5C7NA

Crystal structure of the human brpf1 bromodomain in complex with bromosporine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
112
structure length
112
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peregrin
publication title Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 39
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2015-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5c7nA00
3GG3A 4XYAA 4BHWA 4A9HA 4MEPA 5EISA 3AADA 4O70A 5AMEA 4YYHA 3HMEA 4XUAA 5FE1A 4PS5A 2YQDA 4YYNA 5ENCA 4WHUA 4KV1A 4YAXA 4PCIA 5HELA 4A9FA 5ENFA 3LQJA 5E9KA 5ENEA 4YYMA 4Z93A 5FH8A 4UYGA 4NR4A 5E9MA 5C87A 5I7YA 5ENJA 5CGPA 1N72A 4IOOA 5DW1A 5IGKA 3U5KA 5I83A 4HXOA 3G0LA 4GPJA 5DKHA 5LKUA 5F62A 4KV4A 4O7EA 4QC3A 5FB1A 5EGUA 2DVVA 4NYWA 2NXBA 5E9LA 5EV9A 5A81A 3S91A 4A9OA 2E3KA 5EWCA 2E7OA 2OUOA 5E3DA 5I80A 5EK9A 2MJVB 5I40A 2F6JA 4A9MA 5KU3A 5CRMA 5I1QA 5LKXA 4A9EA 4HBVA 3UVYA 3DAIA 4QR5A 5A82A 2R10A 5HRXA 3UV4A 4C67A 2OSSA 5DKDA 5CQ6A 4NR7A 4NUDA 5BT3A 4YY4A 2L5EA 4OGJA 5DYUA 5FG5A 4LYIA 3HMFA 5CUCA 5CFWA 4Q0OA 3DWYA 5A5RA 5DLZA 1WUMA 4O7CA 4MR3A 2R0SA 4QSTA 5JI8A 5EQ1A 5JWMA 5EM3A 1WUGA 4HBWA 3NXBA 5AD2A 5FFWA 4HXNA 5CTLA 3Q2FA 3IU5A 2R0YA 5FFVA 4TT4A 4HBXA 5ETDA 5TB6A 5FE8A 5KHMA 5LJ1A 4UIXA 5D3SA 4IR5A 5ENGA 5K29A 4UIUA 4N4IA 5CUEA 5KTWA 4PY6A 4LZSA 5D3JA 2LSPB 4O74A 5DY7A 2R0VA 4YBMA 4QEWA 4YYJA 3U5MA 5COIA 5HM0A 4KCXA 5E7DA 3LXJA 5FH7A 3QZTA 5E3GA 4QNSA 4MEOA 2DATA 5CQTA 4HXSA 5C85A 5E0RA 4LRGA 4YYGA 5IGMA 4Z1QA 5C4QA 4QEVA 5DFBA 4QSPA 4YY6A 1X0JA 4A9JA 5I89A 2DWWA 5G4RA 5H1TA 4XY8A 4Y03A 5F25A 5KTUA 2I8NA 2RS9B 2L85A 5F36A 5E9VA 4QC1A 5CUAA 5D3LA 3FKMX 5H85A 5EU1A 4YYIA 4BW1A 2D9EA 4J0SA 2I7KA 4MR5A 4OUFA 4O7BA 4HXLA 3G0JA 4O7AA 4A9NA 4NXJA 3O35A 4TYLA 3SVFA 2E7NA 5ENBA 4J3IA 4TU6A 4QBMA 5H1UA 4LYSA 4QY4A 5F1LA 5CQ3A 3P1CA 4YATA 5LUUA 3P1FA 5IGNA 5A7CA 5EICA 4HXRA 3D7CA 4AKNA 5ACYA 4MR6A 4NR8A 5A85A 3Q2EA 5D3TA 1JM4B 4YYDA 1F68A 3UV5A 5EI4A 4BW2A 5IBNA 3JVMA 3O34A 5L8UA 5D24A 3MULA 5C7NA 4QB3A 2L84A 5CQ4A 3MUKA 5A5OA 4TT2A 4YBSA 3HMHA 3UV2A 4N4GA 5I86A 4TU4A 4NYXA 5DKCA 1E6IA 3P1EA 4FLPA 4YK0A 5CY9A 3U5OA 4YYKA 4O7FA 4UIZA 5FH6A 5F2PA 4QSSA 5EPSA 4CFLA 5EP7A 3TLPA 5KO4A 5CP5A 3UW9A 5DYXA 2YEMA 4N4FA 5L8TA 2RFJA 5FFYA 1JSPB 3SVHA 4LDFA 2WP2A 2DVRA 4LZ2A 4IR3A 3JVLA 4NUCA 5CS8A 4TQNA 4HXMA 5D3NA 5EPBA 5HENA 5IGLA 4ALGA 3P1DA 4LZRA 5E73A 5A5SA 2OO1A 5F5ZA 2GRCA 4CUUA 4TZ2A 5EWVA 4QZSA 5BT4A 4PKLA 4Z6IA 3AQAA 3LQIA 4YADA 5FBXA 4Q0NA 5CUGA 5DFCA 4DONA 5FE0A 3MB4A 4Z1SA 4TS8A 4NQMA 3O36A 4QR4A 4NR6A 5HEMA 5D0CA 4UYEA 4O71A 2RI7A 4O78A 4YBTA 5FE6A 3MQMA 5FE5A 4ALHA 4MENA 5EA1A 5IIDA 2G4AA 5BT5A 2RNYA 2YYNA 5F1HA 2YEKA 4UYHA 4UITA 1ZS5A 3UVXA 5D3PA 5D26A 5CUBA 5DX4A 5TCMA 5CPEA 5L97A 5CQAA 5HRVA 4QYDA 4CUQA 4IORA 5DW2A 4O77A 5AMFA 4NRCA 5CZGA 4E96A 5C89A 4HXPA 4N3WA 4NRBA 4YH4A 5LKTA 5LVRA 4QSRA 5ETBA 5FDZA 4Z6HA 3JVKA 4ZC9A 4ZW1A 4YH3A 4PCEA 4WIVA 3SVGA 5CUDA 5CQ5A 5CQ7A 2WP1A 4IR4A 5E9YA 2KTBB 2F6NA 5FE3A 4LC2A 5HJCA 4PTBA 5I88A 5HQ6A 5A5PA 2DKWA 5FE2A 4OGIA 3U5LA 4J0RA 4CURA 3IU6A 2RO1A 4XY9A 4QSQA 4CUTA 5HCLA 4UIWA 4A9IA 5EWHA 3U5JA 4QEUA 4O75A 5FE9A 5A83A 4TZ8A 3K2JA 4O76A 4X2IA 5AD3A 2DVSA 5KTXA 2RNWA 2YDWA 2D82A 5LKZA 5G4SA 5F61A 3O33A 4ZQLA 3MB3A 4HBYA 4WHWA 4LR6A 4BJXA 5L99A 5II1A 3U5PA 4BW4A 4TT6A 4UIYA 4IR6A 4YC9A 5E9IA 3LQHA 4J1PA 3QZVA 5HQ5A 2N9GA 5F60A 