5C7NA

Crystal structure of the human brpf1 bromodomain in complex with bromosporine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 39
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5c7nA00
4HXSA 4O7BA 4O77A 4TT6A 4TT4A 5HCLA 5I7XA 5II2A 2NXBA 4LZRA 5DY7A 5ENJA 5FE2A 5CQ4A 4O7CA 4XY9A 3LQIA 4YABA 5EGUA 5HELA 2MJVB 3UVWA 5CFWA 5LJ1A 5COIA 4YYHA 4UIWA 2RNWA 2E7OA 4O70A 2L5EA 2YQDA 4HXNA 5FG4A 5EP7A 5CUBA 5EWVA 3IU6A 5A5OA 4NYWA 4QUTA 5AMFA 5CPEA 5A5PA 4DONA 5CY9A 1JSPB 4UYEA 4MEPA 4N4GA 5EWCA 4A9LA 5ENGA 5CQ5A 3UV2A 5C8GA 4N3WA 5KHMA 4C67A 4TU6A 5F60A 5L97A 4PCEA 5EPRA 3I3JA 3LQHA 4QR3A 5EWHA 4XUBA 3O35A 5D3PA 5FFYA 4N4HA 2GRCA 5E3GA 2N9GA 4LZ2A 5E74A 2OUOA 4MR4A 4QY4A 5KTUA 3UV4A 5DFDA 4HXPA 4ZQLA 2I7KA 4YH3A 4NR8A 4PKLA 4PY6A 5CRMA 4J1PA 5EA1A 5CQTA 4NUCA 5CS8A 5IGLA 4TZ8A 3GG3A 5H1TA 5HQ5A 3MULA 2DKWA 4QC1A 3K2JA 4RVRA 5CQ3A 5CQ7A 5E7DA 4F3IA 5FFWA 5FE0A 3O36A 4IOQA 4UIUA 4IR6A 2F6NA 4UYDA 3LJWA 4A9EA 5F1LA 5FE1A 4NQNA 5ENEA 4Z6IA 2YYNA 2E3KA 5L99A 5HQ7A 2KTBB 4TYLA 4TU4A 5FB0A 4QYDA 5E3DA 4Z1SA 5EPBA 5DLZA 4A9IA 5DLXA 5I40A 5DKCA 5LJ0A 3JVKA 4CURA 4LDFA 5HM0A 4MR3A 3MXFA 4YATA 3P1DA 4QR4A 5DKDA 5JI8A 5EU1A 5CQ6A 5AMEA 4YYIA 4IR5A 5D3SA 2D9EA 5ENFA 4UYFB 4HXLA 4ALHA 5EWDA 2F6JA 5FE3A 4OGJA 5CGPA 4CUUA 5FE9A 4CUSA 2FSAA 5ETBA 4YY6A 5F25A 4BW3A 5A83A 5DX4A 3JVLA 4HBVA 5FE8A 4TS8A 4UYHA 4QBMA 4YYDA 4QNSA 1X0JA 4ALGA 3D7CA 3S91A 4YADA 4FLPA 4OUFA 5IGMA 5E0RA 4HXOA 4MENA 5D3HA 5D3LA 4HBYA 4CUTA 4ZW1A 4XUAA 5ENIA 2DVSA 5FFVA 4QUUA 2L85A 4QSQA 3MB3A 5DW2A 2R0VA 5FE4A 5FH7A 4NR9A 4IORA 1JM4B 5I7YA 4YYNA 4UITA 2YEKA 4NQMA 5AD2A 4XY8A 4O75A 4BW2A 4QC3A 4CUQA 4KV4A 5A7CA 3U5OA 5LKUA 5EPSA 5FE6A 5LVQA 5D24A 4CFLA 5D3RA 2YW5A 3U5KA 4O72A 5C87A 4C66A 4A9NA 2L84A 5I86A 5HFQA 4Z1QA 3UVDA 5L96A 5D7XA 4LYWA 5EM3A 4NRBA 5TCMA 5L8UA 5L8TA 4QEWA 4QSTA 1ZS5A 5F36A 4HXKA 5HRVA 5LKXA 4LZSA 5FG5A 4ZC9A 2DVQA 5J0DA 4LYSA 2H60A 3DAIA 3SVHA 5HENA 4BJXA 4OGIA 5BT5A 5CUDA 5FH6A 3AADA 4Y03A 4HBXA 4O76A 3SVGA 3UVYA 4O78A 4QR5A 5E73A 4TT2A 4NRCA 2YELA 3AQAA 5DYCA 4E96A 5KO4A 3U5JA 5KU3A 5C7NA 4XYAA 5HLSA 5H1VA 5FE5A 1WUMA 5EV9A 5DYUA 5E9LA 4Q0OA 5ENBA 5FDZA 4WHUA 5II1A 5C4QA 4PCIA 3U5PA 4AKNA 4YYGA 5IG6A 5HRWA 2WP2A 3HMHA 5EQ1A 2RNYA 4LYIA 4QB3A 4QEUA 5CUCA 5LKZA 4YH4A 5CUAA 4QSSA 4Z6HA 4QSUA 4QEVA 3G0JA 3HMFA 5DYAA 4YBSA 5F5ZA 4IR4A 5AD3A 5CUEA 1F68A 5E9IA 4YAXA 2OO1A 4J0SA 4NYXA 5E9KA 2LSPB 4IR3A 5FB1A 4KV1A 4MEOA 5DYXA 5ENCA 3NXBA 5H85A 5F3AA 5LUUA 5IGNA 5BT4A 4YC9A 4Q0NA 5I1QA 4HBWA 3QZSA 5FBXA 5CQAA 2YDWA 4O7EA 5CQ8A 4CL9A 4O71A 3Q2EA 2DWWA 5ACYA 4UYFA 4TZ2A 5ETDA 4LR6A 5F2PA 3RCWA 5KTWA 2R0YA 4QZSA 3QZTA 3LXJA 4J3IA 3O33A 5I83A 3ONIA 4YK0A 4PTBA 5A5QA 5KTXA 3QZVA 5G4RA 5JWMA 5A5NA 3SVFA 5A81A 4QSWA 5ENHA 5IBNA 4NR6A 4A9OA 4A9HA 4NS5A 5D26A 2E7NA 4HXRA 5DKHA 3P1EA 4NYVA 5D3NA 4Z93A 4BW4A 5CP5A 3TLPA 5C89A 4NR4A 1EQFA 4QSXA 4NUEA 5CTLA 1E6IA 2OSSA 3U5MA 4BHWA 4MR5A 3UW9A 5A85A 5CUGA 3G0LA 4N4IA 4QSRA 5A5SA 4CFKA 2RO1A 4O7FA 5BT3A 3U5LA 2DVRA 3P1CA 5HFRA 3P1FA 5DFBA 5FH8A 4LRGA 5C85A 4GPJA 5EK9A 4A9FA 5F63A 4YBTA 5LVRA 2R10A 4UYGA 3FKMX 3UVXA 3MQMA 4NR7A 2R0SA 4QSPA 4A9KA 5HQ6A 2G4AA 5D25A 4A9JA 5FG6A 5I29A 3Q2FA 4YBMA 1WUGA 3UV5A 3JVMA 4BW1A 4YY4A 5E9MA 4CUPA 5D0CA 3LQJA 4MR6A 5G4SA 5LKTA 4KCXA 5IGKA 4NRAA 5DFCA 2YEMA 4O74A 4YYJA 4NR5A 5K29A 4WHWA 3S92A 2I8NA 4TQNA 5CZGA 5DBMA 4HXMA 4QYLA 5D3TA 5EWWA 4YYKA 4UIYA 4UIXA 3U5NA 5F62A 4WIVA 2RFJA 5HRXA 3DWYA 5EI4A 4NUDA 4LC2A 5LJ2A 4NXJA 4O7AA 5D3JA 5I89A 2RNXA 5L98A 3MUKA 5CRZA 5EVAA 5A5RA 2DVVA 5IIDA 4CLBA 5FE7A 5EISA 3P5OA 2D82A 1N72A 5HJCA 3IU5A 5DW1A 4UIVA 2RI7A 3O34A 5I80A 4TTEA 4X2IA 4N4FA 4YYMA 5H1UA 5F1HA 2RS9B 3JVJA 5E9VA 5HEMA 4A9MA 5E9YA 5A82A 4MEQA 5F61A 4QSVA 3MB4A 4IOOA 3ZYUA 4UIZA 2DATA 5EICA 4PS5A 3HMEA 5CU8A 4J0RA 3O37A 5TB6A 5I88A 2WP1A
