5C7NA

Crystal structure of the human brpf1 bromodomain in complex with bromosporine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5c7nA00
5HEMA 4KV4A 3UV2A 4NUEA 4XUBA 3LJWA 2FSAA 5EPRA 4LZSA 5D24A 5CQ8A 2R0YA 4IR3A 2RI7A 3S91A 5EWCA 3G0JA 4CL9A 5CQ7A 4O78A 4QUTA 4ZC9A 5LKXA 5H1TA 2OO1A 3GG3A 5FE1A 5D3TA 3UVWA 2DATA 5EPBA 4QZSA 4YBSA 2D9EA 3O35A 3MUKA 4HBXA 4A9NA 4YYJA 5CRZA 5KTUA 2R0VA 4AKNA 4QY4A 4IORA 3DAIA 5EK9A 5CP5A 5LJ2A 5CQTA 5G4SA 1JM4B 4J1PA 5H85A 2DWWA 4WIVA 5A7CA 3U5LA 5CUDA 4UYFB 4UYDA 4PKLA 2YW5A 4YH3A 4LYIA 5F62A 5CUBA 5HELA 4QYLA 2YQDA 4BW2A 4C67A 4Z93A 3U5JA 5FE4A 4NR5A 4PTBA 4QR5A 3RCWA 3FKMX 4QSQA 5A5RA 4MR4A 5LKUA 5EQ1A 3O36A 5HRWA 4OGJA 5G4RA 4GPJA 4QR3A 5KO4A 3P1CA 5I7YA 5FE5A 5I86A 3P5OA 2RS9B 3NXBA 5F2PA 4XY8A 4PS5A 3MB3A 3S92A 1EQFA 3JVKA 1F68A 4HXMA 4XY9A 4NR7A 3O37A 5FB1A 5E9IA 5E7DA 5IIDA 5KTXA 4NR6A 4X2IA 4QEVA 3O33A 4BJXA 5II1A 5H1VA 3QZTA 4UITA 5E73A 4XYAA 5EVAA 4O77A 4TTEA 3P1EA 5C8GA 3UVXA 5DYXA 4UIWA 5E9MA 4ZW1A 4IR4A 5EV9A 2OUOA 4HBWA 5DYCA 4NR9A 4A9IA 4MEQA 4MENA 4O71A 2WP2A 5CPEA 5TCMA 4OGIA 5DLZA 5I89A 4PY6A 5DBMA 5JWMA 5CUGA 5EA1A 5DYUA 4UIUA 5A81A 5D7XA 5E9YA 5I80A 5CU8A 4TT6A 2RO1A 5ENJA 1E6IA 5E74A 4TU4A 4J0SA 5DW2A 2L85A 4MEPA 3LQIA 3UW9A 3U5NA 4Z1SA 5HLSA 4TQNA 4YBTA 2RFJA 4NQNA 4Z6IA 5FDZA 2E7NA 2YEKA 4YH4A 4YYMA 4O75A 3MB4A 4YABA 4ALHA 3DWYA 4QSVA 5D3JA 5DFCA 4QC3A 3O34A 4A9MA 5F36A 5E9VA 3I3JA 3SVFA 4O7CA 4BW4A 4NUCA 4TU6A 4QB3A 3SVHA 5EWHA 5LUUA 5FE3A 2H60A 4DONA 5HM0A 5DYAA 4HXLA 5DKCA 5FH7A 4FLPA 4O7AA 5EP7A 5AD3A 5EU1A 4QEWA 2E7OA 3U5PA 5DFDA 5IG6A 2DKWA 5A5QA 4IOQA 5BT5A 4O7BA 5CQAA 4HXNA 2DVVA 2YDWA 4QSTA 5FE0A 5HRXA 5E0RA 5CQ6A 5CQ4A 2L84A 4A9KA 2RNXA 2E3KA 5L98A 5FFWA 5L99A 4NUDA 3AADA 5D3HA 4YBMA 2MJVB 4N3WA 3IU6A 4BW1A 5BT3A 5COIA 5II2A 5EICA 3HMFA 5KHMA 4YYIA 5CS8A 3MULA 3QZSA 4NRBA 5FFVA 2L5EA 4QR4A 4QSWA 3Q2FA 4MR5A 4UYFA 3UV4A 5F61A 3AQAA 2WP1A 5D3PA 3U5MA 4UIZA 5ENIA 5EWDA 5C7NA 4YAXA 5IGMA 4Q0OA 4QSXA 5HQ6A 3IU5A 5FE2A 2OSSA 4UYHA 5E9KA 4NRAA 5HJCA 5CFWA 5D3RA 4YYNA 5IBNA 4NYVA 5ENHA 2YEMA 2LSPB 5E9LA 5LKZA 4J3IA 5KU3A 4TT4A 5I88A 4MR6A 1X0JA 5FE9A 5ENCA 5A85A 4N4IA 5L8UA 2R10A 5EI4A 3HMEA 4J0RA 4HBYA 5F1HA 5LVRA 5BT4A 4QEUA 4LYWA 5LKTA 3HMHA 4HXPA 5AMEA 2KTBB 2I8NA 5H1UA 5L96A 5ACYA 3TLPA 4NQMA 2RNYA 4QUUA 4Q0NA 2DVQA 3G0LA 5DLXA 5FG4A 4A9FA 4YATA 4NYXA 4NS5A 4QNSA 3JVMA 4MEOA 3UV5A 5ENGA 4LDFA 3D7CA 2D82A 3QZVA 4PCEA 2DVSA 4Y03A 4NYWA 5EISA 5F25A 4N4FA 4WHWA 4C66A 5HFQA 5CUCA 4CURA 5F3AA 5LJ0A 4XUAA 3JVJA 4NR8A 5ENEA 4IR6A 4O7EA 5HRVA 2F6JA 4QSSA 5FFYA 1ZS5A 4CUQA 4O74A 1WUGA 4HXRA 5DKDA 5I29A 5C87A 4IOOA 5CQ5A 2G4AA 4LYSA 5A5NA 4O72A 1N72A 4A9LA 4A9HA 4YY6A 5FE8A 5L8TA 5A5PA 5DY7A 5K29A 3LQJA 5CQ3A 4CUTA 4UIVA 5CTLA 5F60A 5ENFA 5HQ7A 5EM3A 2NXBA 4TS8A 4KCXA 4NXJA 4LRGA 4A9JA 5I1QA 5A82A 5L97A 5HCLA 4HXKA 3JVLA 4LR6A 4UIXA 2N9GA 2YELA 5HFRA 5DFBA 4A9OA 3LQHA 4O7FA 5A5OA 5IGKA 4OUFA 4BW3A 5HQ5A 4HXOA 5TB6A 4A9EA 4UYGA 5C89A 4PCIA 4CUPA 5FG5A 4O76A 4YY4A 5D25A 5CUEA 5HENA 1JSPB 5DX4A 3U5OA 3P1DA 3ONIA 4KV1A 5ETBA 5F5ZA 3MQMA 5IGLA 5F63A 5FBXA 5DW1A 2RNWA 5F1LA 3U5KA 5FH8A 5C4QA 4QSUA 4CUUA 4CUSA 3ZYUA 4YYGA 5D3LA 5AD2A 5E3DA 4MR3A 4LZ2A 4NRCA 4YYDA 4TZ8A 5KTWA 4QC1A 5AMFA 3SVGA 4LC2A 4TYLA 5CRMA 5CZGA 5A5SA 4YK0A 5D26A 4Z6HA 4TZ2A 5IGNA 5C85A 4CFLA 5E3GA 5J0DA 4YYHA 4YYKA 5FE7A 5ETDA 5DKHA 4HXSA 2DVRA 4F3IA 2YYNA 5LJ1A 4UIYA 5I83A 4TT2A 5I40A 4LZRA 4RVRA 5FE6A 5EWWA 5FB0A 4CFKA 5ENBA 4NR4A 2R0SA 5CUAA 3P1FA 4Z1QA 4ZQLA 3UVYA 4WHUA 3UVDA 4N4GA 5FH6A 5D3NA 4QBMA 4E96A 5CY9A 5D3SA 2GRCA 3K2JA 3LXJA 5LVQA 3MXFA 4QSPA 4UYEA 5CGPA 4QSRA 4YC9A 4IR5A 1WUMA 5I7XA 5FG6A 3Q2EA 4BHWA 5D0CA 5A83A 4O70A 4N4HA 4ALGA 2F6NA 4HBVA 2I7KA 4QYDA 5EGUA 5EPSA 5EWVA 4CLBA 5JI8A 4YADA