5HFQA 5HRWA 4QUUA 1EQFA 3UVWA 4A9KA 5LJ2A 5FB0A 4UYDA 4UYFA 3U5NA 5EWDA 4N4HA 5LVQA 3I3JA 5F3AA 4CUSA 4NR5A 4NUEA 4A9LA 5CU8A 2DVQA 3P5OA 4C66A 5D25A 3LJWA 3RCWA 5FE7A 2H60A 5DFDA 5DYCA 4CL9A 2YELA 5HLSA 4O72A 4F3IA 4HXKA 5IG6A 3MXFA 4QYLA 5EVAA 5DLXA 2RNXA 5CRZA 5D3HA 5HFRA 2YW5A 5J0DA 5D7XA 4QSXA 5HQ7A 3ONIA 4QUTA 4MEQA 5D3RA 4CLBA 5F63A 5E74A 4QSVA 4NRAA 5C8GA 4QSWA 5CQ8A 3ZYUA 5FE4A 4YABA 5ENHA 5DYAA 4UYFB 5DBMA 4BW3A 4TTEA 4LYWA 4UIVA 4CUPA 5A5QA 4MR4A 5LJ0A 3O37A 4QR3A 5FG4A 5ENIA 3UVDA 5I7XA 4NS5A 4RVRA 5I29A 4QSUA 5II2A 5A5NA 4CFKA 5FG6A 4XUBA 2FSAA 5L96A 3QZSA 4NR9A 5EWWA 3S92A 5EPRA 4NYVA 5L98A 3JVJA 5H1VA 4NQNA 4IOQA
chains in the Genus database with same CATH superfamily
3GG3A 4XYAA 4BHWA 4A9HA 4MEPA 5EISA 3AADA 4O70A 5AMEA 4YYHA 3HMEA 4XUAA 5FE1A 4PS5A 2YQDA 4YYNA 5ENCA 4WHUA 4KV1A 4YAXA 4PCIA 5HELA 4A9FA 5ENFA 3LQJA 5E9KA 5ENEA 4YYMA 4Z93A 5FH8A 4UYGA 4NR4A 5E9MA 5C87A 5I7YA 5ENJA 5CGPA 1N72A 4IOOA 5DW1A 5IGKA 3U5KA 5I83A 4HXOA 3G0LA 4GPJA 5DKHA 5LKUA 5F62A 4KV4A 4O7EA 4QC3A 5FB1A 5EGUA 2DVVA 4NYWA 2NXBA 5E9LA 5EV9A 5A81A 3S91A 4A9OA 2E3KA 5EWCA 2E7OA 2OUOA 5E3DA 5I80A 5EK9A 2MJVB 5I40A 2F6JA 4A9MA 5KU3A 5CRMA 5I1QA 5LKXA 4A9EA 4HBVA 3UVYA 3DAIA 4QR5A 5A82A 2R10A 5HRXA 3UV4A 4AKHA 4C67A 2OSSA 5DKDA 5CQ6A 4NR7A 4NUDA 5BT3A 4YY4A 2L5EA 4OGJA 5DYUA 5FG5A 4LYIA 3HMFA 5CUCA 5CFWA 4Q0OA 3DWYA 5A5RA 5DLZA 1WUMA 4O7CA 4MR3A 2R0SA 4QSTA 5JI8A 5EQ1A 5JWMA 5EM3A 1WUGA 4HBWA 3NXBA 5AD2A 5FFWA 4HXNA 5CTLA 3Q2FA 3IU5A 2R0YA 5FFVA 4TT4A 4HBXA 5ETDA 5TB6A 5FE8A 5KHMA 5LJ1A 4UIXA 5D3SA 4IR5A 5ENGA 5K29A 4UIUA 4N4IA 5CUEA 5KTWA 4PY6A 4LZSA 5D3JA 2LSPB 4O74A 5DY7A 2R0VA 4YBMA 4QEWA 4YYJA 3U5MA 5COIA 5HM0A 4KCXA 5E7DA 3LXJA 5FH7A 3QZTA 1PUOA 5E3GA 4QNSA 4MEOA 2DATA 5CQTA 4HXSA 5C85A 5E0RA 4LRGA 4YYGA 5IGMA 4Z1QA 5C4QA 4QEVA 5DFBA 4QSPA 4YY6A 1X0JA 4A9JA 5I89A 2DWWA 5G4RA 5H1TA 4XY8A 4Y03A 2EJNA 5F25A 5KTUA 2I8NA 2RS9B 2L85A 5F36A 5E9VA 4QC1A 5CUAA 5D3LA 3FKMX 5H85A 5EU1A 4YYIA 4BW1A 2D9EA 4J0SA 2I7KA 4MR5A 4OUFA 4O7BA 4HXLA 3G0JA 4O7AA 4A9NA 4NXJA 3O35A 4TYLA 3SVFA 2E7NA 5ENBA 4J3IA 4TU6A 4QBMA 5H1UA 4LYSA 4QY4A 5F1LA 3ERRA 3P1CA 5CQ3A 4YATA 5LUUA 3P1FA 5IGNA 5A7CA 5EICA 4HXRA 3D7CA 4AKNA 5ACYA 4MR6A 4NR8A 5A85A 3Q2EA 5D3TA 1JM4B 4YYDA 1F68A 3UV5A 5EI4A 4BW2A 5IBNA 3JVMA 3O34A 5L8UA 5D24A 3MULA 5C7NA 4QB3A 2L84A 5CQ4A 3MUKA 5A5OA 4TT2A 4YBSA 3HMHA 3UV2A 4N4GA 5I86A 4TU4A 4NYXA 5DKCA 1E6IA 3P1EA 4FLPA 4YK0A 5CY9A 3U5OA 4YYKA 4O7FA 4UIZA 5FH6A 5F2PA 4QSSA 5EPSA 4CFLA 5EP7A 3TLPA 5KO4A 5CP5A 3VKHA 3UW9A 5DYXA 2YEMA 4N4FA 5L8TA 2RFJA 5FFYA 1JSPB 3SVHA 4LDFA 2WP2A 2DVRA 4LZ2A 4IR3A 3JVLA 4NUCA 5CS8A 4TQNA 4HXMA 5D3NA 5EPBA 5HENA 5IGLA 4ALGA 3P1DA 4LZRA 5E73A 5A5SA 2OO1A 5F5ZA 2GRCA 4CUUA 4TZ2A 5EWVA 4QZSA 5BT4A 4PKLA 4Z6IA 3AQAA 3LQIA 4YADA 5FBXA 4Q0NA 5CUGA 5DFCA 4DONA 5FE0A 3MB4A 4Z1SA 4TS8A 4NQMA 3O36A 4QR4A 4NR6A 5HEMA 5D0CA 4UYEA 4O71A 2RI7A 4O78A 4YBTA 5FE6A 3MQMA 5FE5A 4ALHA 4MENA 5EA1A 5IIDA 2G4AA 5BT5A 2RNYA 2YYNA 5F1HA 2YEKA 4UYHA 4UITA 1ZS5A 3UVXA 5D3PA 5D26A 5CUBA 5DX4A 5TCMA 5CPEA 5L97A 5CQAA 5HRVA 4QYDA 4CUQA 4IORA 5DW2A 4O77A 5AMFA 4NRCA 5CZGA 4E96A 5C89A 4HXPA 4N3WA 4NRBA 4YH4A 5LKTA 5LVRA 4QSRA 5ETBA 5FDZA 4Z6HA 3JVKA 4ZC9A 4ZW1A 4YH3A 4PCEA 4WIVA 3SVGA 5CUDA 5CQ5A 5CQ7A 2WP1A 4IR4A 5E9YA 2KTBB 2F6NA 5FE3A 4LC2A 4AI6A 5HJCA 4PTBA 5I88A 5HQ6A 5A5PA 3VKGA 2DKWA 5FE2A 