;  4QST A;  4O78 A;  4CUU A;  2GRC A;  2DVQ A;  5DLX A;  5A5N A;  3JVM A;  5D3L A;  4ZC9 A;  5KU3 A;  5HQ5 A;  4PTB A;  2RNX A;  4YBM A;  4QZS A;  2WP2 A;  4QUU A;  5ETB A;  4UIW A;  3VKG A;  4BW2 A;  4LC2 A;  5CQ5 A;  4LZS A;  4BW1 A;  4E96 A;  4XYA A;  5BT3 A;  3UV5 A;  4CL9 A;  2YEK A;  3K2J A;  5A81 A;  5A85 A;  5EV9 A;  4O72 A;  5IG6 A;  2G4A A;  5EPB A;  4NR5 A;  3Q2F A;  5AD3 A;  5AME A;  4YYJ A;  5A5O A;  2DAT A;  4HBW A;  5LJ2 A;  2L85 A;  4HBX A;  5D3T A;  5EWW A;  5BT4 A;  3O33 A;  5CQ4 A;  5A5P A;  5KTX A;  5CUB A;  4QSQ A;  4A9L A;  5CQ7 A;  5TB6 A;  4Y03 A;  5DKD A;  5F36 A;  5F61 A;  4A9I A;  5A5R A;  4QSP A;  5LUU A;  5JI8 A;  5E3G A;  5DY7 A;  2N9G A;  4CLB A;  5EP7 A;  1WUG A;  4CUQ A;  4F3I A;  4YBS A;  2F6J A;  5HJC A;  5E0R A;  5HRX A;  4NRC A;  1ZKR A;  3LJW A;  5CPE A;  5DYX A;  4ZQL A;  4KV4 A;  4UYG A;  4MEQ A;  4Z1S A;  5LVR A;  4NR8 A;  4TZ2 A;  5D25 A;  3MB4 A;  4UYF A;  4WHU A;  5DFB A;  2L5E A;  5CY9 A;  5I88 A;  4FLP A;  5CQ6 A;  4O7A A;  5CP5 A;  5D7X A;  4NR4 A;  4QSW A;  5FG4 A;  5A83 A;  5KTU A;  5DFD A;  5AD2 A;  3S92 A;  5FE1 A;  4PKL A;  2I7K A;  5DYU A;  2OSS A;  5DX4 A;  3SVH A;  4QY4 A;  3TLP A;  2R0S A;  2R0V A;  5F25 A;  4N3W A;  4XUB A;  5F2P A;  4YYI A;  4KV1 A;  2RNY A;  5EWC A;  2RNW A;  3SVF A;  5C89 A;  4O7F A;  2RS9 B;  3LQI A;  4YH3 A;  4UYE A;  4UIZ A;  4PY6 A;  4HXR A;  3O37 A;  4NQM A;  5F1L A;  3U5N A;  4HXK A;  4C66 A;  1PUO A;  4AKN A;  4NXJ A;  5DW2 A;  3U5J A;  5CUD A;  5II2 A;  5FH8 A;  4MR3 A;  4Z6H A;  4CFK A;  2RI7 A;  4HXN A;  4BW4 A;  5EWV A;  3P5O A;  4XY9 A;  5D0C A;  3JVL A;  4YYH A;  5D3H A;  3S91 A;  5HM0 A;  4UYH A;  4NR6 A;  4QUT A;  5L96 A;  2DVR A;  2DWW A;  5IID A;  4J0S A;  3UV2 A;  5EK9 A;  4NQN A;  4KCX A;  4UIU A;  4YK0 A;  3QZT A;  4YYK A;  5LJ1 A;  4QSX A;  1X0J A;  3QZS A;  5EM3 A;  4IOR A;  4AI6 A;  5H1V A;  4O76 A;  4CFL A;  3LQH A;  4PS5 A;  4TU6 A;  5EVA A;  3O36 A;  5I7Y A;  2L84 A;  5CQ3 A;  4OUF A;  5FE4 A;  2E7N A;  4PCE A;  5I86 A;  4O70 A;  4Q0O A;  5DFC A;  4A9H A;  5CUG A;  4YBT A;  4NUE A;  4YYG A;  5D3R A;  3U5M A;  