chains in the Genus database with same CATH superfamily
5HEMA 4KV4A 3UV2A 4AKGA 4NUEA 4XUBA 3LJWA 2FSAA 5EPRA 4LZSA 5D24A 5CQ8A 2R0YA 4IR3A 2RI7A 3S91A 5EWCA 3G0JA 4CL9A 5CQ7A 4O78A 4QUTA 4ZC9A 5LKXA 5H1TA 2OO1A 3GG3A 5FE1A 5D3TA 3UVWA 2DATA 5EPBA 4QZSA 4YBSA 2D9EA 3O35A 3MUKA 4HBXA 4A9NA 4YYJA 5CRZA 5KTUA 2R0VA 4AKNA 4QY4A 4IORA 3DAIA 5EK9A 5CP5A 5LJ2A 5CQTA 5G4SA 1JM4B 4J1PA 5H85A 2DWWA 4WIVA 5A7CA 3U5LA 5CUDA 4UYFB 4UYDA 4PKLA 2YW5A 4YH3A 4LYIA 5F62A 5CUBA 5HELA 4QYLA 2YQDA 4BW2A 4C67A 4Z93A 3U5JA 5FE4A 4NR5A 4PTBA 4QR5A 3RCWA 3FKMX 4QSQA 5A5RA 4MR4A 5LKUA 5EQ1A 3O36A 5HRWA 4OGJA 5G4RA 4GPJA 4QR3A 5KO4A 3P1CA 5I7YA 5FE5A 5I86A 3P5OA 2RS9B 3NXBA 3ERRA 5F2PA 4XY8A 4PS5A 3MB3A 3S92A 1EQFA 3JVKA 1F68A 4HXMA 4XY9A 4NR7A 3O37A 5FB1A 5E9IA 5E7DA 5IIDA 5KTXA 4NR6A 4X2IA 4QEVA 3O33A 4BJXA 5II1A 5H1VA 3QZTA 4UITA 5E73A 4XYAA 5EVAA 4O77A 4TTEA 3P1EA 5C8GA 3UVXA 5DYXA 4UIWA 5E9MA 4ZW1A 4IR4A 5EV9A 2OUOA 4HBWA 5DYCA 3VKGA 4NR9A 4A9IA 4MEQA 4MENA 4O71A 2WP2A 5CPEA 5TCMA 4OGIA 5DLZA 5I89A 4PY6A 5DBMA 5JWMA 5CUGA 5EA1A 5DYUA 4UIUA 5A81A 5D7XA 5E9YA 5I80A 5CU8A 4TT6A 2RO1A 5ENJA 1E6IA 5E74A 4AKHA 4TU4A 4J0SA 5DW2A 2L85A 3D1BA 4MEPA 3LQIA 3UW9A 3U5NA 4Z1SA 5HLSA 4TQNA 4YBTA 2RFJA 4NQNA 4Z6IA 5FDZA 2E7NA 2YEKA 4YH4A 4YYMA 4O75A 3MB4A 4YABA 4ALHA 3DWYA 4QSVA 5D3JA 5DFCA 4QC3A 3O34A 4A9MA 5F36A 5E9VA 3I3JA 3SVFA 4O7CA 4BW4A 4NUCA 4TU6A 4QB3A 3SVHA 4AKIA 5EWHA 5LUUA 5FE3A 2H60A 4DONA 5HM0A 5DYAA 4HXLA 5DKCA 5FH7A 4FLPA 4O7AA 5EP7A 5AD3A 5EU1A 4QEWA 2E7OA 3U5PA 5DFDA 5IG6A 2DKWA 5A5QA 4IOQA 5BT5A 4O7BA 5CQAA 4HXNA 2DVVA 2YDWA 4QSTA 5FE0A 5HRXA 5E0RA 5CQ6A 5CQ4A 2L84A 4A9KA 2RNXA 2E3KA 5L98A 5FFWA 5L99A 4NUDA 3AADA 5D3HA 4YBMA 2MJVB 4N3WA 3IU6A 4BW1A 5BT3A 5COIA 5II2A 5EICA 3HMFA 5KHMA 4YYIA 5CS8A 3MULA 3QZSA 4NRBA 5FFVA 2L5EA 4QR4A 4QSWA 3Q2FA 4MR5A 4UYFA 3UV4A 5F61A 3AQAA 2WP1A 5D3PA 3U5MA 4UIZA 5ENIA 5EWDA 5C7NA 4YAXA 5IGMA 4Q0OA 4QSXA 5HQ6A 3IU5A 5FE2A 2OSSA 4UYHA 5E9KA 4NRAA 5HJCA 5CFWA 5D3RA 4YYNA 5IBNA 4NYVA 5ENHA 2YEMA 2LSPB 5E9LA 5LKZA 2EJNA 4J3IA 5KU3A 1PUOA 4TT4A 5I88A 4MR6A 1X0JA 5FE9A 5ENCA 5A85A 4N4IA 5L8UA 2R10A 5EI4A 3HMEA 4J0RA 4HBYA 5F1HA 5LVRA 5BT4A 4QEUA 4LYWA 5LKTA 3HMHA 4HXPA 5AMEA 2KTBB 2I8NA 5H1UA 5L96A 5ACYA 3TLPA 4NQMA 2RNYA 4QUUA 4Q0NA 2DVQA 3G0LA 5DLXA 5FG4A 4A9FA 4YATA 4NYXA 4NS5A 3D1DA 4QNSA 3JVMA 4MEOA 3UV5A 5ENGA 4LDFA 3D7CA 2D82A 3QZVA 4PCEA 2DVSA 4Y03A 4NYWA 5EISA 5F25A 4N4FA 4WHWA 4C66A 5HFQA 5CUCA 4CURA 5F3AA 5LJ0A 4XUAA 3JVJA 4NR8A 5ENEA 4IR6A 4O7EA 5HRVA 2F6JA 4QSSA 5FFYA 1ZS5A 4CUQA 4O74A 1WUGA 4HXRA 5DKDA 5I29A 5C87A 4IOOA 5CQ5A 2G4AA 4LYSA 5A5NA 4O72A 1N72A 4A9LA 4A9HA 4YY6A 5FE8A 5L8TA 5A5PA 5DY7A 5K29A 3LQJA 5CQ3A 4CUTA 4UIVA 5CTLA 5F60A 5ENFA 5HQ7A 5EM3A 2NXBA 4TS8A 4KCXA 4NXJA 4LRGA 4A9JA 5I1QA 5A82A 5L97A 5HCLA 4HXKA 3JVLA 4LR6A 4UIXA 2N9GA 2YELA 5HFRA 5DFBA 4A9OA 3LQHA 4O7FA 5A5OA 5IGKA 4OUFA 4BW3A 5HQ5A 4HXOA 5TB6A 4A9EA 4UYGA 5C89A 4PCIA 4CUPA 5FG5A 4O76A 4YY4A 5D25A 5CUEA 5HENA 1JSPB 5DX4A 3U5OA 3P1DA 3ONIA 4KV1A 5ETBA 5F5ZA 3MQMA 5IGLA 5F63A 5FBXA 5DW1A 2RNWA 5F1LA 3U5KA 5FH8A 5C4QA 4QSUA 4CUUA 4CUSA 3ZYUA 4YYGA 5D3LA 5AD2A 5E3DA 4MR3A 4LZ2A 4NRCA 