4OGIA 3U5LA 4J0RA 4CURA 3IU6A 2RO1A 4XY9A 4QSQA 4CUTA 5HCLA 4UIWA 4A9IA 5EWHA 3U5JA 4QEUA 4O75A 5FE9A 5A83A 4TZ8A 3K2JA 4O76A 4X2IA 5AD3A 2DVSA 5KTXA 2RNWA 2YDWA 2D82A 3D1DA 5G4SA 5LKZA 5F61A 3O33A 4ZQLA 3MB3A 4HBYA 4WHWA 4LR6A 4BJXA 5L99A 1ZKRA 5II1A 3U5PA 4BW4A 4TT6A 4UIYA 4IR6A 4YC9A 5E9IA 3LQHA 4J1PA 3QZVA 5HQ5A 2N9GA 4AKGA 5F60A 3D1BA 5HFQA 5HRWA 4QUUA 1EQFA 3UVWA 4A9KA 5LJ2A 5FB0A 4UYDA 4UYFA 3U5NA 5EWDA 4N4HA 5LVQA 3I3JA 5F3AA 4CUSA 4NR5A 4NUEA 4A9LA 5CU8A 2DVQA 3P5OA 4C66A 5D25A 3LJWA 3RCWA 5FE7A 2H60A 5DFDA 5DYCA 4CL9A 2YELA 5HLSA 4O72A 4F3IA 4HXKA 5IG6A 3MXFA 4QYLA 5EVAA 5DLXA 2RNXA 5CRZA 5D3HA 5HFRA 2YW5A 5J0DA 5D7XA 4AKIA 4QSXA 5HQ7A 3ONIA 4QUTA 4MEQA 5D3RA 4CLBA 5F63A 5E74A 4QSVA 4NRAA 5C8GA 4QSWA 5CQ8A 3ZYUA 5FE4A 4YABA 5ENHA 5DYAA 4UYFB 5DBMA 4BW3A 4TTEA 4LYWA 4UIVA 4CUPA 5A5QA 4MR4A 5LJ0A 3O37A 4QR3A 5FG4A 5ENIA 3UVDA 5I7XA 4NS5A 4RVRA 5I29A 4QSUA 5II2A 5A5NA 4CFKA 5FG6A 4XUBA 2FSAA 5L96A 3QZSA 4NR9A 5EWWA 3S92A 5EPRA 4NYVA 5L98A 3JVJA 5H1VA 4NQNA 4IOQA
chains in the Genus database with same CATH topology
3GG3A 4XYAA 4BHWA 4A9HA 4MEPA 5EISA 3AADA 4O70A 5AMEA 4YYHA 3HMEA 4XUAA 5FE1A 4PS5A 2YQDA 4YYNA 5ENCA 4WHUA 4KV1A 4YAXA 4PCIA 5HELA 4A9FA 5ENFA 3LQJA 5E9KA 5ENEA 4YYMA 4Z93A 5FH8A 4UYGA 4NR4A 5E9MA 5C87A 5I7YA 5ENJA 5CGPA 1N72A 4IOOA 5DW1A 5IGKA 3U5KA 5I83A 4HXOA 3G0LA 4GPJA 5DKHA 5LKUA 5F62A 4KV4A 4O7EA 4QC3A 5FB1A 5EGUA 2DVVA 4NYWA 2NXBA 5E9LA 5EV9A 5A81A 3S91A 4A9OA 2E3KA 5EWCA 2E7OA 2OUOA 5E3DA 5I80A 5EK9A 2MJVB 5I40A 2F6JA 4A9MA 5KU3A 5CRMA 5I1QA 5LKXA 4A9EA 4HBVA 3UVYA 3DAIA 4QR5A 5A82A 2R10A 5HRXA 3UV4A 4C67A 2OSSA 5DKDA 5CQ6A 4NR7A 4NUDA 5BT3A 4YY4A 2L5EA 4OGJA 5DYUA 5FG5A 4LYIA 3HMFA 5CUCA 5CFWA 4Q0OA 3DWYA 5A5RA 5DLZA 1WUMA 4O7CA 4MR3A 2R0SA 4QSTA 5JI8A 5EQ1A 5JWMA 5EM3A 1WUGA 4HBWA 3NXBA 5AD2A 5FFWA 4HXNA 5CTLA 3Q2FA 3IU5A 2R0YA 5FFVA 4TT4A 4HBXA 5ETDA 5TB6A 5FE8A 5KHMA 5LJ1A 4UIXA 5D3SA 4IR5A 5ENGA 5K29A 4UIUA 4N4IA 5CUEA 5KTWA 4PY6A 4LZSA 5D3JA 2LSPB 4O74A 5DY7A 2R0VA 4YBMA 4QEWA 4YYJA 3U5MA 5COIA 5HM0A 4KCXA 5E7DA 3LXJA 5FH7A 3QZTA 5E3GA 4QNSA 4MEOA 2DATA 5CQTA 4HXSA 5C85A 5E0RA 4LRGA 4YYGA 5IGMA 4Z1QA 5C4QA 4QEVA 5DFBA 4QSPA 4YY6A 1X0JA 4A9JA 5I89A 2DWWA 5G4RA 5H1TA 4XY8A 4Y03A 5F25A 5KTUA 2I8NA 2RS9B 2L85A 5F36A 5E9VA 4QC1A 5CUAA 5D3LA 3FKMX 5H85A 5EU1A 4YYIA 4BW1A 2D9EA 4J0SA 2I7KA 4MR5A 4OUFA 4O7BA 4HXLA 3G0JA 4O7AA 4A9NA 4NXJA 3O35A 4TYLA 3SVFA 2E7NA 5ENBA 4J3IA 4TU6A 4QBMA 5H1UA 4LYSA 4QY4A 5F1LA 5CQ3A 3P1CA 4YATA 5LUUA 3P1FA 5IGNA 5A7CA 5EICA 4HXRA 3D7CA 4AKNA 5ACYA 4MR6A 4NR8A 5A85A 3Q2EA 5D3TA 1JM4B 4YYDA 1F68A 3UV5A 5EI4A 4BW2A 5IBNA 3JVMA 3O34A 5L8UA 5D24A 3MULA 5C7NA 4QB3A 2L84A 5CQ4A 3MUKA 5A5OA 4TT2A 4YBSA 3HMHA 3UV2A 4N4GA 5I86A 4TU4A 4NYXA 5DKCA 1E6IA 3P1EA 4FLPA 4YK0A 5CY9A 3U5OA 4YYKA 4O7FA 4UIZA 5FH6A 5F2PA 4QSSA 5EPSA 4CFLA 5EP7A 3TLPA 5KO4A 5CP5A 3UW9A 5DYXA 2YEMA 4N4FA 5L8TA 2RFJA 5FFYA 1JSPB 3SVHA 4LDFA 2WP2A 2DVRA 4LZ2A 4IR3A 3JVLA 4NUCA 5CS8A 4TQNA 4HXMA 5D3NA 5EPBA 5HENA 5IGLA 4ALGA 3P1DA 4LZRA 5E73A 5A5SA 2OO1A 5F5ZA 2GRCA 4CUUA 4TZ2A 5EWVA 4QZSA 5BT4A 4PKLA 4Z6IA 3AQAA 3LQIA 4YADA 5FBXA 4Q0NA 5CUGA 5DFCA 4DONA 5FE0A 3MB4A 4Z1SA 4TS8A 4NQMA 3O36A 4QR4A 4NR6A 5HEMA 5D0CA 4UYEA 4O71A 2RI7A 4O78A 4YBTA 5FE6A 3MQMA 5FE5A 4ALHA 4MENA 5EA1A 5IIDA 2G4AA 5BT5A 2RNYA 2YYNA 5F1HA 2YEKA 4UYHA 4UITA 1ZS5A 3UVXA 5D3PA 5D26A 5CUBA 