4NS5 A;  4QR4 A;  2YW5 A;  3LXJ A;  5ENJ A;  5D3P A;  5EWH A;  4A9O A;  5FDZ A;  5LKT A;  5CTL A;  4X2I A;  2E3K A;  5HLS A;  5EI4 A;  5D3N A;  5E9L A;  3IU6 A;  5HEM A;  5E73 A;  3P1F A;  3AQA A;  4IR4 A;  4N4G A;  4CUR A;  5D26 A;  4QNS A;  4UYD A;  4J3I A;  5CUA A;  4NRA A;  4CUP A;  4LYS A;  5FFY A;  5E9M A;  4Z1Q A;  2E7O A;  5E9V A;  3UVX A;  5FE9 A;  3MB3 A;  5FE8 A;  4QYL A;  4YYN A;  4QSR A;  5F62 A;  3HMF A;  3D7C A;  5H1U A;  5CUE A;  5HRV A;  5CGP A;  5ENG A;  4LYI A;  4QBM A;  3UVY A;  3QZV A;  4YAX A;  4LDF A;  3U5P A;  2YEM A;  4LR6 A;  4IR3 A;  3NXB A;  4AKG A;  2R10 A;  4BW3 A;  5ENI A;  5I7X A;  5LJ0 A;  3O35 A;  5L97 A;  3I3J A;  4XUA A;  3JVJ A;  1N72 A;  4LZ2 A;  4MEN A;  5L8U A;  5CU8 A;  1ZS5 A;  4O7B A;  4YAT A;  5CZG A;  3JVK A;  4HBY A;  4QC1 A;  4QSV A;  2EJN A;  4TYL A;  3Q2E A;  4TU4 A;  1F68 A;  5F63 A;  5CRM A;  5CS8 A;  5ENB A;  4QYD A;  4QEW A;  5F1H A;  5DBM A;  4N4H A;  5ETD A;  5FE5 A;  4TZ8 A;  4LZR A;  4Z6I A;  5CQA A;  4YY6 A;  3O34 A;  5CFW A;  4QR3 A;  5I1Q A;  4CUT A;  5E7D A;  5KHM A;  4A9J A;  5E9I A;  4UIY A;  5F5Z A;  5LKZ A;  4NUC A;  2DVS A;  4QR5 A;  5DYC A;  5IGK A;  5C85 A;  5FB1 A;  5L8T A;  3P1E A;  2D9E A;  4MR4 A;  2R0Y A;  4YH4 A;  1JM4 B;  4YY4 A;  5ENC A;  4A9F A;  5JWM A;  4TS8 A;  5ACY A;  3LQJ A;  4QC3 A;  4J1P A;  5EPS A;  4IR5 A;  3VKH A;  3U5O A;  4UYF B;  2OO1 A;  2RO1 A;  4HBV A;  3U5L A;  5EU1 A;  5FE7 A;  4O7C A;  4WHW A;  4TTE A;  5CUC A;  4BHW A;  5HEL A;  5DLZ A;  4IOQ A;  5BT5 A;  2MJV B;  3MUL A;  4A9M A;  4HXS A;  3UVD A;  4TQN A;  4O71 A;  4UIX A;  2OUO A;  4LYW A;  4OGJ A;  5EGU A;  4N4F A;  5DKH A;  5CQT A;  4NR7 A;  5C7N A;  4BJX A;  5FE0 A;  5FB0 A;  4YC9 A;  5IGL A;  4MEO A;  5A7C A;  3SVG A;  5FE3 A;  3DAI A;  3IU5 A;  4ZW1 A;  5E3D A;  4NRB A;  5C4Q A;  2I8N A;  3HME A;  5FBX A;  4QEU A;  4UIV A;  4C67 A;  1EQF A;  4MEP A;  4HXL A;  3GG3 A;  5C87 A;  5IGM A;  5L99 A;  4N4I A;  5FE6 A;  4PCI A;  4AKI A;  2YEL A;  4NYW A;  4RVR A;  4O77 A;  4NYX A;  2YDW A;  5I89 A;  5L98 A;  5HRW A;  4YAB A;  2D82 A;  2KTB B;  5HEN A;  5HQ7 A;  1WUM