4YYDA 4TZ8A 5KTWA 4QC1A 5AMFA 3SVGA 4LC2A 4TYLA 5CRMA 5CZGA 5A5SA 4YK0A 5D26A 4Z6HA 4TZ2A 5IGNA 5C85A 4CFLA 5E3GA 5J0DA 4YYHA 4YYKA 5FE7A 3VKHA 5ETDA 5DKHA 4HXSA 2DVRA 4F3IA 2YYNA 5LJ1A 4UIYA 5I83A 4TT2A 5I40A 4LZRA 4RVRA 5FE6A 1ZKRA 5EWWA 5FB0A 4AI6A 4CFKA 5ENBA 4NR4A 2R0SA 5CUAA 3P1FA 4Z1QA 4ZQLA 3UVYA 4WHUA 3UVDA 4N4GA 5FH6A 5D3NA 4QBMA 4E96A 5CY9A 5D3SA 2GRCA 3K2JA 3LXJA 5LVQA 3MXFA 4QSPA 4UYEA 5CGPA 4QSRA 4YC9A 4IR5A 1WUMA 5I7XA 5FG6A 3Q2EA 4BHWA 5D0CA 5A83A 4O70A 4N4HA 4ALGA 2F6NA 4HBVA 2I7KA 4QYDA 5EGUA 5EPSA 5EWVA 4CLBA 5JI8A 4YADA
chains in the Genus database with same CATH topology
5HEMA 4KV4A 3UV2A 4NUEA 4XUBA 3LJWA 2FSAA 5EPRA 4LZSA 5D24A 5CQ8A 2R0YA 4IR3A 2RI7A 3S91A 5EWCA 3G0JA 4CL9A 5CQ7A 4O78A 4QUTA 4ZC9A 5LKXA 5H1TA 2OO1A 3GG3A 5FE1A 5D3TA 3UVWA 2DATA 5EPBA 4QZSA 4YBSA 2D9EA 3O35A 3MUKA 4HBXA 4A9NA 4YYJA 5CRZA 5KTUA 2R0VA 4AKNA 4QY4A 4IORA 3DAIA 5EK9A 5CP5A 5LJ2A 5CQTA 5G4SA 1JM4B 4J1PA 5H85A 2DWWA 4WIVA 5A7CA 3U5LA 5CUDA 4UYFB 4UYDA 4PKLA 2YW5A 4YH3A 4LYIA 5F62A 5CUBA 5HELA 4QYLA 2YQDA 4BW2A 4C67A 4Z93A 3U5JA 5FE4A 4NR5A 4PTBA 4QR5A 3RCWA 3FKMX 4QSQA 5A5RA 4MR4A 5LKUA 5EQ1A 3O36A 5HRWA 4OGJA 5G4RA 4GPJA 4QR3A 5KO4A 3P1CA 5I7YA 5FE5A 5I86A 3P5OA 2RS9B 3NXBA 5F2PA 4XY8A 4PS5A 3MB3A 3S92A 1EQFA 3JVKA 1F68A 4HXMA 4XY9A 4NR7A 3O37A 5FB1A 5E9IA 5E7DA 5IIDA 5KTXA 4NR6A 4X2IA 4QEVA 3O33A 4BJXA 5II1A 5H1VA 3QZTA 4UITA 5E73A 4XYAA 5EVAA 4O77A 4TTEA 3P1EA 5C8GA 3UVXA 5DYXA 4UIWA 5E9MA 4ZW1A 4IR4A 5EV9A 2OUOA 4HBWA 5DYCA 4NR9A 4A9IA 4MEQA 4MENA 4O71A 2WP2A 5CPEA 5TCMA 4OGIA 5DLZA 5I89A 4PY6A 5DBMA 5JWMA 5CUGA 5EA1A 5DYUA 4UIUA 5A81A 5D7XA 5E9YA 5I80A 5CU8A 4TT6A 2RO1A 5ENJA 1E6IA 5E74A 4TU4A 4J0SA 5DW2A 2L85A 4MEPA 3LQIA 3UW9A 3U5NA 4Z1SA 5HLSA 4TQNA 4YBTA 2RFJA 4NQNA 4Z6IA 5FDZA 2E7NA 2YEKA 4YH4A 4YYMA 4O75A 3MB4A 4YABA 4ALHA 3DWYA 4QSVA 5D3JA 5DFCA 4QC3A 3O34A 4A9MA 5F36A 5E9VA 3I3JA 3SVFA 4O7CA 4BW4A 4NUCA 4TU6A 4QB3A 3SVHA 5EWHA 5LUUA 5FE3A 2H60A 4DONA 5HM0A 5DYAA 4HXLA 5DKCA 5FH7A 4FLPA 4O7AA 5EP7A 5AD3A 5EU1A 4QEWA 2E7OA 3U5PA 5DFDA 5IG6A 2DKWA 5A5QA 4IOQA 5BT5A 4O7BA 5CQAA 4HXNA 2DVVA 2YDWA 4QSTA 5FE0A 5HRXA 5E0RA 5CQ6A 5CQ4A 2L84A 4A9KA 2RNXA 2E3KA 5L98A 5FFWA 5L99A 4NUDA 3AADA 5D3HA 4YBMA 2MJVB 4N3WA 3IU6A 4BW1A 5BT3A 5COIA 5II2A 5EICA 3HMFA 5KHMA 4YYIA 5CS8A 3MULA 3QZSA 4NRBA 5FFVA 2L5EA 4QR4A 4QSWA 3Q2FA 4MR5A 4UYFA 3UV4A 5F61A 3AQAA 2WP1A 5D3PA 3U5MA 4UIZA 5ENIA 5EWDA 5C7NA 4YAXA 5IGMA 4Q0OA 4QSXA 5HQ6A 3IU5A 5FE2A 2OSSA 4UYHA 5E9KA 4NRAA 5HJCA 5CFWA 5D3RA 4YYNA 5IBNA 4NYVA 5ENHA 2YEMA 2LSPB 5E9LA 5LKZA 4J3IA 5KU3A 4TT4A 5I88A 4MR6A 1X0JA 5FE9A 5ENCA 5A85A 4N4IA 5L8UA 2R10A 5EI4A 3HMEA 4J0RA 4HBYA 5F1HA 5LVRA 5BT4A 4QEUA 4LYWA 5LKTA 3HMHA 4HXPA 5AMEA 2KTBB 2I8NA 5H1UA 5L96A 5ACYA 3TLPA 4NQMA 2RNYA 4QUUA 4Q0NA 2DVQA 3G0LA 5DLXA 5FG4A 4A9FA 4YATA 4NYXA 4NS5A 4QNSA 3JVMA 4MEOA 3UV5A 5ENGA 4LDFA 3D7CA 2D82A 3QZVA 4PCEA 2DVSA 4Y03A 4NYWA 5EISA 5F25A 4N4FA 4WHWA 4C66A 5HFQA 5CUCA 4CURA 5F3AA 5LJ0A 4XUAA 3JVJA 4NR8A 5ENEA 4IR6A 4O7EA 5HRVA 2F6JA 4QSSA 5FFYA 1ZS5A 4CUQA 4O74A 1WUGA 4HXRA 5DKDA 5I29A 5C87A 4IOOA 5CQ5A 2G4AA 4LYSA 5A5NA 4O72A 1N72A 4A9LA 4A9HA 4YY6A 5FE8A 5L8TA 5A5PA 5DY7A 5K29A 3LQJA 5CQ3A 4CUTA 4UIVA 5CTLA 5F60A 5ENFA 5HQ7A 5EM3A 2NXBA 4TS8A 4KCXA 4NXJA 4LRGA 4A9JA 5I1QA 5A82A 5L97A 5HCLA 4HXKA 3JVLA 4LR6A 4UIXA 2N9GA 2YELA 5HFRA 5DFBA 4A9OA 3LQHA 4O7FA 5A5OA 5IGKA 4OUFA 4BW3A 5HQ5A 4HXOA 5TB6A 4A9EA 4UYGA 5C89A 4PCIA 4CUPA 5FG5A 