5DX4A 5TCMA 5CPEA 5L97A 5CQAA 5HRVA 4QYDA 4CUQA 4IORA 5DW2A 4O77A 5AMFA 4NRCA 5CZGA 4E96A 5C89A 4HXPA 4N3WA 4NRBA 4YH4A 5LKTA 5LVRA 4QSRA 5ETBA 5FDZA 4Z6HA 3JVKA 4ZC9A 4ZW1A 4YH3A 4PCEA 4WIVA 3SVGA 5CUDA 5CQ5A 5CQ7A 2WP1A 4IR4A 5E9YA 2KTBB 2F6NA 5FE3A 4LC2A 5HJCA 4PTBA 5I88A 5HQ6A 5A5PA 2DKWA 5FE2A 4OGIA 3U5LA 4J0RA 4CURA 3IU6A 2RO1A 4XY9A 4QSQA 4CUTA 5HCLA 4UIWA 4A9IA 5EWHA 3U5JA 4QEUA 4O75A 5FE9A 5A83A 4TZ8A 3K2JA 4O76A 4X2IA 5AD3A 2DVSA 5KTXA 2RNWA 2YDWA 2D82A 5LKZA 5G4SA 5F61A 3O33A 4ZQLA 3MB3A 4HBYA 4WHWA 4LR6A 4BJXA 5L99A 5II1A 3U5PA 4BW4A 4TT6A 4UIYA 4IR6A 4YC9A 5E9IA 3LQHA 4J1PA 3QZVA 5HQ5A 2N9GA 5F60A 5HFQA 5HRWA 4QUUA 1EQFA 3UVWA 4A9KA 5LJ2A 5FB0A 4UYDA 4UYFA 3U5NA 5EWDA 4N4HA 5LVQA 3I3JA 5F3AA 4CUSA 4NR5A 4NUEA 4A9LA 5CU8A 2DVQA 3P5OA 4C66A 5D25A 3LJWA 3RCWA 5FE7A 2H60A 5DFDA 5DYCA 4CL9A 2YELA 5HLSA 4O72A 4F3IA 4HXKA 5IG6A 3MXFA 4QYLA 5EVAA 5DLXA 2RNXA 5CRZA 5D3HA 5HFRA 2YW5A 5J0DA 5D7XA 4QSXA 5HQ7A 3ONIA 4QUTA 4MEQA 5D3RA 4CLBA 5F63A 5E74A 4QSVA 4NRAA 5C8GA 4QSWA 5CQ8A 3ZYUA 5FE4A 4YABA 5ENHA 5DYAA 4UYFB 5DBMA 4BW3A 4TTEA 4LYWA 4UIVA 4CUPA 5A5QA 4MR4A 5LJ0A 3O37A 4QR3A 5FG4A 5ENIA 3UVDA 5I7XA 4NS5A 4RVRA 5I29A 4QSUA 5II2A 5A5NA 4CFKA 5FG6A 4XUBA 2FSAA 5L96A 3QZSA 4NR9A 5EWWA 3S92A 5EPRA 4NYVA 5L98A 3JVJA 5H1VA 4NQNA 4IOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GG3 A;  4XYA A;  4BHW A;  4A9H A;  4MEP A;  5EIS A;  3AAD A;  4O70 A;  5AME A;  4YYH A;  3HME A;  4XUA A;  5FE1 A;  4PS5 A;  2YQD A;  4YYN A;  5ENC A;  4WHU A;  4KV1 A;  4YAX A;  4PCI A;  5HEL A;  4A9F A;  5ENF A;  3LQJ A;  5E9K A;  5ENE A;  4YYM A;  4Z93 A;  5FH8 A;  4UYG A;  4NR4 A;  5E9M A;  5C87 A;  5I7Y A;  5ENJ A;  5CGP A;  1N72 A;  4IOO A;  5DW1 A;  5IGK A;  3U5K A;  5I83 A;  4HXO A;  3G0L A;  4GPJ A;  5DKH A;  5LKU A;  5F62 A;  4KV4 A;  4O7E A;  4QC3 A;  5FB1 A;  5EGU A;  2DVV A;  4NYW A;  2NXB A;  5E9L A;  5EV9 A;  5A81 A;  3S91 A;  4A9O A;  2E3K A;  5EWC A;  2E7O A;  2OUO A;  5E3D A;  5I80 A;  5EK9 A;  2MJV B;  5I40 A;  2F6J A;  4A9M A;  5KU3 A;  5CRM A;  5I1Q A;  5LKX A;  4A9E A;  4HBV A;  3UVY A;  3DAI A;  4QR5 A;  5A82 A;  2R10 A;  5HRX A;  3UV4 A;  4C67 A;  2OSS A;  5DKD A;  5CQ6 A;  4NR7 A;  4NUD A;  5BT3 A;  4YY4 A;  2L5E A;  4OGJ A;  5DYU A;  5FG5 A;  4LYI A;  3HMF A;  5CUC A;  5CFW A;  4Q0O A;  3DWY A;  5A5R A;  5DLZ A;  1WUM A;  4O7C A;  4MR3 A;  2R0S A;  4QST A;  5JI8 A;  5EQ1 A;  5JWM A;  5EM3 A;  1WUG A;  4HBW A;  3NXB A;  5AD2 A;  5FFW A;  4HXN A;  5CTL A;  3Q2F A;  3IU5 A;  2R0Y A;  5FFV A;  4TT4 A;  4HBX A;  5ETD A;  5TB6 A;  5FE8 A;  5KHM A;  5LJ1 A;  4UIX A;  5D3S A;  4IR5 A;  5ENG A;  5K29 A;  4UIU A;  4N4I A;  5CUE A;  5KTW A;  4PY6 A;  4LZS A;  5D3J A;  2LSP B;  4O74 A;  5DY7 A;  2R0V A;  4YBM A;  4QEW A;  4YYJ A;  3U5M A;  5COI A;  5HM0 A;  4KCX A;  5E7D A;  3LXJ A;  5FH7 A;  3QZT A;  5E3G A;  4QNS A;  4MEO A;  2DAT A;  5CQT A;  4HXS A;  5C85 A;  5E0R A;  4LRG A;  4YYG A;  5IGM A;  4Z1Q A;  5C4Q A;  4QEV A;  5DFB A;  4QSP A;  4YY6 A;  1X0J A;  4A9J A;  5I89 A;  2DWW A;  5G4R A;  5H1T A;  4XY8 A;  4Y03 A;  5F25 A;  5KTU A;  2I8N A;  2RS9 B;  2L85 A;  5F36 A;  5E9V A;  4QC1 A;  5CUA A;  5D3L A;  3FKM X;  5H85 A;  5EU1 A;  4YYI A;  4BW1 A;  2D9E A;  4J0S A;  2I7K A;  4MR5 A;  4OUF A;  4O7B A;  4HXL A;  3G0J A;  4O7A A;  4A9N A;  4NXJ A;  3O35 A;  4TYL A;  3SVF A;  2E7N