A;  4LRG A;  5KO4 A;  5FFW A;  3HMH A;  5LVQ A;  5EIC A;  5C8G A;  5CQ8 A;  4CUS A;  5E9K A;  3P1D A;  5D24 A;  3UV4 A;  2FSA A;  3ONI A;  5FG6 A;  5DYA A;  4YYM A;  5G4S A;  5F60 A;  4YAD A;  4A9K A;  5A5S A;  4TT2 A;  5ENH A;  5D3S A;  4ALG A;  5HFQ A;  4TT4 A;  4Q0N A;  4HXM A;  4XY8 A;  5A5Q A;  5G4R A;  3U5K A;  2H60 A;  4MR6 A;  4TT6 A;  4UIT A;  5DW1 A;  2YQD A;  5AMF A;  3AAD A;  5EWD A;  5COI A;  5K29 A;  5I40 A;  5II1 A;  5D3J A;  3UVW A;  4A9E A;  2DKW A;  4NR9 A;  3G0J A;  5J0D A;  5CRZ A;  5E9Y A;  1E6I A;  5H1T A;  4IOO A;  4J0R A;  5I83 A;  5LKX A;  5FFV A;  5HQ6 A;  5ENE A;  4A9N A;  5IGN A;  4O75 A;  5FH7 A;  5IBN A;  3DWY A;  4QSU A;  4OGI A;  3P1C A;  5FG5 A;  5I29 A;  4HXP A;  2F6N A;  5EPR A;  4O7E A;  3MQM A;  5H85 A;  2NXB A;  4DON A;  4QB3 A;  4GPJ A;  2LSP B;  3UW9 A;  2DVV A;  5DKC A;  4QEV A;  2WP1 A;  5TCM A;  5I80 A; 
#chains in the Genus database with same CATH homology
 5LKU A;  4Z93 A;  3ZYU A;  4IR6 A;  3G0L A;  1JSP B;  4QSS A;  5EQ1 A;  5E74 A;  5EA1 A;  5FH6 A;  4O74 A;  5F3A A;  3FKM X;  4NUD A;  3RCW A;  5A82 A;  4ALH A;  4MR5 A;  4NYV A;  4WIV A;  5KTW A;  4HXO A;  3MUK A;  3MXF A;  2RFJ A;  5HFR A;  5HCL A;  4YYD A;  5ENF A;  2YYN A;  5EIS A;  5FE2 A;  4QST A;  4O78 A;  4CUU A;  2GRC A;  2DVQ A;  5DLX A;  5A5N A;  3JVM A;  5D3L A;  4ZC9 A;  5KU3 A;  5HQ5 A;  4PTB A;  2RNX A;  4YBM A;  4QZS A;  2WP2 A;  4QUU A;  5ETB A;  4UIW A;  4BW2 A;  4LC2 A;  5CQ5 A;  4LZS A;  4BW1 A;  4E96 A;  4XYA A;  5BT3 A;  3UV5 A;  4CL9 A;  2YEK A;  3K2J A;  5A81 A;  5A85 A;  5EV9 A;  4O72 A;  5IG6 A;  2G4A A;  5EPB A;  4NR5 A;  3Q2F A;  5AD3 A;  5AME A;  4YYJ A;  5A5O A;  2DAT A;  4HBW A;  5LJ2 A;  2L85 A;  4HBX A;  5D3T A;  5EWW A;  5BT4 A;  3O33 A;  5CQ4 A;  5A5P A;  5KTX A;  5CUB A;  4QSQ A;  4A9L A;  5CQ7 A;  5TB6 A;  4Y03 A;  5DKD A;  5F36 A;  5F61 A;  4A9I A;  5A5R A;  4QSP A;  5LUU A;  5JI8 A;  5E3G A;  5DY7 A;  2N9G A;  4CLB A;  5EP7 A;  1WUG A;  4CUQ A;  4F3I A;  4YBS A;  2F6J A;  5HJC A;  5E0R A;  5HRX A;  4NRC A;  3LJW A;  5CPE A;  5DYX A;  4ZQL A;  4KV4 A;  4UYG A;  4MEQ A;  4Z1S A;  