chains in the Genus database with same CATH superfamily
4HXSA 4O7BA 4O77A 4TT6A 4TT4A 5HCLA 5I7XA 5II2A 2NXBA 4LZRA 5DY7A 5ENJA 5FE2A 5CQ4A 4O7CA 4XY9A 3LQIA 4YABA 5EGUA 5HELA 2MJVB 3UVWA 5CFWA 5LJ1A 5COIA 4YYHA 4UIWA 2RNWA 2E7OA 4O70A 2L5EA 2YQDA 4HXNA 5FG4A 5EP7A 5CUBA 5EWVA 3IU6A 5A5OA 4NYWA 4QUTA 5AMFA 5CPEA 5A5PA 4DONA 5CY9A 1JSPB 4UYEA 4MEPA 4N4GA 5EWCA 4A9LA 5ENGA 5CQ5A 3UV2A 5C8GA 4N3WA 5KHMA 4C67A 4TU6A 5F60A 5L97A 4PCEA 5EPRA 3I3JA 3LQHA 4QR3A 5EWHA 4XUBA 3O35A 5D3PA 5FFYA 4N4HA 2GRCA 5E3GA 2N9GA 4LZ2A 5E74A 2OUOA 4MR4A 4QY4A 5KTUA 3UV4A 5DFDA 4HXPA 4ZQLA 2I7KA 4YH3A 4NR8A 4PKLA 4PY6A 5CRMA 4J1PA 5EA1A 5CQTA 4NUCA 5CS8A 5IGLA 4TZ8A 3GG3A 5H1TA 5HQ5A 3MULA 2DKWA 4QC1A 3K2JA 4RVRA 5CQ3A 5CQ7A 5E7DA 4F3IA 5FFWA 5FE0A 3O36A 4IOQA 4UIUA 4AKGA 4IR6A 2F6NA 4UYDA 3LJWA 4A9EA 5F1LA 5FE1A 4NQNA 5ENEA 4Z6IA 2YYNA 2E3KA 5L99A 5HQ7A 2KTBB 4TYLA 4TU4A 5FB0A 4QYDA 5E3DA 4Z1SA 5EPBA 5DLZA 4A9IA 5DLXA 5I40A 5DKCA 5LJ0A 3JVKA 4CURA 4LDFA 5HM0A 4MR3A 3MXFA 4YATA 3P1DA 4QR4A 5DKDA 5JI8A 5EU1A 5CQ6A 5AMEA 4YYIA 4IR5A 4AKIA 5D3SA 4AKHA 2D9EA 5ENFA 4UYFB 4HXLA 4ALHA 5EWDA 2F6JA 5FE3A 4OGJA 5CGPA 4CUUA 5FE9A 4CUSA 2FSAA 5ETBA 4YY6A 5F25A 4BW3A 5A83A 5DX4A 3JVLA 4HBVA 5FE8A 4TS8A 4UYHA 4QBMA 4YYDA 4QNSA 1X0JA 4ALGA 3D7CA 3S91A 4YADA 4FLPA 4OUFA 5IGMA 5E0RA 4HXOA 4MENA 5D3HA 5D3LA 4HBYA 4CUTA 4ZW1A 4XUAA 5ENIA 2DVSA 5FFVA 4QUUA 2L85A 4QSQA 3MB3A 5DW2A 2R0VA 5FE4A 5FH7A 4NR9A 4IORA 1JM4B 5I7YA 4YYNA 4UITA 2YEKA 4NQMA 5AD2A 4XY8A 4O75A 4BW2A 4QC3A 4CUQA 4KV4A 5A7CA 3U5OA 5LKUA 5EPSA 5FE6A 5LVQA 5D24A 4CFLA 5D3RA 2YW5A 3U5KA 4O72A 5C87A 4C66A 4A9NA 2L84A 5I86A 5HFQA 4Z1QA 3UVDA 5L96A 5D7XA 4LYWA 5EM3A 4NRBA 5TCMA 5L8UA 5L8TA 4QEWA 4QSTA 1ZS5A 5F36A 4HXKA 5HRVA 5LKXA 4LZSA 5FG5A 4ZC9A 2DVQA 5J0DA 4LYSA 2H60A 3DAIA 3SVHA 5HENA 4BJXA 4OGIA 5BT5A 5CUDA 5FH6A 3AADA 4Y03A 4HBXA 4O76A 3SVGA 3UVYA 4O78A 4QR5A 5E73A 4TT2A 4NRCA 2YELA 3AQAA 5DYCA 4E96A 5KO4A 3U5JA 5KU3A 5C7NA 4XYAA 5HLSA 5H1VA 5FE5A 1WUMA 5EV9A 5DYUA 5E9LA 4Q0OA 5ENBA 5FDZA 4WHUA 5II1A 5C4QA 4PCIA 3U5PA 4AKNA 4YYGA 5IG6A 5HRWA 2WP2A 3HMHA 3D1DA 5EQ1A 2RNYA 4LYIA 4QB3A 4QEUA 5CUCA 5LKZA 4YH4A 5CUAA 4QSSA 4Z6HA 4QSUA 4QEVA 3G0JA 3ERRA 3HMFA 5DYAA 4YBSA 5F5ZA 4IR4A 5AD3A 5CUEA 1F68A 5E9IA 4YAXA 2OO1A 4J0SA 4NYXA 5E9KA 2LSPB 4IR3A 5FB1A 4KV1A 4MEOA 5DYXA 5ENCA 3NXBA 5H85A 5F3AA 5LUUA 5IGNA 5BT4A 4YC9A 4Q0NA 5I1QA 4HBWA 3QZSA 5FBXA 5CQAA 2YDWA 4O7EA 5CQ8A 4CL9A 4O71A 3Q2EA 2DWWA 5ACYA 4UYFA 4TZ2A 5ETDA 4LR6A 5F2PA 3RCWA 5KTWA 2R0YA 4QZSA 3QZTA 3LXJA 4J3IA 3VKGA 3O33A 5I83A 3ONIA 4YK0A 4PTBA 5A5QA 5KTXA 3QZVA 5G4RA 5JWMA 5A5NA 3SVFA 1ZKRA 5A81A 4QSWA 5ENHA 5IBNA 4NR6A 4A9OA 4A9HA 4NS5A 5D26A 2E7NA 4HXRA 5DKHA 3P1EA 4NYVA 5D3NA 4Z93A 4BW4A 5CP5A 3TLPA 5C89A 4NR4A 1EQFA 4QSXA 4NUEA 5CTLA 1E6IA 2OSSA 3U5MA 4BHWA 4MR5A 3UW9A 5A85A 5CUGA 3G0LA 4N4IA 4QSRA 5A5SA 4CFKA 2RO1A 4O7FA 5BT3A 3U5LA 2DVRA 3P1CA 5HFRA 3P1FA 5DFBA 5FH8A 4LRGA 3D1BA 5C85A 4GPJA 5EK9A 4A9FA 5F63A 4YBTA 5LVRA 2R10A 4UYGA 3FKMX 3UVXA 3MQMA 4NR7A 2R0SA 4QSPA 4A9KA 2EJNA 5HQ6A 2G4AA 5D25A 4A9JA 5FG6A 5I29A 3Q2FA 4YBMA 1WUGA 3UV5A 3JVMA 4BW1A 