A;  5ENB A;  4J3I A;  4TU6 A;  4QBM A;  5H1U A;  4LYS A;  4QY4 A;  5F1L A;  5CQ3 A;  3P1C A;  4YAT A;  5LUU A;  3P1F A;  5IGN A;  5A7C A;  5EIC A;  4HXR A;  3D7C A;  4AKN A;  5ACY A;  4MR6 A;  4NR8 A;  5A85 A;  3Q2E A;  5D3T A;  1JM4 B;  4YYD A;  1F68 A;  3UV5 A;  5EI4 A;  4BW2 A;  5IBN A;  3JVM A;  3O34 A;  5L8U A;  5D24 A;  3MUL A;  5C7N A;  4QB3 A;  2L84 A;  5CQ4 A;  3MUK A;  5A5O A;  4TT2 A;  4YBS A;  3HMH A;  3UV2 A;  4N4G A;  5I86 A;  4TU4 A;  4NYX A;  5DKC A;  1E6I A;  3P1E A;  4FLP A;  4YK0 A;  5CY9 A;  3U5O A;  4YYK A;  4O7F A;  4UIZ A;  5FH6 A;  5F2P A;  4QSS A;  5EPS A;  4CFL A;  5EP7 A;  3TLP A;  5KO4 A;  5CP5 A;  3UW9 A;  5DYX A;  2YEM A;  4N4F A;  5L8T A;  2RFJ A;  5FFY A;  1JSP B;  3SVH A;  4LDF A;  2WP2 A;  2DVR A;  4LZ2 A;  4IR3 A;  3JVL A;  4NUC A;  5CS8 A;  4TQN A;  4HXM A;  5D3N A;  5EPB A;  5HEN A;  5IGL A;  4ALG A;  3P1D A;  4LZR A;  5E73 A;  5A5S A;  2OO1 A;  5F5Z A;  2GRC A;  4CUU A;  4TZ2 A;  5EWV A;  4QZS A;  5BT4 A;  4PKL A;  4Z6I A;  3AQA A;  3LQI A;  4YAD A;  5FBX A;  4Q0N A;  5CUG A;  5DFC A;  4DON A;  5FE0 A;  3MB4 A;  4Z1S A;  4TS8 A;  4NQM A;  3O36 A;  4QR4 A;  4NR6 A;  5HEM A;  5D0C A;  4UYE A;  4O71 A;  2RI7 A;  4O78 A;  4YBT A;  5FE6 A;  3MQM A;  5FE5 A;  4ALH A;  4MEN A;  5EA1 A;  5IID A;  2G4A A;  5BT5 A;  2RNY A;  2YYN A;  5F1H A;  2YEK A;  4UYH A;  4UIT A;  1ZS5 A;  3UVX A;  5D3P A;  5D26 A;  5CUB A;  5DX4 A;  5TCM A;  5CPE A;  5L97 A;  5CQA A;  5HRV A;  4QYD A;  4CUQ A;  4IOR A;  5DW2 A;  4O77 A;  5AMF A;  4NRC A;  5CZG A;  4E96 A;  5C89 A;  4HXP A;  4N3W A;  4NRB A;  4YH4 A;  5LKT A;  5LVR A;  4QSR A;  5ETB A;  5FDZ A;  4Z6H A;  3JVK A;  4ZC9 A;  4ZW1 A;  4YH3 A;  4PCE A;  4WIV A;  3SVG A;  5CUD A;  5CQ5 A;  5CQ7 A;  2WP1 A;  4IR4 A;  5E9Y A;  2KTB B;  2F6N A;  5FE3 A;  4LC2 A;  5HJC A;  4PTB A;  5I88 A;  5HQ6 A;  5A5P A;  2DKW A;  5FE2 A;  4OGI A;  3U5L A;  4J0R A;  4CUR A;  3IU6 A;  2RO1 A;  4XY9 A;  4QSQ A;  4CUT A;  5HCL A;  4UIW A;  4A9I A;  5EWH A;  3U5J A;  4QEU A;  4O75 A;  5FE9 A;  5A83 A;  4TZ8 A;  3K2J A;  4O76 A;  4X2I A;  5AD3 A;  2DVS A;  5KTX A;  2RNW A;  2YDW A;  2D82 A;  5LKZ A;  5G4S A;  5F61 A;  3O33 A;  4ZQL A;  3MB3 A;  4HBY A;  4WHW A;  4LR6 A;  4BJX A;  5L99 A;  5II1 A;  3U5P A;  4BW4 A;  4TT6 A;  4UIY A;  4IR6 A;  4YC9 A;  5E9I A;  3LQH A;  4J1P A;  3QZV A;  5HQ5 A;  2N9G A;  5F60 A;  5HFQ A;  5HRW A;  4QUU A;  1EQF A;  3UVW A;  4A9K A;  5LJ2 A;  5FB0 A;  4UYD A;  4UYF A;  3U5N A;  5EWD A;  4N4H A;  5LVQ A;  3I3J A;  5F3A A;  4CUS A;  4NR5 A;  4NUE A;  4A9L A;  5CU8 A;  2DVQ A;  3P5O A;  4C66 A;  5D25 A;  3LJW A;  3RCW A;  5FE7 A;  2H60 A;  5DFD A;  5DYC A;  4CL9 A;  2YEL A;  5HLS A;  4O72 A;  4F3I A;  4HXK A;  5IG6 A;  3MXF A;  4QYL A;  5EVA A;  5DLX A;  2RNX A;  5CRZ A;  5D3H A;  5HFR A;  2YW5 A;  5J0D A;  5D7X A;  4QSX A;  5HQ7 A;  3ONI A;  4QUT A;  4MEQ A;  5D3R A;  4CLB A;  5F63 A;  5E74 A;  4QSV A;  4NRA A;  5C8G A;  4QSW A;  5CQ8 A;  3ZYU A;  5FE4 A;  4YAB A;  5ENH A;  5DYA A;  4UYF B;  5DBM A;  4BW3 A;  4TTE A;  4LYW A;  4UIV A;  4CUP A;  5A5Q A;  4MR4 A;  5LJ0 A;  3O37 A;  4QR3 A;  5FG4 A;  5ENI A;  3UVD A;  5I7X A;  4NS5 A;  4RVR A;  5I29 A;  4QSU A;  5II2 A;  5A5N A;  4CFK A;  5FG6 A;  4XUB A;  2FSA A;  5L96 A;  3QZS A;  4NR9 A;  5EWW A;  3S92 A;  5EPR A;  4NYV A;  5L98 A;  3JVJ A;  5H1V A;  4NQN A;  4IOQ A; 