4O76A 4YY4A 5D25A 5CUEA 5HENA 1JSPB 5DX4A 3U5OA 3P1DA 3ONIA 4KV1A 5ETBA 5F5ZA 3MQMA 5IGLA 5F63A 5FBXA 5DW1A 2RNWA 5F1LA 3U5KA 5FH8A 5C4QA 4QSUA 4CUUA 4CUSA 3ZYUA 4YYGA 5D3LA 5AD2A 5E3DA 4MR3A 4LZ2A 4NRCA 4YYDA 4TZ8A 5KTWA 4QC1A 5AMFA 3SVGA 4LC2A 4TYLA 5CRMA 5CZGA 5A5SA 4YK0A 5D26A 4Z6HA 4TZ2A 5IGNA 5C85A 4CFLA 5E3GA 5J0DA 4YYHA 4YYKA 5FE7A 5ETDA 5DKHA 4HXSA 2DVRA 4F3IA 2YYNA 5LJ1A 4UIYA 5I83A 4TT2A 5I40A 4LZRA 4RVRA 5FE6A 5EWWA 5FB0A 4CFKA 5ENBA 4NR4A 2R0SA 5CUAA 3P1FA 4Z1QA 4ZQLA 3UVYA 4WHUA 3UVDA 4N4GA 5FH6A 5D3NA 4QBMA 4E96A 5CY9A 5D3SA 2GRCA 3K2JA 3LXJA 5LVQA 3MXFA 4QSPA 4UYEA 5CGPA 4QSRA 4YC9A 4IR5A 1WUMA 5I7XA 5FG6A 3Q2EA 4BHWA 5D0CA 5A83A 4O70A 4N4HA 4ALGA 2F6NA 4HBVA 2I7KA 4QYDA 5EGUA 5EPSA 5EWVA 4CLBA 5JI8A 4YADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEM A;  4KV4 A;  3UV2 A;  4NUE A;  4XUB A;  3LJW A;  2FSA A;  5EPR A;  4LZS A;  5D24 A;  5CQ8 A;  2R0Y A;  4IR3 A;  2RI7 A;  3S91 A;  5EWC A;  3G0J A;  4CL9 A;  5CQ7 A;  4O78 A;  4QUT A;  4ZC9 A;  5LKX A;  5H1T A;  2OO1 A;  3GG3 A;  5FE1 A;  5D3T A;  3UVW A;  2DAT A;  5EPB A;  4QZS A;  4YBS A;  2D9E A;  3O35 A;  3MUK A;  4HBX A;  4A9N A;  4YYJ A;  5CRZ A;  5KTU A;  2R0V A;  4AKN A;  4QY4 A;  4IOR A;  3DAI A;  5EK9 A;  5CP5 A;  5LJ2 A;  5CQT A;  5G4S A;  1JM4 B;  4J1P A;  5H85 A;  2DWW A;  4WIV A;  5A7C A;  3U5L A;  5CUD A;  4UYF B;  4UYD A;  4PKL A;  2YW5 A;  4YH3 A;  4LYI A;  5F62 A;  5CUB A;  5HEL A;  4QYL A;  2YQD A;  4BW2 A;  4C67 A;  4Z93 A;  3U5J A;  5FE4 A;  4NR5 A;  4PTB A;  4QR5 A;  3RCW A;  3FKM X;  4QSQ A;  5A5R A;  4MR4 A;  5LKU A;  5EQ1 A;  3O36 A;  5HRW A;  4OGJ A;  5G4R A;  4GPJ A;  4QR3 A;  5KO4 A;  3P1C A;  5I7Y A;  5FE5 A;  5I86 A;  3P5O A;  2RS9 B;  3NXB A;  5F2P A;  4XY8 A;  4PS5 A;  3MB3 A;  3S92 A;  1EQF A;  3JVK A;  1F68 A;  4HXM A;  4XY9 A;  4NR7 A;  3O37 A;  5FB1 A;  5E9I A;  5E7D A;  5IID A;  5KTX A;  4NR6 A;  4X2I A;  4QEV A;  3O33 A;  4BJX A;  5II1 A;  5H1V A;  3QZT A;  4UIT A;  5E73 A;  4XYA A;  5EVA A;  4O77 A;  4TTE A;  3P1E A;  5C8G A;  3UVX A;  5DYX A;  4UIW A;  5E9M A;  4ZW1 A;  4IR4 A;  5EV9 A;  2OUO A;  4HBW A;  5DYC A;  4NR9 A;  4A9I A;  4MEQ A;  4MEN A;  4O71 A;  2WP2 A;  5CPE A;  5TCM A;  4OGI A;  5DLZ A;  5I89 A;  4PY6 A;  5DBM A;  5JWM A;  5CUG A;  5EA1 A;  5DYU A;  4UIU A;  5A81 A;  5D7X A;  5E9Y A;  5I80 A;  5CU8 A;  4TT6 A;  2RO1 A;  5ENJ A;  1E6I A;  5E74 A;  4TU4 A;  4J0S A;  5DW2 A;  2L85 A;  4MEP A;  3LQI A;  3UW9 A;  3U5N A;  4Z1S A;  5HLS A;  4TQN A;  4YBT A;  2RFJ A;  4NQN A;  4Z6I A;  5FDZ A;  2E7N A;  2YEK A;  4YH4 A;  4YYM A;  4O75 A;  3MB4 A;  4YAB A;  4ALH A;  3DWY A;  4QSV A;  5D3J A;  5DFC A;  4QC3 A;  3O34 A;  4A9M A;  5F36 A;  5E9V A;  3I3J A;  3SVF A;  4O7C A;  4BW4 A;  4NUC A;  4TU6 A;  4QB3 A;  3SVH A;  5EWH A;  5LUU A;  5FE3 A;  2H60 A;  4DON A;  5HM0 A;  5DYA A;  4HXL A;  5DKC A;  5FH7 A;  4FLP A;  4O7A A;  5EP7 A;  5AD3 A;  5EU1 A;  4QEW A;  2E7O A;  3U5P A;  5DFD A;  5IG6 A;  2DKW A;  5A5Q A;  4IOQ A;  5BT5 A;  4O7B A;  5CQA A;  4HXN A;  2DVV A;  2YDW A;  4QST A;  5FE0 A;  5HRX A;  5E0R A;  5CQ6 A;  5CQ4 A;  2L84 A;  4A9K A;  2RNX A;  2E3K A;  5L98 A;  5FFW A;  5L99 A;  4NUD A;  3AAD A;  5D3H A;  4YBM A;  2MJV B;  4N3W A;  3IU6 A;  4BW1 A;  5BT3 A;  5COI A;  5II2 A;  5EIC A;  3HMF A;  5KHM A;  4YYI A;  5CS8 A;  3MUL A;  3QZS A;  4NRB A;  5FFV A;  2L5E A;  4QR4 A;  4QSW A;  3Q2F A;  4MR5 A;  4UYF A;  3UV4 A;  5F61 A;  3AQA