4YY4A 5E9MA 4CUPA 5D0CA 3LQJA 4MR6A 5G4SA 5LKTA 4KCXA 5IGKA 4NRAA 5DFCA 2YEMA 4O74A 4YYJA 4NR5A 3VKHA 5K29A 4WHWA 3S92A 2I8NA 4TQNA 5CZGA 5DBMA 4HXMA 4QYLA 5D3TA 5EWWA 4YYKA 4UIYA 4UIXA 3U5NA 5F62A 4WIVA 2RFJA 5HRXA 3DWYA 5EI4A 4NUDA 4LC2A 5LJ2A 4NXJA 4O7AA 5D3JA 5I89A 2RNXA 5L98A 3MUKA 5CRZA 5EVAA 5A5RA 2DVVA 5IIDA 4CLBA 5FE7A 5EISA 3P5OA 2D82A 1N72A 5HJCA 3IU5A 5DW1A 4UIVA 2RI7A 4AI6A 3O34A 5I80A 4TTEA 4X2IA 4N4FA 4YYMA 5H1UA 5F1HA 2RS9B 3JVJA 5E9VA 5HEMA 4A9MA 5E9YA 5A82A 4MEQA 1PUOA 4QSVA 5F61A 3MB4A 4IOOA 3ZYUA 4UIZA 2DATA 5EICA 4PS5A 3HMEA 5CU8A 4J0RA 3O37A 5TB6A 5I88A 2WP1A
chains in the Genus database with same CATH topology
4HXSA 4O7BA 4O77A 4TT6A 4TT4A 5HCLA 5I7XA 5II2A 2NXBA 4LZRA 5DY7A 5ENJA 5FE2A 5CQ4A 4O7CA 4XY9A 3LQIA 4YABA 5EGUA 5HELA 2MJVB 3UVWA 5CFWA 5LJ1A 5COIA 4YYHA 4UIWA 2RNWA 2E7OA 4O70A 2L5EA 2YQDA 4HXNA 5FG4A 5EP7A 5CUBA 5EWVA 3IU6A 5A5OA 4NYWA 4QUTA 5AMFA 5CPEA 5A5PA 4DONA 5CY9A 1JSPB 4UYEA 4MEPA 4N4GA 5EWCA 4A9LA 5ENGA 5CQ5A 3UV2A 5C8GA 4N3WA 5KHMA 4C67A 4TU6A 5F60A 5L97A 4PCEA 5EPRA 3I3JA 3LQHA 4QR3A 5EWHA 4XUBA 3O35A 5D3PA 5FFYA 4N4HA 2GRCA 5E3GA 2N9GA 4LZ2A 5E74A 2OUOA 4MR4A 4QY4A 5KTUA 3UV4A 5DFDA 4HXPA 4ZQLA 2I7KA 4YH3A 4NR8A 4PKLA 4PY6A 5CRMA 4J1PA 5EA1A 5CQTA 4NUCA 5CS8A 5IGLA 4TZ8A 3GG3A 5H1TA 5HQ5A 3MULA 2DKWA 4QC1A 3K2JA 4RVRA 5CQ3A 5CQ7A 5E7DA 4F3IA 5FFWA 5FE0A 3O36A 4IOQA 4UIUA 4IR6A 2F6NA 4UYDA 3LJWA 4A9EA 5F1LA 5FE1A 4NQNA 5ENEA 4Z6IA 2YYNA 2E3KA 5L99A 5HQ7A 2KTBB 4TYLA 4TU4A 5FB0A 4QYDA 5E3DA 4Z1SA 5EPBA 5DLZA 4A9IA 5DLXA 5I40A 5DKCA 5LJ0A 3JVKA 4CURA 4LDFA 5HM0A 4MR3A 3MXFA 4YATA 3P1DA 4QR4A 5DKDA 5JI8A 5EU1A 5CQ6A 5AMEA 4YYIA 4IR5A 5D3SA 2D9EA 5ENFA 4UYFB 4HXLA 4ALHA 5EWDA 2F6JA 5FE3A 4OGJA 5CGPA 4CUUA 5FE9A 4CUSA 2FSAA 5ETBA 4YY6A 5F25A 4BW3A 5A83A 5DX4A 3JVLA 4HBVA 5FE8A 4TS8A 4UYHA 4QBMA 4YYDA 4QNSA 1X0JA 4ALGA 3D7CA 3S91A 4YADA 4FLPA 4OUFA 5IGMA 5E0RA 4HXOA 4MENA 5D3HA 5D3LA 4HBYA 4CUTA 4ZW1A 4XUAA 5ENIA 2DVSA 5FFVA 4QUUA 2L85A 4QSQA 3MB3A 5DW2A 2R0VA 5FE4A 5FH7A 4NR9A 4IORA 1JM4B 5I7YA 4YYNA 4UITA 2YEKA 4NQMA 5AD2A 4XY8A 4O75A 4BW2A 4QC3A 4CUQA 4KV4A 5A7CA 3U5OA 5LKUA 5EPSA 5FE6A 5LVQA 5D24A 4CFLA 5D3RA 2YW5A 3U5KA 4O72A 5C87A 4C66A 4A9NA 2L84A 5I86A 5HFQA 4Z1QA 3UVDA 5L96A 5D7XA 4LYWA 5EM3A 4NRBA 5TCMA 5L8UA 5L8TA 4QEWA 4QSTA 1ZS5A 5F36A 4HXKA 5HRVA 5LKXA 4LZSA 5FG5A 4ZC9A 2DVQA 5J0DA 4LYSA 2H60A 3DAIA 3SVHA 5HENA 4BJXA 4OGIA 5BT5A 5CUDA 5FH6A 3AADA 4Y03A 4HBXA 4O76A 3SVGA 3UVYA 4O78A 4QR5A 5E73A 4TT2A 4NRCA 2YELA 3AQAA 5DYCA 4E96A 5KO4A 3U5JA 5KU3A 5C7NA 4XYAA 5HLSA 5H1VA 5FE5A 1WUMA 5EV9A 5DYUA 5E9LA 4Q0OA 5ENBA 5FDZA 4WHUA 5II1A 5C4QA 4PCIA 3U5PA 4AKNA 4YYGA 5IG6A 5HRWA 2WP2A 3HMHA 5EQ1A 2RNYA 4LYIA 4QB3A 4QEUA 5CUCA 5LKZA 4YH4A 5CUAA 4QSSA 4Z6HA 4QSUA 4QEVA 3G0JA 3HMFA 5DYAA 4YBSA 5F5ZA 4IR4A 5AD3A 5CUEA 1F68A 5E9IA 4YAXA 2OO1A 4J0SA 4NYXA 5E9KA 2LSPB 4IR3A 5FB1A 4KV1A 4MEOA 5DYXA 5ENCA 3NXBA 5H85A 5F3AA 5LUUA 5IGNA 5BT4A 4YC9A 4Q0NA 5I1QA 4HBWA 3QZSA 5FBXA 5CQAA 2YDWA 4O7EA 5CQ8A 4CL9A 4O71A 3Q2EA 2DWWA 5ACYA 4UYFA 4TZ2A 5ETDA 4LR6A 5F2PA 3RCWA 5KTWA 2R0YA 4QZSA 3QZTA 3LXJA 4J3IA 3O33A 5I83A 3ONIA 4YK0A 4PTBA 5A5QA 5KTXA 3QZVA 5G4RA 5JWMA 5A5NA 3SVFA 5A81A 4QSWA 5ENHA 5IBNA 4NR6A 4A9OA 4A9HA 4NS5A 5D26A 2E7NA 4HXRA 5DKHA 3P1EA 4NYVA 5D3NA 4Z93A 4BW4A 5CP5A 3TLPA 5C89A 4NR4A 1EQFA 4QSXA 4NUEA 5CTLA 1E6IA 2OSSA 3U5MA 4BHWA 4MR5A 3UW9A 5A85A 5CUGA 3G0LA 4N4IA 4QSRA 5A5SA 4CFKA 2RO1A 4O7FA 5BT3A 3U5LA 2DVRA 3P1CA 