#chains in the Genus database with same CATH topology
 3GG3 A;  4XYA A;  4BHW A;  4A9H A;  4MEP A;  5EIS A;  3AAD A;  4O70 A;  5AME A;  4YYH A;  3HME A;  4XUA A;  5FE1 A;  4PS5 A;  2YQD A;  4YYN A;  5ENC A;  4WHU A;  4KV1 A;  4YAX A;  4PCI A;  5HEL A;  4A9F A;  5ENF A;  3LQJ A;  5E9K A;  5ENE A;  4YYM A;  4Z93 A;  5FH8 A;  4UYG A;  4NR4 A;  5E9M A;  5C87 A;  5I7Y A;  5ENJ A;  5CGP A;  1N72 A;  4IOO A;  5DW1 A;  5IGK A;  3U5K A;  5I83 A;  4HXO A;  3G0L A;  4GPJ A;  5DKH A;  5LKU A;  5F62 A;  4KV4 A;  4O7E A;  4QC3 A;  5FB1 A;  5EGU A;  2DVV A;  4NYW A;  2NXB A;  5E9L A;  5EV9 A;  5A81 A;  3S91 A;  4A9O A;  2E3K A;  5EWC A;  2E7O A;  2OUO A;  5E3D A;  5I80 A;  5EK9 A;  2MJV B;  5I40 A;  2F6J A;  4A9M A;  5KU3 A;  5CRM A;  5I1Q A;  5LKX A;  4A9E A;  4HBV A;  3UVY A;  3DAI A;  4QR5 A;  5A82 A;  2R10 A;  5HRX A;  3UV4 A;  4AKH A;  4C67 A;  2OSS A;  5DKD A;  5CQ6 A;  4NR7 A;  4NUD A;  5BT3 A;  4YY4 A;  2L5E A;  4OGJ A;  5DYU A;  5FG5 A;  4LYI A;  3HMF A;  5CUC A;  5CFW A;  4Q0O A;  3DWY A;  5A5R A;  5DLZ A;  1WUM A;  4O7C A;  4MR3 A;  2R0S A;  4QST A;  5JI8 A;  5EQ1 A;  5JWM A;  5EM3 A;  1WUG A;  4HBW A;  3NXB A;  5AD2 A;  5FFW A;  4HXN A;  5CTL A;  3Q2F A;  3IU5 A;  2R0Y A;  5FFV A;  4TT4 A;  4HBX A;  5ETD A;  5TB6 A;  5FE8 A;  5KHM A;  5LJ1 A;  4UIX A;  5D3S A;  4IR5 A;  5ENG A;  5K29 A;  4UIU A;  4N4I A;  5CUE A;  5KTW A;  4PY6 A;  4LZS A;  5D3J A;  2LSP B;  4O74 A;  5DY7 A;  2R0V A;  4YBM A;  4QEW A;  4YYJ A;  3U5M A;  5COI A;  5HM0 A;  4KCX A;  5E7D A;  3LXJ A;  5FH7 A;  3QZT A;  1PUO A;  5E3G A;  4QNS A;  4MEO A;  2DAT A;  5CQT A;  4HXS A;  5C85 A;  5E0R A;  4LRG A;  4YYG A;  5IGM A;  4Z1Q A;  5C4Q A;  4QEV A;  5DFB A;  4QSP A;  4YY6 A;  1X0J A;  4A9J A;  5I89 A;  2DWW A;  5G4R A;  5H1T A;  4XY8 A;  4Y03 A;  2EJN A;  5F25 A;  5KTU A;  2I8N A;  2RS9 B;  2L85 A;  5F36 A;  5E9V A;  4QC1 A;  5CUA A;  5D3L A;  3FKM X;  5H85 A;  5EU1 A;  4YYI A;  4BW1 A;  2D9E A;  4J0S A;  2I7K A;  4MR5 A;  4OUF A;  4O7B A;  4HXL A;  3G0J A;  4O7A A;  4A9N A;  4NXJ A;  3O35 A;  4TYL A;  3SVF A;  2E7N A;  5ENB A;  4J3I A;  4TU6 A;  4QBM A;  5H1U A;  4LYS A;  4QY4 A;  5F1L A;  3ERR A;  3P1C A;  5CQ3 A;  4YAT A;  5LUU A;  3P1F A;  5IGN A;  5A7C A;  5EIC A;  4HXR A;  3D7C A;  4AKN A;  5ACY A;  4MR6 A;  4NR8 A;  5A85 A;  3Q2E A;  5D3T A;  1JM4 B;  4YYD A;  1F68 A;  3UV5 A;  5EI4 A;  4BW2 A;  5IBN A;  3JVM A;  3O34 A;  5L8U A;  5D24 A;  3MUL A;  5C7N A;  4QB3 A;  2L84 A;  5CQ4 A;  3MUK A;  5A5O A;  4TT2 A;  4YBS A;  3HMH A;  3UV2 A;  4N4G A;  5I86 A;  4TU4 A;  4NYX A;  5DKC A;  1E6I A;  3P1E A;  4FLP A;  4YK0 A;  5CY9 A;  3U5O A;  4YYK A;  4O7F A;  4UIZ A;  5FH6 A;  5F2P A;  4QSS A;  5EPS A;  4CFL A;  5EP7 A;  3TLP A;  5KO4 A;  5CP5 A;  3VKH A;  3UW9 A;  5DYX A;  2YEM A;  4N4F A;  5L8T A;  2RFJ A;  5FFY A;  1JSP B;  3SVH A;  4LDF A;  2WP2 A;  2DVR A;  4LZ2 A;  4IR3 A;  3JVL A;  4NUC A;  5CS8 A;  4TQN A;  4HXM A;  5D3N A;  5EPB A;  5HEN A;  5IGL A;  4ALG A;  3P1D A;  4LZR A;  5E73 A;  5A5S A;  2OO1 A;  5F5Z A;  2GRC A;  4CUU A;  4TZ2 A;  5EWV A;  4QZS A;  5BT4 A;  4PKL A;  4Z6I A;  3AQA A;  3LQI A;  4YAD A;  5FBX A;  4Q0N A;  5CUG A;  5DFC A;  4DON A;  5FE0 A;  3MB4 A;  4Z1S A;  4TS8 A;  4NQM A;  3O36 A;  4QR4 A;  4NR6 A;  5HEM A;  5D0C A;  4UYE A;  4O71 A;  2RI7 A;  4O78 A;  4YBT A;  5FE6 