A;  2WP1 A;  5D3P A;  3U5M A;  4UIZ A;  5ENI A;  5EWD A;  5C7N A;  4YAX A;  5IGM A;  4Q0O A;  4QSX A;  5HQ6 A;  3IU5 A;  5FE2 A;  2OSS A;  4UYH A;  5E9K A;  4NRA A;  5HJC A;  5CFW A;  5D3R A;  4YYN A;  5IBN A;  4NYV A;  5ENH A;  2YEM A;  2LSP B;  5E9L A;  5LKZ A;  4J3I A;  5KU3 A;  4TT4 A;  5I88 A;  4MR6 A;  1X0J A;  5FE9 A;  5ENC A;  5A85 A;  4N4I A;  5L8U A;  2R10 A;  5EI4 A;  3HME A;  4J0R A;  4HBY A;  5F1H A;  5LVR A;  5BT4 A;  4QEU A;  4LYW A;  5LKT A;  3HMH A;  4HXP A;  5AME A;  2KTB B;  2I8N A;  5H1U A;  5L96 A;  5ACY A;  3TLP A;  4NQM A;  2RNY A;  4QUU A;  4Q0N A;  2DVQ A;  3G0L A;  5DLX A;  5FG4 A;  4A9F A;  4YAT A;  4NYX A;  4NS5 A;  4QNS A;  3JVM A;  4MEO A;  3UV5 A;  5ENG A;  4LDF A;  3D7C A;  2D82 A;  3QZV A;  4PCE A;  2DVS A;  4Y03 A;  4NYW A;  5EIS A;  5F25 A;  4N4F A;  4WHW A;  4C66 A;  5HFQ A;  5CUC A;  4CUR A;  5F3A A;  5LJ0 A;  4XUA A;  3JVJ A;  4NR8 A;  5ENE A;  4IR6 A;  4O7E A;  5HRV A;  2F6J A;  4QSS A;  5FFY A;  1ZS5 A;  4CUQ A;  4O74 A;  1WUG A;  4HXR A;  5DKD A;  5I29 A;  5C87 A;  4IOO A;  5CQ5 A;  2G4A A;  4LYS A;  5A5N A;  4O72 A;  1N72 A;  4A9L A;  4A9H A;  4YY6 A;  5FE8 A;  5L8T A;  5A5P A;  5DY7 A;  5K29 A;  3LQJ A;  5CQ3 A;  4CUT A;  4UIV A;  5CTL A;  5F60 A;  5ENF A;  5HQ7 A;  5EM3 A;  2NXB A;  4TS8 A;  4KCX A;  4NXJ A;  4LRG A;  4A9J A;  5I1Q A;  5A82 A;  5L97 A;  5HCL A;  4HXK A;  3JVL A;  4LR6 A;  4UIX A;  2N9G A;  2YEL A;  5HFR A;  5DFB A;  4A9O A;  3LQH A;  4O7F A;  5A5O A;  5IGK A;  4OUF A;  4BW3 A;  5HQ5 A;  4HXO A;  5TB6 A;  4A9E A;  4UYG A;  5C89 A;  4PCI A;  4CUP A;  5FG5 A;  4O76 A;  4YY4 A;  5D25 A;  5CUE A;  5HEN A;  1JSP B;  5DX4 A;  3U5O A;  3P1D A;  3ONI A;  4KV1 A;  5ETB A;  5F5Z A;  3MQM A;  5IGL A;  5F63 A;  5FBX A;  5DW1 A;  2RNW A;  5F1L A;  3U5K A;  5FH8 A;  5C4Q A;  4QSU A;  4CUU A;  4CUS A;  3ZYU A;  4YYG A;  5D3L A;  5AD2 A;  5E3D A;  4MR3 A;  4LZ2 A;  4NRC A;  4YYD A;  4TZ8 A;  5KTW A;  4QC1 A;  5AMF A;  3SVG A;  4LC2 A;  4TYL A;  5CRM A;  5CZG A;  5A5S A;  4YK0 A;  5D26 A;  4Z6H A;  4TZ2 A;  5IGN A;  5C85 A;  4CFL A;  5E3G A;  5J0D A;  4YYH A;  4YYK A;  5FE7 A;  5ETD A;  5DKH A;  4HXS A;  2DVR A;  4F3I A;  2YYN A;  5LJ1 A;  4UIY A;  5I83 A;  4TT2 A;  5I40 A;  4LZR A;  4RVR A;  5FE6 A;  5EWW A;  5FB0 A;  4CFK A;  5ENB A;  4NR4 A;  2R0S A;  5CUA A;  3P1F A;  4Z1Q A;  4ZQL A;  3UVY A;  4WHU A;  3UVD A;  4N4G A;  5FH6 A;  5D3N A;  4QBM A;  4E96 A;  5CY9 A;  5D3S A;  2GRC A;  3K2J A;  3LXJ A;  5LVQ A;  3MXF A;  4QSP A;  4UYE A;  5CGP A;  4QSR A;  4YC9 A;  4IR5 A;  1WUM A;  5I7X A;  5FG6 A;  3Q2E A;  4BHW A;  5D0C A;  5A83 A;  4O70 A;  4N4H A;  4ALG A;  2F6N A;  4HBV A;  2I7K A;  4QYD A;  5EGU A;  5EPS A;  5EWV A;  4CLB A;  5JI8 A;  4YAD A; 
#chains in the Genus database with same CATH topology
 5HEM A;  4KV4 A;  3UV2 A;  4AKG A;  4NUE A;  4XUB A;  3LJW A;  2FSA A;  5EPR A;  4LZS A;  5D24 A;  5CQ8 A;  2R0Y A;  4IR3 A;  2RI7 A;  3S91 A;  5EWC A;  3G0J A;  4CL9 A;  5CQ7 A;  4O78 A;  4QUT A;  4ZC9 A;  5LKX A;  5H1T A;  2OO1 A;  3GG3 A;  5FE1 A;  5D3T A;  3UVW A;  2DAT A;  5EPB A;  4QZS A;  4YBS A;  2D9E A;  3O35 A;  3MUK A;  4HBX A;  4A9N A;  4YYJ A;  5CRZ A;  5KTU A;  2R0V A;  4AKN A;  4QY4 A;  4IOR A;  3DAI A;  5EK9 A;  5CP5 A;  5LJ2 A;  5CQT A;  5G4S A;  1JM4 B;  4J1P A;  5H85 A;  2DWW A;  4WIV A;  5A7C A;  3U5L A;  5CUD A;  4UYF B;  4UYD A;  4PKL A;  2YW5 A;  4YH3 A;  4LYI A;  5F62 A;  5CUB A;  5HEL