5HFRA 3P1FA 5DFBA 5FH8A 4LRGA 5C85A 4GPJA 5EK9A 4A9FA 5F63A 4YBTA 5LVRA 2R10A 4UYGA 3FKMX 3UVXA 3MQMA 4NR7A 2R0SA 4QSPA 4A9KA 5HQ6A 2G4AA 5D25A 4A9JA 5FG6A 5I29A 3Q2FA 4YBMA 1WUGA 3UV5A 3JVMA 4BW1A 4YY4A 5E9MA 4CUPA 5D0CA 3LQJA 4MR6A 5G4SA 5LKTA 4KCXA 5IGKA 4NRAA 5DFCA 2YEMA 4O74A 4YYJA 4NR5A 5K29A 4WHWA 3S92A 2I8NA 4TQNA 5CZGA 5DBMA 4HXMA 4QYLA 5D3TA 5EWWA 4YYKA 4UIYA 4UIXA 3U5NA 5F62A 4WIVA 2RFJA 5HRXA 3DWYA 5EI4A 4NUDA 4LC2A 5LJ2A 4NXJA 4O7AA 5D3JA 5I89A 2RNXA 5L98A 3MUKA 5CRZA 5EVAA 5A5RA 2DVVA 5IIDA 4CLBA 5FE7A 5EISA 3P5OA 2D82A 1N72A 5HJCA 3IU5A 5DW1A 4UIVA 2RI7A 3O34A 5I80A 4TTEA 4X2IA 4N4FA 4YYMA 5H1UA 5F1HA 2RS9B 3JVJA 5E9VA 5HEMA 4A9MA 5E9YA 5A82A 4MEQA 5F61A 4QSVA 3MB4A 4IOOA 3ZYUA 4UIZA 2DATA 5EICA 4PS5A 3HMEA 5CU8A 4J0RA 3O37A 5TB6A 5I88A 2WP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXS A;  4O7B A;  4O77 A;  4TT6 A;  4TT4 A;  5HCL A;  5I7X A;  5II2 A;  2NXB A;  4LZR A;  5DY7 A;  5ENJ A;  5FE2 A;  5CQ4 A;  4O7C A;  4XY9 A;  3LQI A;  4YAB A;  5EGU A;  5HEL A;  2MJV B;  3UVW A;  5CFW A;  5LJ1 A;  5COI A;  4YYH A;  4UIW A;  2RNW A;  2E7O A;  4O70 A;  2L5E A;  2YQD A;  4HXN A;  5FG4 A;  5EP7 A;  5CUB A;  5EWV A;  3IU6 A;  5A5O A;  4NYW A;  4QUT A;  5AMF A;  5CPE A;  5A5P A;  4DON A;  5CY9 A;  1JSP B;  4UYE A;  4MEP A;  4N4G A;  5EWC A;  4A9L A;  5ENG A;  5CQ5 A;  3UV2 A;  5C8G A;  4N3W A;  5KHM A;  4C67 A;  4TU6 A;  5F60 A;  5L97 A;  4PCE A;  5EPR A;  3I3J A;  3LQH A;  4QR3 A;  5EWH A;  4XUB A;  3O35 A;  5D3P A;  5FFY A;  4N4H A;  2GRC A;  5E3G A;  2N9G A;  4LZ2 A;  5E74 A;  2OUO A;  4MR4 A;  4QY4 A;  5KTU A;  3UV4 A;  5DFD A;  4HXP A;  4ZQL A;  2I7K A;  4YH3 A;  4NR8 A;  4PKL A;  4PY6 A;  5CRM A;  4J1P A;  5EA1 A;  5CQT A;  4NUC A;  5CS8 A;  5IGL A;  4TZ8 A;  3GG3 A;  5H1T A;  5HQ5 A;  3MUL A;  2DKW A;  4QC1 A;  3K2J A;  4RVR A;  5CQ3 A;  5CQ7 A;  5E7D A;  4F3I A;  5FFW A;  5FE0 A;  3O36 A;  4IOQ A;  4UIU A;  4IR6 A;  2F6N A;  4UYD A;  3LJW A;  4A9E A;  5F1L A;  5FE1 A;  4NQN A;  5ENE A;  4Z6I A;  2YYN A;  2E3K A;  5L99 A;  5HQ7 A;  2KTB B;  4TYL A;  4TU4 A;  5FB0 A;  4QYD A;  5E3D A;  4Z1S A;  5EPB A;  5DLZ A;  4A9I A;  5DLX A;  5I40 A;  5DKC A;  5LJ0 A;  3JVK A;  4CUR A;  4LDF A;  5HM0 A;  4MR3 A;  3MXF A;  4YAT A;  3P1D A;  4QR4 A;  5DKD A;  5JI8 A;  5EU1 A;  5CQ6 A;  5AME A;  4YYI A;  4IR5 A;  5D3S A;  2D9E A;  5ENF A;  4UYF B;  4HXL A;  4ALH A;  5EWD A;  2F6J A;  5FE3 A;  4OGJ A;  5CGP A;  4CUU A;  5FE9 A;  4CUS A;  2FSA A;  5ETB A;  4YY6 A;  5F25 A;  4BW3 A;  5A83 A;  5DX4 A;  3JVL A;  4HBV A;  5FE8 A;  4TS8 A;  4UYH A;  4QBM A;  4YYD A;  4QNS A;  1X0J A;  4ALG A;  3D7C A;  3S91 A;  4YAD A;  4FLP A;  4OUF A;  5IGM A;  5E0R A;  4HXO A;  4MEN A;  5D3H A;  5D3L A;  4HBY A;  4CUT A;  4ZW1 A;  4XUA A;  5ENI A;  2DVS A;  5FFV A;  4QUU A;  2L85 A;  4QSQ A;  3MB3 A;  5DW2 A;  2R0V A;  5FE4 A;  5FH7 A;  4NR9 A;  4IOR A;  1JM4 B;  5I7Y A;  4YYN A;  4UIT A;  2YEK A;  4NQM A;  5AD2 A;  4XY8 A;  4O75 A;  4BW2 A;  4QC3 A;  4CUQ A;  4KV4 A;  5A7C A;  3U5O A;  5LKU A;  5EPS A;  5FE6 A;  5LVQ A;  5D24 A;  4CFL A;  5D3R A;  2YW5 A;  3U5K A;  4O72 A;  5C87 A;  4C66 A;  4A9N A;  2L84 A;  5I86 A;  5HFQ A;  4Z1Q A;  3UVD A;  5L96 A;  5D7X A;  4LYW A;  5EM3 A;  4NRB A;  5TCM A;  5L8U A;  5L8T A;  4QEW A;  4QST A;  1ZS5 A;  5F36 A;  4HXK A;  5HRV A;  5LKX A;  4LZS A;  5FG5 A;  4ZC9 A;  2DVQ A;  5J0D A;  4LYS A;  2H60 A;  3DAI A;  3SVH A;  5HEN A;  4BJX A;  4OGI