A;  3MQM A;  5FE5 A;  4ALH A;  4MEN A;  5EA1 A;  5IID A;  2G4A A;  5BT5 A;  2RNY A;  2YYN A;  5F1H A;  2YEK A;  4UYH A;  4UIT A;  1ZS5 A;  3UVX A;  5D3P A;  5D26 A;  5CUB A;  5DX4 A;  5TCM A;  5CPE A;  5L97 A;  5CQA A;  5HRV A;  4QYD A;  4CUQ A;  4IOR A;  5DW2 A;  4O77 A;  5AMF A;  4NRC A;  5CZG A;  4E96 A;  5C89 A;  4HXP A;  4N3W A;  4NRB A;  4YH4 A;  5LKT A;  5LVR A;  4QSR A;  5ETB A;  5FDZ A;  4Z6H A;  3JVK A;  4ZC9 A;  4ZW1 A;  4YH3 A;  4PCE A;  4WIV A;  3SVG A;  5CUD A;  5CQ5 A;  5CQ7 A;  2WP1 A;  4IR4 A;  5E9Y A;  2KTB B;  2F6N A;  5FE3 A;  4LC2 A;  4AI6 A;  5HJC A;  4PTB A;  5I88 A;  5HQ6 A;  5A5P A;  3VKG A;  2DKW A;  5FE2 A;  4OGI A;  3U5L A;  4J0R A;  4CUR A;  3IU6 A;  2RO1 A;  4XY9 A;  4QSQ A;  4CUT A;  5HCL A;  4UIW A;  4A9I A;  5EWH A;  3U5J A;  4QEU A;  4O75 A;  5FE9 A;  5A83 A;  4TZ8 A;  3K2J A;  4O76 A;  4X2I A;  5AD3 A;  2DVS A;  5KTX A;  2RNW A;  2YDW A;  2D82 A;  3D1D A;  5G4S A;  5LKZ A;  5F61 A;  3O33 A;  4ZQL A;  3MB3 A;  4HBY A;  4WHW A;  4LR6 A;  4BJX A;  5L99 A;  1ZKR A;  5II1 A;  3U5P A;  4BW4 A;  4TT6 A;  4UIY A;  4IR6 A;  4YC9 A;  5E9I A;  3LQH A;  4J1P A;  3QZV A;  5HQ5 A;  2N9G A;  4AKG A;  5F60 A;  3D1B A;  5HFQ A;  5HRW A;  4QUU A;  1EQF A;  3UVW A;  4A9K A;  5LJ2 A;  5FB0 A;  4UYD A;  4UYF A;  3U5N A;  5EWD A;  4N4H A;  5LVQ A;  3I3J A;  5F3A A;  4CUS A;  4NR5 A;  4NUE A;  4A9L A;  5CU8 A;  2DVQ A;  3P5O A;  4C66 A;  5D25 A;  3LJW A;  3RCW A;  5FE7 A;  2H60 A;  5DFD A;  5DYC A;  4CL9 A;  2YEL A;  5HLS A;  4O72 A;  4F3I A;  4HXK A;  5IG6 A;  3MXF A;  4QYL A;  5EVA A;  5DLX A;  2RNX A;  5CRZ A;  5D3H A;  5HFR A;  2YW5 A;  5J0D A;  5D7X A;  4AKI A;  4QSX A;  5HQ7 A;  3ONI A;  4QUT A;  4MEQ A;  5D3R A;  4CLB A;  5F63 A;  5E74 A;  4QSV A;  4NRA A;  5C8G A;  4QSW A;  5CQ8 A;  3ZYU A;  5FE4 A;  4YAB A;  5ENH A;  5DYA A;  4UYF B;  5DBM A;  4BW3 A;  4TTE A;  4LYW A;  4UIV A;  4CUP A;  5A5Q A;  4MR4 A;  5LJ0 A;  3O37 A;  4QR3 A;  5FG4 A;  5ENI A;  3UVD A;  5I7X A;  4NS5 A;  4RVR A;  5I29 A;  4QSU A;  5II2 A;  5A5N A;  4CFK A;  5FG6 A;  4XUB A;  2FSA A;  5L96 A;  3QZS A;  4NR9 A;  5EWW A;  3S92 A;  5EPR A;  4NYV A;  5L98 A;  3JVJ A;  5H1V A;  4NQN A;  4IOQ A; 
#chains in the Genus database with same CATH homology
 3GG3 A;  4XYA A;  4BHW A;  4A9H A;  4MEP A;  5EIS A;  3AAD A;  4O70 A;  5AME A;  4YYH A;  3HME A;  4XUA A;  5FE1 A;  4PS5 A;  2YQD A;  4YYN A;  5ENC A;  4WHU A;  4KV1 A;  4YAX A;  4PCI A;  5HEL A;  4A9F A;  5ENF A;  3LQJ A;  5E9K A;  5ENE A;  4YYM A;  4Z93 A;  5FH8 A;  4UYG A;  4NR4 A;  5E9M A;  5C87 A;  5I7Y A;  5ENJ A;  5CGP A;  1N72 A;  4IOO A;  5DW1 A;  5IGK A;  3U5K A;  5I83 A;  4HXO A;  3G0L A;  4GPJ A;  5DKH A;  5LKU A;  5F62 A;  4KV4 A;  4O7E A;  4QC3 A;  5FB1 A;  5EGU A;  2DVV A;  4NYW A;  2NXB A;  5E9L A;  5EV9 A;  5A81 A;  3S91 A;  4A9O A;  2E3K A;  5EWC A;  2E7O A;  2OUO A;  5E3D A;  5I80 A;  5EK9 A;  2MJV B;  5I40 A;  2F6J A;  4A9M A;  5KU3 A;  5CRM A;  5I1Q A;  5LKX A;  4A9E A;  4HBV A;  3UVY A;  3DAI A;  4QR5 A;  5A82 A;  2R10 A;  5HRX A;  3UV4 A;  4C67 A;  2OSS A;  5DKD A;  5CQ6 A;  4NR7 A;  4NUD A;  5BT3 A;  4YY4 A;  2L5E A;  4OGJ A;  5DYU A;  5FG5 A;  4LYI A;  3HMF A;  5CUC A;  5CFW A;  4Q0O A;  3DWY A;  5A5R A;  5DLZ A;  1WUM A;  4O7C A;  4MR3 A;  2R0S A;  4QST A;  5JI8 A;  5EQ1 A;  5JWM A;  5EM3 A;  1WUG A;  4HBW A;  3NXB