A;  4QYL A;  2YQD A;  4BW2 A;  4C67 A;  4Z93 A;  3U5J A;  5FE4 A;  4NR5 A;  4PTB A;  4QR5 A;  3RCW A;  3FKM X;  4QSQ A;  5A5R A;  4MR4 A;  5LKU A;  5EQ1 A;  3O36 A;  5HRW A;  4OGJ A;  5G4R A;  4GPJ A;  4QR3 A;  5KO4 A;  3P1C A;  5I7Y A;  5FE5 A;  5I86 A;  3P5O A;  2RS9 B;  3NXB A;  3ERR A;  5F2P A;  4XY8 A;  4PS5 A;  3MB3 A;  3S92 A;  1EQF A;  3JVK A;  1F68 A;  4HXM A;  4XY9 A;  4NR7 A;  3O37 A;  5FB1 A;  5E9I A;  5E7D A;  5IID A;  5KTX A;  4NR6 A;  4X2I A;  4QEV A;  3O33 A;  4BJX A;  5II1 A;  5H1V A;  3QZT A;  4UIT A;  5E73 A;  4XYA A;  5EVA A;  4O77 A;  4TTE A;  3P1E A;  5C8G A;  3UVX A;  5DYX A;  4UIW A;  5E9M A;  4ZW1 A;  4IR4 A;  5EV9 A;  2OUO A;  4HBW A;  5DYC A;  3VKG A;  4NR9 A;  4A9I A;  4MEQ A;  4MEN A;  4O71 A;  2WP2 A;  5CPE A;  5TCM A;  4OGI A;  5DLZ A;  5I89 A;  4PY6 A;  5DBM A;  5JWM A;  5CUG A;  5EA1 A;  5DYU A;  4UIU A;  5A81 A;  5D7X A;  5E9Y A;  5I80 A;  5CU8 A;  4TT6 A;  2RO1 A;  5ENJ A;  1E6I A;  5E74 A;  4AKH A;  4TU4 A;  4J0S A;  5DW2 A;  2L85 A;  3D1B A;  4MEP A;  3LQI A;  3UW9 A;  3U5N A;  4Z1S A;  5HLS A;  4TQN A;  4YBT A;  2RFJ A;  4NQN A;  4Z6I A;  5FDZ A;  2E7N A;  2YEK A;  4YH4 A;  4YYM A;  4O75 A;  3MB4 A;  4YAB A;  4ALH A;  3DWY A;  4QSV A;  5D3J A;  5DFC A;  4QC3 A;  3O34 A;  4A9M A;  5F36 A;  5E9V A;  3I3J A;  3SVF A;  4O7C A;  4BW4 A;  4NUC A;  4TU6 A;  4QB3 A;  3SVH A;  4AKI A;  5EWH A;  5LUU A;  5FE3 A;  2H60 A;  4DON A;  5HM0 A;  5DYA A;  4HXL A;  5DKC A;  5FH7 A;  4FLP A;  4O7A A;  5EP7 A;  5AD3 A;  5EU1 A;  4QEW A;  2E7O A;  3U5P A;  5DFD A;  5IG6 A;  2DKW A;  5A5Q A;  4IOQ A;  5BT5 A;  4O7B A;  5CQA A;  4HXN A;  2DVV A;  2YDW A;  4QST A;  5FE0 A;  5HRX A;  5E0R A;  5CQ6 A;  5CQ4 A;  2L84 A;  4A9K A;  2RNX A;  2E3K A;  5L98 A;  5FFW A;  5L99 A;  4NUD A;  3AAD A;  5D3H A;  4YBM A;  2MJV B;  4N3W A;  3IU6 A;  4BW1 A;  5BT3 A;  5COI A;  5II2 A;  5EIC A;  3HMF A;  5KHM A;  4YYI A;  5CS8 A;  3MUL A;  3QZS A;  4NRB A;  5FFV A;  2L5E A;  4QR4 A;  4QSW A;  3Q2F A;  4MR5 A;  4UYF A;  3UV4 A;  5F61 A;  3AQA A;  2WP1 A;  5D3P A;  3U5M A;  4UIZ A;  5ENI A;  5EWD A;  5C7N A;  4YAX A;  5IGM A;  4Q0O A;  4QSX A;  5HQ6 A;  3IU5 A;  5FE2 A;  2OSS A;  4UYH A;  5E9K A;  4NRA A;  5HJC A;  5CFW A;  5D3R A;  4YYN A;  5IBN A;  4NYV A;  5ENH A;  2YEM A;  2LSP B;  5E9L A;  5LKZ A;  2EJN A;  4J3I A;  5KU3 A;  1PUO A;  4TT4 A;  5I88 A;  4MR6 A;  1X0J A;  5FE9 A;  5ENC A;  5A85 A;  4N4I A;  5L8U A;  2R10 A;  5EI4 A;  3HME A;  4J0R A;  4HBY A;  5F1H A;  5LVR A;  5BT4 A;  4QEU A;  4LYW A;  5LKT A;  3HMH A;  4HXP A;  5AME A;  2KTB B;  2I8N A;  5H1U A;  5L96 A;  5ACY A;  3TLP A;  4NQM A;  2RNY A;  4QUU A;  4Q0N A;  2DVQ A;  3G0L A;  5DLX A;  5FG4 A;  4A9F A;  4YAT A;  4NYX A;  4NS5 A;  3D1D A;  4QNS A;  3JVM A;  4MEO A;  3UV5 A;  5ENG A;  4LDF A;  3D7C A;  2D82 A;  3QZV A;  4PCE A;  2DVS A;  4Y03 A;  4NYW A;  5EIS A;  5F25 A;  4N4F A;  4WHW A;  4C66 A;  5HFQ A;  5CUC A;  4CUR A;  5F3A A;  5LJ0 A;  4XUA A;  3JVJ A;  4NR8 A;  5ENE A;  4IR6 A;  4O7E A;  5HRV A;  2F6J A;  4QSS A;  5FFY A;  1ZS5 A;  4CUQ A;  4O74 A;  1WUG A;  4HXR A;  5DKD A;  5I29 A;  5C87 A;  4IOO A;  5CQ5 A;  2G4A A;  4LYS A;  5A5N A;  4O72 A;  1N72 A;  4A9L A;  4A9H A;  4YY6 A;  5FE8 A;  5L8T A;  5A5P A;  5DY7 A;  5K29 A;  3LQJ A;  5CQ3 A;  4CUT A;  4UIV A;  5CTL A;  5F60 A;  5ENF A;  5HQ7 A;  5EM3 A;  2NXB A;  4TS8 A;  4KCX A;  4NXJ A;  4LRG A;  4A9J A;  5I1Q A;  5A82 A;  5L97 A;  