A;  5BT5 A;  5CUD A;  5FH6 A;  3AAD A;  4Y03 A;  4HBX A;  4O76 A;  3SVG A;  3UVY A;  4O78 A;  4QR5 A;  5E73 A;  4TT2 A;  4NRC A;  2YEL A;  3AQA A;  5DYC A;  4E96 A;  5KO4 A;  3U5J A;  5KU3 A;  5C7N A;  4XYA A;  5HLS A;  5H1V A;  5FE5 A;  1WUM A;  5EV9 A;  5DYU A;  5E9L A;  4Q0O A;  5ENB A;  5FDZ A;  4WHU A;  5II1 A;  5C4Q A;  4PCI A;  3U5P A;  4AKN A;  4YYG A;  5IG6 A;  5HRW A;  2WP2 A;  3HMH A;  5EQ1 A;  2RNY A;  4LYI A;  4QB3 A;  4QEU A;  5CUC A;  5LKZ A;  4YH4 A;  5CUA A;  4QSS A;  4Z6H A;  4QSU A;  4QEV A;  3G0J A;  3HMF A;  5DYA A;  4YBS A;  5F5Z A;  4IR4 A;  5AD3 A;  5CUE A;  1F68 A;  5E9I A;  4YAX A;  2OO1 A;  4J0S A;  4NYX A;  5E9K A;  2LSP B;  4IR3 A;  5FB1 A;  4KV1 A;  4MEO A;  5DYX A;  5ENC A;  3NXB A;  5H85 A;  5F3A A;  5LUU A;  5IGN A;  5BT4 A;  4YC9 A;  4Q0N A;  5I1Q A;  4HBW A;  3QZS A;  5FBX A;  5CQA A;  2YDW A;  4O7E A;  5CQ8 A;  4CL9 A;  4O71 A;  3Q2E A;  2DWW A;  5ACY A;  4UYF A;  4TZ2 A;  5ETD A;  4LR6 A;  5F2P A;  3RCW A;  5KTW A;  2R0Y A;  4QZS A;  3QZT A;  3LXJ A;  4J3I A;  3O33 A;  5I83 A;  3ONI A;  4YK0 A;  4PTB A;  5A5Q A;  5KTX A;  3QZV A;  5G4R A;  5JWM A;  5A5N A;  3SVF A;  5A81 A;  4QSW A;  5ENH A;  5IBN A;  4NR6 A;  4A9O A;  4A9H A;  4NS5 A;  5D26 A;  2E7N A;  4HXR A;  5DKH A;  3P1E A;  4NYV A;  5D3N A;  4Z93 A;  4BW4 A;  5CP5 A;  3TLP A;  5C89 A;  4NR4 A;  1EQF A;  4QSX A;  4NUE A;  5CTL A;  1E6I A;  2OSS A;  3U5M A;  4BHW A;  4MR5 A;  3UW9 A;  5A85 A;  5CUG A;  3G0L A;  4N4I A;  4QSR A;  5A5S A;  4CFK A;  2RO1 A;  4O7F A;  5BT3 A;  3U5L A;  2DVR A;  3P1C A;  5HFR A;  3P1F A;  5DFB A;  5FH8 A;  4LRG A;  5C85 A;  4GPJ A;  5EK9 A;  4A9F A;  5F63 A;  4YBT A;  5LVR A;  2R10 A;  4UYG A;  3FKM X;  3UVX A;  3MQM A;  4NR7 A;  2R0S A;  4QSP A;  4A9K A;  5HQ6 A;  2G4A A;  5D25 A;  4A9J A;  5FG6 A;  5I29 A;  3Q2F A;  4YBM A;  1WUG A;  3UV5 A;  3JVM A;  4BW1 A;  4YY4 A;  5E9M A;  4CUP A;  5D0C A;  3LQJ A;  4MR6 A;  5G4S A;  5LKT A;  4KCX A;  5IGK A;  4NRA A;  5DFC A;  2YEM A;  4O74 A;  4YYJ A;  4NR5 A;  5K29 A;  4WHW A;  3S92 A;  2I8N A;  4TQN A;  5CZG A;  5DBM A;  4HXM A;  4QYL A;  5D3T A;  5EWW A;  4YYK A;  4UIY A;  4UIX A;  3U5N A;  5F62 A;  4WIV A;  2RFJ A;  5HRX A;  3DWY A;  5EI4 A;  4NUD A;  4LC2 A;  5LJ2 A;  4NXJ A;  4O7A A;  5D3J A;  5I89 A;  2RNX A;  5L98 A;  3MUK A;  5CRZ A;  5EVA A;  5A5R A;  2DVV A;  5IID A;  4CLB A;  5FE7 A;  5EIS A;  3P5O A;  2D82 A;  1N72 A;  5HJC A;  3IU5 A;  5DW1 A;  4UIV A;  2RI7 A;  3O34 A;  5I80 A;  4TTE A;  4X2I A;  4N4F A;  4YYM A;  5H1U A;  5F1H A;  2RS9 B;  3JVJ A;  5E9V A;  5HEM A;  4A9M A;  5E9Y A;  5A82 A;  4MEQ A;  5F61 A;  4QSV A;  3MB4 A;  4IOO A;  3ZYU A;  4UIZ A;  2DAT A;  5EIC A;  4PS5 A;  3HME A;  5CU8 A;  4J0R A;  3O37 A;  5TB6 A;  5I88 A;  2WP1 A; 
#chains in the Genus database with same CATH topology
 4HXS A;  4O7B A;  4O77 A;  4TT6 A;  4TT4 A;  5HCL A;  5I7X A;  5II2 A;  2NXB A;  4LZR A;  5DY7 A;  5ENJ A;  5FE2 A;  5CQ4 A;  4O7C A;  4XY9 A;  3LQI A;  4YAB A;  5EGU A;  5HEL A;  2MJV B;  3UVW A;  5CFW A;  5LJ1 A;  5COI A;  4YYH A;  4UIW A;  2RNW A;  2E7O A;  4O70 A;  2L5E A;  2YQD A;  4HXN A;  5FG4 A;  5EP7 A;  5CUB A;  5EWV A;  3IU6 A;  5A5O A;  4NYW A;  4QUT A;  5AMF A;  5CPE A;  5A5P A;  4DON A;  5CY9 A;  1JSP B;  4UYE A;  4MEP A;  4N4G A;  5EWC A;  4A9L A;  5ENG A;  5CQ5 A;  3UV2 A;  5C8G A;  4N3W A;  5KHM A;  4C67 A;  4TU6 A;  5F60 A;  5L97 A;  4PCE A;  5EPR A;  3I3J A;  3LQH A;  4QR3 