5LVR A;  4NR8 A;  4TZ2 A;  5D25 A;  3MB4 A;  4UYF A;  4WHU A;  5DFB A;  2L5E A;  5CY9 A;  5I88 A;  4FLP A;  5CQ6 A;  4O7A A;  5CP5 A;  5D7X A;  4NR4 A;  4QSW A;  5FG4 A;  5A83 A;  5KTU A;  5DFD A;  5AD2 A;  3S92 A;  5FE1 A;  4PKL A;  2I7K A;  5DYU A;  2OSS A;  5DX4 A;  3SVH A;  4QY4 A;  3TLP A;  2R0S A;  2R0V A;  5F25 A;  4N3W A;  4XUB A;  5F2P A;  4YYI A;  4KV1 A;  2RNY A;  5EWC A;  2RNW A;  3SVF A;  5C89 A;  4O7F A;  2RS9 B;  3LQI A;  4YH3 A;  4UYE A;  4UIZ A;  4PY6 A;  4HXR A;  3O37 A;  4NQM A;  5F1L A;  3U5N A;  4HXK A;  4C66 A;  4AKN A;  4NXJ A;  5DW2 A;  3U5J A;  5CUD A;  5II2 A;  5FH8 A;  4MR3 A;  4Z6H A;  4CFK A;  2RI7 A;  4HXN A;  4BW4 A;  5EWV A;  3P5O A;  4XY9 A;  5D0C A;  3JVL A;  4YYH A;  5D3H A;  3S91 A;  5HM0 A;  4UYH A;  4NR6 A;  4QUT A;  5L96 A;  2DVR A;  2DWW A;  5IID A;  4J0S A;  3UV2 A;  5EK9 A;  4NQN A;  4KCX A;  4UIU A;  4YK0 A;  3QZT A;  4YYK A;  5LJ1 A;  4QSX A;  1X0J A;  3QZS A;  5EM3 A;  4IOR A;  5H1V A;  4O76 A;  4CFL A;  3LQH A;  4PS5 A;  4TU6 A;  5EVA A;  3O36 A;  5I7Y A;  2L84 A;  5CQ3 A;  4OUF A;  5FE4 A;  2E7N A;  4PCE A;  5I86 A;  4O70 A;  4Q0O A;  5DFC A;  4A9H A;  5CUG A;  4YBT A;  4NUE A;  4YYG A;  5D3R A;  3U5M A;  4NS5 A;  4QR4 A;  2YW5 A;  3LXJ A;  5ENJ A;  5D3P A;  5EWH A;  4A9O A;  5FDZ A;  5LKT A;  5CTL A;  4X2I A;  2E3K A;  5HLS A;  5EI4 A;  5D3N A;  5E9L A;  3IU6 A;  5HEM A;  5E73 A;  3P1F A;  3AQA A;  4IR4 A;  4N4G A;  4CUR A;  5D26 A;  4QNS A;  4UYD A;  4J3I A;  5CUA A;  4NRA A;  4CUP A;  4LYS A;  5FFY A;  5E9M A;  4Z1Q A;  2E7O A;  5E9V A;  3UVX A;  5FE9 A;  3MB3 A;  5FE8 A;  4QYL A;  4YYN A;  4QSR A;  5F62 A;  3HMF A;  3D7C A;  5H1U A;  5CUE A;  5HRV A;  5CGP A;  5ENG A;  4LYI A;  4QBM A;  3UVY A;  3QZV A;  4YAX A;  4LDF A;  3U5P A;  2YEM A;  4LR6 A;  4IR3 A;  3NXB A;  2R10 A;  4BW3 A;  5ENI A;  5I7X A;  5LJ0 A;  3O35 A;  5L97 A;  3I3J A;  4XUA A;  3JVJ A;  1N72 A;  4LZ2 A;  4MEN A;  5L8U A;  5CU8 A;  1ZS5 A;  4O7B A;  4YAT A;  5CZG A;  3JVK A;  4HBY A;  4QC1 A;  4QSV A;  4TYL A;  3Q2E A;  4TU4 A;  1F68 A;  5F63 A;  5CRM A;  5CS8 A;  5ENB A;  4QYD A;  4QEW A;  