5HCL A;  4HXK A;  3JVL A;  4LR6 A;  4UIX A;  2N9G A;  2YEL A;  5HFR A;  5DFB A;  4A9O A;  3LQH A;  4O7F A;  5A5O A;  5IGK A;  4OUF A;  4BW3 A;  5HQ5 A;  4HXO A;  5TB6 A;  4A9E A;  4UYG A;  5C89 A;  4PCI A;  4CUP A;  5FG5 A;  4O76 A;  4YY4 A;  5D25 A;  5CUE A;  5HEN A;  1JSP B;  5DX4 A;  3U5O A;  3P1D A;  3ONI A;  4KV1 A;  5ETB A;  5F5Z A;  3MQM A;  5IGL A;  5F63 A;  5FBX A;  5DW1 A;  2RNW A;  5F1L A;  3U5K A;  5FH8 A;  5C4Q A;  4QSU A;  4CUU A;  4CUS A;  3ZYU A;  4YYG A;  5D3L A;  5AD2 A;  5E3D A;  4MR3 A;  4LZ2 A;  4NRC A;  4YYD A;  4TZ8 A;  5KTW A;  4QC1 A;  5AMF A;  3SVG A;  4LC2 A;  4TYL A;  5CRM A;  5CZG A;  5A5S A;  4YK0 A;  5D26 A;  4Z6H A;  4TZ2 A;  5IGN A;  5C85 A;  4CFL A;  5E3G A;  5J0D A;  4YYH A;  4YYK A;  5FE7 A;  3VKH A;  5ETD A;  5DKH A;  4HXS A;  2DVR A;  4F3I A;  2YYN A;  5LJ1 A;  4UIY A;  5I83 A;  4TT2 A;  5I40 A;  4LZR A;  4RVR A;  5FE6 A;  1ZKR A;  5EWW A;  5FB0 A;  4AI6 A;  4CFK A;  5ENB A;  4NR4 A;  2R0S A;  5CUA A;  3P1F A;  4Z1Q A;  4ZQL A;  3UVY A;  4WHU A;  3UVD A;  4N4G A;  5FH6 A;  5D3N A;  4QBM A;  4E96 A;  5CY9 A;  5D3S A;  2GRC A;  3K2J A;  3LXJ A;  5LVQ A;  3MXF A;  4QSP A;  4UYE A;  5CGP A;  4QSR A;  4YC9 A;  4IR5 A;  1WUM A;  5I7X A;  5FG6 A;  3Q2E A;  4BHW A;  5D0C A;  5A83 A;  4O70 A;  4N4H A;  4ALG A;  2F6N A;  4HBV A;  2I7K A;  4QYD A;  5EGU A;  5EPS A;  5EWV A;  4CLB A;  5JI8 A;  4YAD A; 
#chains in the Genus database with same CATH homology
 5HEM A;  4KV4 A;  3UV2 A;  4NUE A;  4XUB A;  3LJW A;  2FSA A;  5EPR A;  4LZS A;  5D24 A;  5CQ8 A;  2R0Y A;  4IR3 A;  2RI7 A;  3S91 A;  5EWC A;  3G0J A;  4CL9 A;  5CQ7 A;  4O78 A;  4QUT A;  4ZC9 A;  5LKX A;  5H1T A;  2OO1 A;  3GG3 A;  5FE1 A;  5D3T A;  3UVW A;  2DAT A;  5EPB A;  4QZS A;  4YBS A;  2D9E A;  3O35 A;  3MUK A;  4HBX A;  4A9N A;  4YYJ A;  5CRZ A;  5KTU A;  2R0V A;  4AKN A;  4QY4 A;  4IOR A;  3DAI A;  5EK9 A;  5CP5 A;  5LJ2 A;  5CQT A;  5G4S A;  1JM4 B;  4J1P A;  5H85 A;  2DWW A;  4WIV A;  5A7C A;  3U5L A;  5CUD A;  4UYF B;  4UYD A;  4PKL A;  2YW5 A;  4YH3 A;  4LYI A;  5F62 A;  5CUB A;  5HEL A;  4QYL A;  2YQD A;  4BW2 A;  4C67 A;  4Z93 A;  3U5J A;  5FE4 A;  4NR5 A;  4PTB A;  4QR5 A;  3RCW A;  3FKM X;  4QSQ A;  5A5R A;  4MR4 A;  5LKU A;  5EQ1 A;  3O36 A;  5HRW A;  4OGJ A;  5G4R A;  4GPJ A;  4QR3 A;  5KO4 A;  3P1C A;  5I7Y A;  5FE5 A;  5I86 A;  3P5O A;  2RS9 B;  3NXB A;  5F2P A;  4XY8 A;  4PS5 A;  3MB3 A;  3S92 A;  1EQF A;  3JVK A;  1F68 A;  4HXM A;  4XY9 A;  4NR7 A;  3O37 A;  5FB1 A;  5E9I A;  5E7D A;  5IID A;  5KTX A;  4NR6 A;  4X2I A;  4QEV A;  3O33 A;  4BJX A;  5II1 A;  5H1V A;  3QZT A;  4UIT A;  5E73 A;  4XYA A;  5EVA A;  4O77 A;  4TTE A;  3P1E A;  5C8G A;  3UVX A;  5DYX A;  4UIW A;  5E9M A;  4ZW1 A;  4IR4 A;  5EV9 A;  2OUO A;  4HBW A;  5DYC A;  4NR9 A;  4A9I A;  4MEQ A;  4MEN A;  4O71 A;  2WP2 A;  5CPE A;  5TCM A;  4OGI A;  5DLZ A;  5I89 A;  4PY6 A;  5DBM A;  5JWM A;  5CUG A;  5EA1 A;  5DYU A;  4UIU A;  5A81 A;  5D7X A;  5E9Y A;  5I80 A;  5CU8 A;  4TT6 A;  2RO1 A;  5ENJ A;  1E6I A;  5E74 A;  4TU4 A;  4J0S A;  5DW2 A;  2L85 A;  4MEP A;  3LQI A;  3UW9 A;  3U5N A;  4Z1S A;  5HLS A;  4TQN A;  4YBT A;  2RFJ A;  4NQN A;  4Z6I A;  5FDZ A;  2E7N A;  2YEK A;  4YH4 A;  4YYM A;  4O75 A;  3MB4 A;  4YAB A;  4ALH A;  3DWY A;  4QSV A;  5D3J A;  5DFC A;  4QC3 A;  3O34 A;  4A9M A;  5F36 A;  5E9V A;  3I3J A;  3SVF A;  4O7C A;  4BW4 A;  4NUC A;  4TU6 A;  4QB3 A;  3SVH A;  5EWH A;  