A;  5EWH A;  4XUB A;  3O35 A;  5D3P A;  5FFY A;  4N4H A;  2GRC A;  5E3G A;  2N9G A;  4LZ2 A;  5E74 A;  2OUO A;  4MR4 A;  4QY4 A;  5KTU A;  3UV4 A;  5DFD A;  4HXP A;  4ZQL A;  2I7K A;  4YH3 A;  4NR8 A;  4PKL A;  4PY6 A;  5CRM A;  4J1P A;  5EA1 A;  5CQT A;  4NUC A;  5CS8 A;  5IGL A;  4TZ8 A;  3GG3 A;  5H1T A;  5HQ5 A;  3MUL A;  2DKW A;  4QC1 A;  3K2J A;  4RVR A;  5CQ3 A;  5CQ7 A;  5E7D A;  4F3I A;  5FFW A;  5FE0 A;  3O36 A;  4IOQ A;  4UIU A;  4AKG A;  4IR6 A;  2F6N A;  4UYD A;  3LJW A;  4A9E A;  5F1L A;  5FE1 A;  4NQN A;  5ENE A;  4Z6I A;  2YYN A;  2E3K A;  5L99 A;  5HQ7 A;  2KTB B;  4TYL A;  4TU4 A;  5FB0 A;  4QYD A;  5E3D A;  4Z1S A;  5EPB A;  5DLZ A;  4A9I A;  5DLX A;  5I40 A;  5DKC A;  5LJ0 A;  3JVK A;  4CUR A;  4LDF A;  5HM0 A;  4MR3 A;  3MXF A;  4YAT A;  3P1D A;  4QR4 A;  5DKD A;  5JI8 A;  5EU1 A;  5CQ6 A;  5AME A;  4YYI A;  4IR5 A;  4AKI A;  5D3S A;  4AKH A;  2D9E A;  5ENF A;  4UYF B;  4HXL A;  4ALH A;  5EWD A;  2F6J A;  5FE3 A;  4OGJ A;  5CGP A;  4CUU A;  5FE9 A;  4CUS A;  2FSA A;  5ETB A;  4YY6 A;  5F25 A;  4BW3 A;  5A83 A;  5DX4 A;  3JVL A;  4HBV A;  5FE8 A;  4TS8 A;  4UYH A;  4QBM A;  4YYD A;  4QNS A;  1X0J A;  4ALG A;  3D7C A;  3S91 A;  4YAD A;  4FLP A;  4OUF A;  5IGM A;  5E0R A;  4HXO A;  4MEN A;  5D3H A;  5D3L A;  4HBY A;  4CUT A;  4ZW1 A;  4XUA A;  5ENI A;  2DVS A;  5FFV A;  4QUU A;  2L85 A;  4QSQ A;  3MB3 A;  5DW2 A;  2R0V A;  5FE4 A;  5FH7 A;  4NR9 A;  4IOR A;  1JM4 B;  5I7Y A;  4YYN A;  4UIT A;  2YEK A;  4NQM A;  5AD2 A;  4XY8 A;  4O75 A;  4BW2 A;  4QC3 A;  4CUQ A;  4KV4 A;  5A7C A;  3U5O A;  5LKU A;  5EPS A;  5FE6 A;  5LVQ A;  5D24 A;  4CFL A;  5D3R A;  2YW5 A;  3U5K A;  4O72 A;  5C87 A;  4C66 A;  4A9N A;  2L84 A;  5I86 A;  5HFQ A;  4Z1Q A;  3UVD A;  5L96 A;  5D7X A;  4LYW A;  5EM3 A;  4NRB A;  5TCM A;  5L8U A;  5L8T A;  4QEW A;  4QST A;  1ZS5 A;  5F36 A;  4HXK A;  5HRV A;  5LKX A;  4LZS A;  5FG5 A;  4ZC9 A;  2DVQ A;  5J0D A;  4LYS A;  2H60 A;  3DAI A;  3SVH A;  5HEN A;  4BJX A;  4OGI A;  5BT5 A;  5CUD A;  5FH6 A;  3AAD A;  4Y03 A;  4HBX A;  4O76 A;  3SVG A;  3UVY A;  4O78 A;  4QR5 A;  5E73 A;  4TT2 A;  4NRC A;  2YEL A;  3AQA A;  5DYC A;  4E96 A;  5KO4 A;  3U5J A;  5KU3 A;  5C7N A;  4XYA A;  5HLS A;  5H1V A;  5FE5 A;  1WUM A;  5EV9 A;  5DYU A;  5E9L A;  4Q0O A;  5ENB A;  5FDZ A;  4WHU A;  5II1 A;  5C4Q A;  4PCI A;  3U5P A;  4AKN A;  4YYG A;  5IG6 A;  5HRW A;  2WP2 A;  3HMH A;  3D1D A;  5EQ1 A;  2RNY A;  4LYI A;  4QB3 A;  4QEU A;  5CUC A;  5LKZ A;  4YH4 A;  5CUA A;  4QSS A;  4Z6H A;  4QSU A;  4QEV A;  3G0J A;  3ERR A;  3HMF A;  5DYA A;  4YBS A;  5F5Z A;  4IR4 A;  5AD3 A;  5CUE A;  1F68 A;  5E9I A;  4YAX A;  2OO1 A;  4J0S A;  4NYX A;  5E9K A;  2LSP B;  4IR3 A;  5FB1 A;  4KV1 A;  4MEO A;  5DYX A;  5ENC A;  3NXB A;  5H85 A;  5F3A A;  5LUU A;  5IGN A;  5BT4 A;  4YC9 A;  4Q0N A;  5I1Q A;  4HBW A;  3QZS A;  5FBX A;  5CQA A;  2YDW A;  4O7E A;  5CQ8 A;  4CL9 A;  4O71 A;  3Q2E A;  2DWW A;  5ACY A;  4UYF A;  4TZ2 A;  5ETD A;  4LR6 A;  5F2P A;  3RCW A;  5KTW A;  2R0Y A;  4QZS A;  3QZT A;  3LXJ A;  4J3I A;  3VKG A;  3O33 A;  5I83 A;  3ONI A;  4YK0 A;  4PTB A;  5A5Q A;  5KTX A;  3QZV A;  5G4R A;  5JWM A;  5A5N A;  3SVF A;  1ZKR A;  5A81 A;  4QSW A;  5ENH A;  5IBN A;  4NR6 A;  4A9O A;  4A9H A;  4NS5 A;  5D26 A;  2E7N A;  4HXR A;  5DKH A;  3P1E A;  4NYV A;  5D3N A;  4Z93 A;  4BW4 A;  5CP5 A;  3TLP A;  5C89 A;  4NR4 A;  1EQF A;  4QSX A;  4NUE A;  5CTL A;  1E6I