5F1H A;  5DBM A;  4N4H A;  5ETD A;  5FE5 A;  4TZ8 A;  4LZR A;  4Z6I A;  5CQA A;  4YY6 A;  3O34 A;  5CFW A;  4QR3 A;  5I1Q A;  4CUT A;  5E7D A;  5KHM A;  4A9J A;  5E9I A;  4UIY A;  5F5Z A;  5LKZ A;  4NUC A;  2DVS A;  4QR5 A;  5DYC A;  5IGK A;  5C85 A;  5FB1 A;  5L8T A;  3P1E A;  2D9E A;  4MR4 A;  2R0Y A;  4YH4 A;  1JM4 B;  4YY4 A;  5ENC A;  4A9F A;  5JWM A;  4TS8 A;  5ACY A;  3LQJ A;  4QC3 A;  4J1P A;  5EPS A;  4IR5 A;  3U5O A;  4UYF B;  2OO1 A;  2RO1 A;  4HBV A;  3U5L A;  5EU1 A;  5FE7 A;  4O7C A;  4WHW A;  4TTE A;  5CUC A;  4BHW A;  5HEL A;  5DLZ A;  4IOQ A;  5BT5 A;  2MJV B;  3MUL A;  4A9M A;  4HXS A;  3UVD A;  4TQN A;  4O71 A;  4UIX A;  2OUO A;  4LYW A;  4OGJ A;  5EGU A;  4N4F A;  5DKH A;  5CQT A;  4NR7 A;  5C7N A;  4BJX A;  5FE0 A;  5FB0 A;  4YC9 A;  5IGL A;  4MEO A;  5A7C A;  3SVG A;  5FE3 A;  3DAI A;  3IU5 A;  4ZW1 A;  5E3D A;  4NRB A;  5C4Q A;  2I8N A;  3HME A;  5FBX A;  4QEU A;  4UIV A;  4C67 A;  1EQF A;  4MEP A;  4HXL A;  3GG3 A;  5C87 A;  5IGM A;  5L99 A;  4N4I A;  5FE6 A;  4PCI A;  2YEL A;  4NYW A;  4RVR A;  4O77 A;  4NYX A;  2YDW A;  5I89 A;  5L98 A;  5HRW A;  4YAB A;  2D82 A;  2KTB B;  5HEN A;  5HQ7 A;  1WUM A;  4LRG A;  5KO4 A;  5FFW A;  3HMH A;  5LVQ A;  5EIC A;  5C8G A;  5CQ8 A;  4CUS A;  5E9K A;  3P1D A;  5D24 A;  3UV4 A;  2FSA A;  3ONI A;  5FG6 A;  5DYA A;  4YYM A;  5G4S A;  5F60 A;  4YAD A;  4A9K A;  5A5S A;  4TT2 A;  5ENH A;  5D3S A;  4ALG A;  5HFQ A;  4TT4 A;  4Q0N A;  4HXM A;  4XY8 A;  5A5Q A;  5G4R A;  3U5K A;  2H60 A;  4MR6 A;  4TT6 A;  4UIT A;  5DW1 A;  2YQD A;  5AMF A;  3AAD A;  5EWD A;  5COI A;  5K29 A;  5I40 A;  5II1 A;  5D3J A;  3UVW A;  4A9E A;  2DKW A;  4NR9 A;  3G0J A;  5J0D A;  5CRZ A;  5E9Y A;  1E6I A;  5H1T A;  4IOO A;  4J0R A;  5I83 A;  5LKX A;  5FFV A;  5HQ6 A;  5ENE A;  4A9N A;  5IGN A;  4O75 A;  5FH7 A;  5IBN A;  3DWY A;  4QSU A;  4OGI A;  3P1C A;  5FG5 A;  5I29 A;  4HXP A;  2F6N A;  5EPR A;  4O7E A;  3MQM A;  5H85 A;  2NXB A;  4DON A;  4QB3 A;  4GPJ A;  2LSP B;  3UW9 A;  2DVV A;  5DKC A;  4QEV A;  2WP1 A;  5TCM A;  5I80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...