5LUU A;  5FE3 A;  2H60 A;  4DON A;  5HM0 A;  5DYA A;  4HXL A;  5DKC A;  5FH7 A;  4FLP A;  4O7A A;  5EP7 A;  5AD3 A;  5EU1 A;  4QEW A;  2E7O A;  3U5P A;  5DFD A;  5IG6 A;  2DKW A;  5A5Q A;  4IOQ A;  5BT5 A;  4O7B A;  5CQA A;  4HXN A;  2DVV A;  2YDW A;  4QST A;  5FE0 A;  5HRX A;  5E0R A;  5CQ6 A;  5CQ4 A;  2L84 A;  4A9K A;  2RNX A;  2E3K A;  5L98 A;  5FFW A;  5L99 A;  4NUD A;  3AAD A;  5D3H A;  4YBM A;  2MJV B;  4N3W A;  3IU6 A;  4BW1 A;  5BT3 A;  5COI A;  5II2 A;  5EIC A;  3HMF A;  5KHM A;  4YYI A;  5CS8 A;  3MUL A;  3QZS A;  4NRB A;  5FFV A;  2L5E A;  4QR4 A;  4QSW A;  3Q2F A;  4MR5 A;  4UYF A;  3UV4 A;  5F61 A;  3AQA A;  2WP1 A;  5D3P A;  3U5M A;  4UIZ A;  5ENI A;  5EWD A;  5C7N A;  4YAX A;  5IGM A;  4Q0O A;  4QSX A;  5HQ6 A;  3IU5 A;  5FE2 A;  2OSS A;  4UYH A;  5E9K A;  4NRA A;  5HJC A;  5CFW A;  5D3R A;  4YYN A;  5IBN A;  4NYV A;  5ENH A;  2YEM A;  2LSP B;  5E9L A;  5LKZ A;  4J3I A;  5KU3 A;  4TT4 A;  5I88 A;  4MR6 A;  1X0J A;  5FE9 A;  5ENC A;  5A85 A;  4N4I A;  5L8U A;  2R10 A;  5EI4 A;  3HME A;  4J0R A;  4HBY A;  5F1H A;  5LVR A;  5BT4 A;  4QEU A;  4LYW A;  5LKT A;  3HMH A;  4HXP A;  5AME A;  2KTB B;  2I8N A;  5H1U A;  5L96 A;  5ACY A;  3TLP A;  4NQM A;  2RNY A;  4QUU A;  4Q0N A;  2DVQ A;  3G0L A;  5DLX A;  5FG4 A;  4A9F A;  4YAT A;  4NYX A;  4NS5 A;  4QNS A;  3JVM A;  4MEO A;  3UV5 A;  5ENG A;  4LDF A;  3D7C A;  2D82 A;  3QZV A;  4PCE A;  2DVS A;  4Y03 A;  4NYW A;  5EIS A;  5F25 A;  4N4F A;  4WHW A;  4C66 A;  5HFQ A;  5CUC A;  4CUR A;  5F3A A;  5LJ0 A;  4XUA A;  3JVJ A;  4NR8 A;  5ENE A;  4IR6 A;  4O7E A;  5HRV A;  2F6J A;  4QSS A;  5FFY A;  1ZS5 A;  4CUQ A;  4O74 A;  1WUG A;  4HXR A;  5DKD A;  5I29 A;  5C87 A;  4IOO A;  5CQ5 A;  2G4A A;  4LYS A;  5A5N A;  4O72 A;  1N72 A;  4A9L A;  4A9H A;  4YY6 A;  5FE8 A;  5L8T A;  5A5P A;  5DY7 A;  5K29 A;  3LQJ A;  5CQ3 A;  4CUT A;  4UIV A;  5CTL A;  5F60 A;  5ENF A;  5HQ7 A;  5EM3 A;  2NXB A;  4TS8 A;  4KCX A;  4NXJ A;  4LRG A;  4A9J A;  5I1Q A;  5A82 A;  5L97 A;  5HCL A;  4HXK A;  3JVL A;  4LR6 A;  4UIX A;  2N9G A;  2YEL A;  5HFR A;  5DFB A;  4A9O A;  3LQH A;  4O7F A;  5A5O A;  5IGK A;  4OUF A;  4BW3 A;  5HQ5 A;  4HXO A;  5TB6 A;  4A9E A;  4UYG A;  5C89 A;  4PCI A;  4CUP A;  5FG5 A;  4O76 A;  4YY4 A;  5D25 A;  5CUE A;  5HEN A;  1JSP B;  5DX4 A;  3U5O A;  3P1D A;  3ONI A;  4KV1 A;  5ETB A;  5F5Z A;  3MQM A;  5IGL A;  5F63 A;  5FBX A;  5DW1 A;  2RNW A;  5F1L A;  3U5K A;  5FH8 A;  5C4Q A;  4QSU A;  4CUU A;  4CUS A;  3ZYU A;  4YYG A;  5D3L A;  5AD2 A;  5E3D A;  4MR3 A;  4LZ2 A;  4NRC A;  4YYD A;  4TZ8 A;  5KTW A;  4QC1 A;  5AMF A;  3SVG A;  4LC2 A;  4TYL A;  5CRM A;  5CZG A;  5A5S A;  4YK0 A;  5D26 A;  4Z6H A;  4TZ2 A;  5IGN A;  5C85 A;  4CFL A;  5E3G A;  5J0D A;  4YYH A;  4YYK A;  5FE7 A;  5ETD A;  5DKH A;  4HXS A;  2DVR A;  4F3I A;  2YYN A;  5LJ1 A;  4UIY A;  5I83 A;  4TT2 A;  5I40 A;  4LZR A;  4RVR A;  5FE6 A;  5EWW A;  5FB0 A;  4CFK A;  5ENB A;  4NR4 A;  2R0S A;  5CUA A;  3P1F A;  4Z1Q A;  4ZQL A;  3UVY A;  4WHU A;  3UVD A;  4N4G A;  5FH6 A;  5D3N A;  4QBM A;  4E96 A;  5CY9 A;  5D3S A;  2GRC A;  3K2J A;  3LXJ A;  5LVQ A;  3MXF A;  4QSP A;  4UYE A;  5CGP A;  4QSR A;  4YC9 A;  4IR5 A;  1WUM A;  5I7X A;  5FG6 A;  3Q2E A;  4BHW A;  5D0C A;  5A83 A;  4O70 A;  4N4H A;  4ALG A;  2F6N A;  4HBV A;  2I7K A;  4QYD A;  5EGU A;  5EPS A;  5EWV A;  4CLB A;  5JI8 A;  4YAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...