A;  2OSS A;  3U5M A;  4BHW A;  4MR5 A;  3UW9 A;  5A85 A;  5CUG A;  3G0L A;  4N4I A;  4QSR A;  5A5S A;  4CFK A;  2RO1 A;  4O7F A;  5BT3 A;  3U5L A;  2DVR A;  3P1C A;  5HFR A;  3P1F A;  5DFB A;  5FH8 A;  4LRG A;  3D1B A;  5C85 A;  4GPJ A;  5EK9 A;  4A9F A;  5F63 A;  4YBT A;  5LVR A;  2R10 A;  4UYG A;  3FKM X;  3UVX A;  3MQM A;  4NR7 A;  2R0S A;  4QSP A;  4A9K A;  2EJN A;  5HQ6 A;  2G4A A;  5D25 A;  4A9J A;  5FG6 A;  5I29 A;  3Q2F A;  4YBM A;  1WUG A;  3UV5 A;  3JVM A;  4BW1 A;  4YY4 A;  5E9M A;  4CUP A;  5D0C A;  3LQJ A;  4MR6 A;  5G4S A;  5LKT A;  4KCX A;  5IGK A;  4NRA A;  5DFC A;  2YEM A;  4O74 A;  4YYJ A;  4NR5 A;  3VKH A;  5K29 A;  4WHW A;  3S92 A;  2I8N A;  4TQN A;  5CZG A;  5DBM A;  4HXM A;  4QYL A;  5D3T A;  5EWW A;  4YYK A;  4UIY A;  4UIX A;  3U5N A;  5F62 A;  4WIV A;  2RFJ A;  5HRX A;  3DWY A;  5EI4 A;  4NUD A;  4LC2 A;  5LJ2 A;  4NXJ A;  4O7A A;  5D3J A;  5I89 A;  2RNX A;  5L98 A;  3MUK A;  5CRZ A;  5EVA A;  5A5R A;  2DVV A;  5IID A;  4CLB A;  5FE7 A;  5EIS A;  3P5O A;  2D82 A;  1N72 A;  5HJC A;  3IU5 A;  5DW1 A;  4UIV A;  2RI7 A;  4AI6 A;  3O34 A;  5I80 A;  4TTE A;  4X2I A;  4N4F A;  4YYM A;  5H1U A;  5F1H A;  2RS9 B;  3JVJ A;  5E9V A;  5HEM A;  4A9M A;  5E9Y A;  5A82 A;  4MEQ A;  1PUO A;  4QSV A;  5F61 A;  3MB4 A;  4IOO A;  3ZYU A;  4UIZ A;  2DAT A;  5EIC A;  4PS5 A;  3HME A;  5CU8 A;  4J0R A;  3O37 A;  5TB6 A;  5I88 A;  2WP1 A; 
#chains in the Genus database with same CATH homology
 4HXS A;  4O7B A;  4O77 A;  4TT6 A;  4TT4 A;  5HCL A;  5I7X A;  5II2 A;  2NXB A;  4LZR A;  5DY7 A;  5ENJ A;  5FE2 A;  5CQ4 A;  4O7C A;  4XY9 A;  3LQI A;  4YAB A;  5EGU A;  5HEL A;  2MJV B;  3UVW A;  5CFW A;  5LJ1 A;  5COI A;  4YYH A;  4UIW A;  2RNW A;  2E7O A;  4O70 A;  2L5E A;  2YQD A;  4HXN A;  5FG4 A;  5EP7 A;  5CUB A;  5EWV A;  3IU6 A;  5A5O A;  4NYW A;  4QUT A;  5AMF A;  5CPE A;  5A5P A;  4DON A;  5CY9 A;  1JSP B;  4UYE A;  4MEP A;  4N4G A;  5EWC A;  4A9L A;  5ENG A;  5CQ5 A;  3UV2 A;  5C8G A;  4N3W A;  5KHM A;  4C67 A;  4TU6 A;  5F60 A;  5L97 A;  4PCE A;  5EPR A;  3I3J A;  3LQH A;  4QR3 A;  5EWH A;  4XUB A;  3O35 A;  5D3P A;  5FFY A;  4N4H A;  2GRC A;  5E3G A;  2N9G A;  4LZ2 A;  5E74 A;  2OUO A;  4MR4 A;  4QY4 A;  5KTU A;  3UV4 A;  5DFD A;  4HXP A;  4ZQL A;  2I7K A;  4YH3 A;  4NR8 A;  4PKL A;  4PY6 A;  5CRM A;  4J1P A;  5EA1 A;  5CQT A;  4NUC A;  5CS8 A;  5IGL A;  4TZ8 A;  3GG3 A;  5H1T A;  5HQ5 A;  3MUL A;  2DKW A;  4QC1 A;  3K2J A;  4RVR A;  5CQ3 A;  5CQ7 A;  5E7D A;  4F3I A;  5FFW A;  5FE0 A;  3O36 A;  4IOQ A;  4UIU A;  4IR6 A;  2F6N A;  4UYD A;  3LJW A;  4A9E A;  5F1L A;  5FE1 A;  4NQN A;  5ENE A;  4Z6I A;  2YYN A;  2E3K A;  5L99 A;  5HQ7 A;  2KTB B;  4TYL A;  4TU4 A;  5FB0 A;  4QYD A;  5E3D A;  4Z1S A;  5EPB A;  5DLZ A;  4A9I A;  5DLX A;  5I40 A;  5DKC A;  5LJ0 A;  3JVK A;  4CUR A;  4LDF A;  5HM0 A;  4MR3 A;  3MXF A;  4YAT A;  3P1D A;  4QR4 A;  5DKD A;  5JI8 A;  5EU1 A;  5CQ6 A;  5AME A;  4YYI A;  4IR5 A;  5D3S A;  2D9E A;  5ENF A;  4UYF B;  4HXL A;  4ALH A;  5EWD A;  2F6J A;  5FE3 A;  4OGJ A;  5CGP A;  4CUU A;  5FE9 A;  4CUS A;  2FSA A;  5ETB A;  4YY6 A;  5F25 A;  4BW3 A;  5A83 A;  5DX4 A;  3JVL A;  4HBV A;  5FE8 A;  4TS8 A;  4UYH A;  4QBM A;  4YYD A;  4QNS A;  1X0J A;  4ALG A;  3D7C A;  3S91 A;  4YAD A;  4FLP A;  4OUF A;  5IGM A;  5E0R A;  4HXO A;  4MEN A;  5D3H A;  5D3L A;  4HBY A;  4CUT A;  4ZW1 A;  4XUA A;  5ENI A;  2DVS A;  5FFV A;  4QUU A;  2L85 A;  4QSQ A;  3MB3 A;  5DW2 A;  2R0V A;  5FE4 A;  5FH7 A;  4NR9 A;  4IOR A;  1JM4 B;  5I7Y A;  4YYN A;  4UIT A;  2YEK A;  4NQM A;  5AD2 A;  4XY8 A;  4O75 A;  4BW2 A;  4QC3 A;  4CUQ A;  4KV4 A;  5A7C A;  3U5O A;  5LKU A;  5EPS A;  5FE6 A;  5LVQ A;  5D24 A;  4CFL A;  5D3R A;  2YW5 A;  3U5K A;  4O72 A;  5C87 A;  4C66 A;  4A9N A;  2L84 A;  5I86 A;  5HFQ A;  4Z1Q A;  3UVD A;  5L96 A;  5D7X A;  4LYW A;  5EM3 A;  4NRB A;  5TCM A;  5L8U A;  5L8T A;  4QEW A;  4QST A;  1ZS5 A;  5F36 A;  4HXK A;  5HRV A;  5LKX A;  4LZS A;  5FG5 A;  4ZC9 A;  2DVQ A;  5J0D A;  4LYS A;  2H60 A;  3DAI A;  3SVH A;  5HEN A;  4BJX A;  4OGI A;  5BT5 A;  5CUD A;  5FH6 A;  3AAD A;  4Y03 A;  4HBX A;  4O76 A;  3SVG A;  3UVY A;  4O78 A;  4QR5 A;  5E73 A;  4TT2 A;  4NRC A;  2YEL A;  3AQA A;  5DYC A;  4E96 A;  5KO4 A;  3U5J A;  5KU3 A;  5C7N A;  4XYA A;  5HLS A;  5H1V A;  5FE5 A;  1WUM A;  5EV9 A;  5DYU A;  5E9L A;  4Q0O A;  5ENB A;  5FDZ A;  4WHU A;  5II1 A;  5C4Q A;  4PCI A;  3U5P A;  4AKN A;  4YYG A;  5IG6 A;  5HRW A;  2WP2 A;  3HMH A;  5EQ1 A;  2RNY A;  4LYI A;  4QB3 A;  4QEU A;  5CUC A;  5LKZ A;  4YH4 A;  5CUA A;  4QSS A;  4Z6H A;  4QSU A;  4QEV A;  3G0J A;  3HMF A;  5DYA A;  4YBS A;  5F5Z A;  4IR4 A;  5AD3 A;  5CUE A;  1F68 A;  5E9I A;  4YAX A;  2OO1 A;  4J0S A;  4NYX A;  5E9K A;  2LSP B;  4IR3 A;  5FB1 A;  4KV1 A;  4MEO A;  5DYX A;  5ENC A;  3NXB A;  5H85 A;  5F3A A;  5LUU A;  5IGN A;  5BT4 A;  4YC9 A;  4Q0N A;  5I1Q A;  4HBW A;  3QZS A;  5FBX A;  5CQA A;  2YDW A;  4O7E A;  5CQ8 A;  4CL9 A;  4O71 A;  3Q2E A;  2DWW A;  5ACY A;  4UYF A;  4TZ2 A;  5ETD A;  4LR6 A;  5F2P A;  3RCW A;  5KTW A;  2R0Y A;  4QZS A;  3QZT A;  3LXJ A;  4J3I A;  3O33 A;  5I83 A;  3ONI A;  4YK0 A;  4PTB A;  5A5Q A;  5KTX A;  3QZV A;  5G4R A;  5JWM A;  5A5N A;  3SVF A;  5A81 A;  4QSW A;  5ENH A;  5IBN A;  4NR6 A;  4A9O A;  4A9H A;  4NS5 A;  5D26 A;  2E7N A;  4HXR A;  5DKH A;  3P1E A;  4NYV A;  5D3N A;  4Z93 A;  4BW4 A;  5CP5 A;  3TLP A;  5C89 A;  4NR4 A;  1EQF A;  4QSX A;  4NUE A;  5CTL A;  1E6I A;  2OSS A;  3U5M A;  4BHW A;  4MR5 A;  3UW9 A;  5A85 A;  5CUG A;  3G0L A;  4N4I A;  4QSR A;  5A5S A;  4CFK A;  2RO1 A;  4O7F A;  5BT3 A;  3U5L A;  2DVR A;  3P1C A;  5HFR A;  3P1F A;  5DFB A;  5FH8 A;  4LRG A;  5C85 A;  4GPJ A;  5EK9 A;  4A9F A;  5F63 A;  4YBT A;  5LVR A;  2R10 A;  4UYG A;  3FKM X;  3UVX A;  3MQM A;  4NR7 A;  2R0S A;  4QSP A;  4A9K A;  5HQ6 A;  2G4A A;  5D25 A;  4A9J A;  5FG6 A;  5I29 A;  3Q2F A;  4YBM A;  1WUG A;  3UV5 A;  3JVM A;  4BW1 A;  4YY4 A;  5E9M A;  4CUP A;  5D0C A;  3LQJ A;  4MR6 A;  5G4S A;  5LKT A;  4KCX A;  5IGK A;  4NRA A;  5DFC A;  2YEM A;  4O74 A;  4YYJ A;  4NR5 A;  5K29 A;  4WHW A;  3S92 A;  2I8N A;  4TQN A;  5CZG A;  5DBM A;  4HXM A;  4QYL A;  5D3T A;  5EWW A;  4YYK A;  4UIY A;  4UIX A;  3U5N A;  5F62 A;  4WIV A;  2RFJ A;  5HRX A;  3DWY A;  5EI4 A;  4NUD A;  4LC2 A;  5LJ2 A;  4NXJ A;  4O7A A;  5D3J A;  5I89 A;  2RNX A;  5L98 A;  3MUK A;  5CRZ A;  5EVA A;  5A5R A;  2DVV A;  5IID A;  4CLB A;  5FE7 A;  5EIS A;  3P5O A;  2D82 A;  1N72 A;  5HJC A;  3IU5 A;  5DW1 A;  4UIV A;  2RI7 A;  3O34 A;  5I80 A;  4TTE A;  4X2I A;  4N4F A;  4YYM A;  5H1U A;  5F1H A;  2RS9 B;  3JVJ A;  5E9V A;  5HEM A;  4A9M A;  5E9Y A;  5A82 A;  4MEQ A;  5F61 A;  4QSV A;  3MB4 A;  4IOO A;  3ZYU A;  4UIZ A;  2DAT A;  5EIC A;  4PS5 A;  3HME A;  5CU8 A;  4J0R A;  3O37 A;  5TB6 A;  5I88 A;  2WP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...