A;  5AD2 A;  5FFW A;  4HXN A;  5CTL A;  3Q2F A;  3IU5 A;  2R0Y A;  5FFV A;  4TT4 A;  4HBX A;  5ETD A;  5TB6 A;  5FE8 A;  5KHM A;  5LJ1 A;  4UIX A;  5D3S A;  4IR5 A;  5ENG A;  5K29 A;  4UIU A;  4N4I A;  5CUE A;  5KTW A;  4PY6 A;  4LZS A;  5D3J A;  2LSP B;  4O74 A;  5DY7 A;  2R0V A;  4YBM A;  4QEW A;  4YYJ A;  3U5M A;  5COI A;  5HM0 A;  4KCX A;  5E7D A;  3LXJ A;  5FH7 A;  3QZT A;  5E3G A;  4QNS A;  4MEO A;  2DAT A;  5CQT A;  4HXS A;  5C85 A;  5E0R A;  4LRG A;  4YYG A;  5IGM A;  4Z1Q A;  5C4Q A;  4QEV A;  5DFB A;  4QSP A;  4YY6 A;  1X0J A;  4A9J A;  5I89 A;  2DWW A;  5G4R A;  5H1T A;  4XY8 A;  4Y03 A;  5F25 A;  5KTU A;  2I8N A;  2RS9 B;  2L85 A;  5F36 A;  5E9V A;  4QC1 A;  5CUA A;  5D3L A;  3FKM X;  5H85 A;  5EU1 A;  4YYI A;  4BW1 A;  2D9E A;  4J0S A;  2I7K A;  4MR5 A;  4OUF A;  4O7B A;  4HXL A;  3G0J A;  4O7A A;  4A9N A;  4NXJ A;  3O35 A;  4TYL A;  3SVF A;  2E7N A;  5ENB A;  4J3I A;  4TU6 A;  4QBM A;  5H1U A;  4LYS A;  4QY4 A;  5F1L A;  5CQ3 A;  3P1C A;  4YAT A;  5LUU A;  3P1F A;  5IGN A;  5A7C A;  5EIC A;  4HXR A;  3D7C A;  4AKN A;  5ACY A;  4MR6 A;  4NR8 A;  5A85 A;  3Q2E A;  5D3T A;  1JM4 B;  4YYD A;  1F68 A;  3UV5 A;  5EI4 A;  4BW2 A;  5IBN A;  3JVM A;  3O34 A;  5L8U A;  5D24 A;  3MUL A;  5C7N A;  4QB3 A;  2L84 A;  5CQ4 A;  3MUK A;  5A5O A;  4TT2 A;  4YBS A;  3HMH A;  3UV2 A;  4N4G A;  5I86 A;  4TU4 A;  4NYX A;  5DKC A;  1E6I A;  3P1E A;  4FLP A;  4YK0 A;  5CY9 A;  3U5O A;  4YYK A;  4O7F A;  4UIZ A;  5FH6 A;  5F2P A;  4QSS A;  5EPS A;  4CFL A;  5EP7 A;  3TLP A;  5KO4 A;  5CP5 A;  3UW9 A;  5DYX A;  2YEM A;  4N4F A;  5L8T A;  2RFJ A;  5FFY A;  1JSP B;  3SVH A;  4LDF A;  2WP2 A;  2DVR A;  4LZ2 A;  4IR3 A;  3JVL A;  4NUC A;  5CS8 A;  4TQN A;  4HXM A;  5D3N A;  5EPB A;  5HEN A;  5IGL A;  4ALG A;  3P1D A;  4LZR A;  5E73 A;  5A5S A;  2OO1 A;  5F5Z A;  2GRC A;  4CUU A;  4TZ2 A;  5EWV A;  4QZS A;  5BT4 A;  4PKL A;  4Z6I A;  3AQA A;  3LQI A;  4YAD A;  5FBX A;  4Q0N A;  5CUG A;  5DFC A;  4DON A;  5FE0 A;  3MB4 A;  4Z1S A;  4TS8 A;  4NQM A;  3O36 A;  4QR4 A;  4NR6 A;  5HEM A;  5D0C A;  4UYE A;  4O71 A;  2RI7 A;  4O78 A;  4YBT A;  5FE6 A;  3MQM A;  5FE5 A;  4ALH A;  4MEN A;  5EA1 A;  5IID A;  2G4A A;  5BT5 A;  2RNY A;  2YYN A;  5F1H A;  2YEK A;  4UYH A;  4UIT A;  1ZS5 A;  3UVX A;  5D3P A;  5D26 A;  5CUB A;  5DX4 A;  5TCM A;  5CPE A;  5L97 A;  5CQA A;  5HRV A;  4QYD A;  4CUQ A;  4IOR A;  5DW2 A;  4O77 A;  5AMF A;  4NRC A;  5CZG A;  4E96 A;  5C89 A;  4HXP A;  4N3W A;  4NRB A;  4YH4 A;  5LKT A;  5LVR A;  4QSR A;  5ETB A;  5FDZ A;  4Z6H A;  3JVK A;  4ZC9 A;  4ZW1 A;  4YH3 A;  4PCE A;  4WIV A;  3SVG A;  5CUD A;  5CQ5 A;  5CQ7 A;  2WP1 A;  4IR4 A;  5E9Y A;  2KTB B;  2F6N A;  5FE3 A;  4LC2 A;  5HJC A;  4PTB A;  5I88 A;  5HQ6 A;  5A5P A;  2DKW A;  5FE2 A;  4OGI A;  3U5L A;  4J0R A;  4CUR A;  3IU6 A;  2RO1 A;  4XY9 A;  4QSQ A;  4CUT A;  5HCL A;  4UIW A;  4A9I A;  5EWH A;  3U5J A;  4QEU A;  4O75 A;  5FE9 A;  5A83 A;  4TZ8 A;  3K2J A;  4O76 A;  4X2I A;  5AD3 A;  2DVS A;  5KTX A;  2RNW A;  2YDW A;  2D82 A;  5LKZ A;  5G4S A;  5F61 A;  3O33 A;  4ZQL A;  3MB3 A;  4HBY A;  4WHW A;  4LR6 A;  4BJX A;  5L99 A;  5II1 A;  3U5P A;  4BW4 A;  4TT6 A;  4UIY A;  4IR6 A;  4YC9 A;  5E9I A;  3LQH A;  4J1P A;  3QZV A;  5HQ5 A;  2N9G A;  5F60 A;  5HFQ A;  5HRW A;  4QUU A;  1EQF A;  3UVW A;  4A9K A;  5LJ2 A;  5FB0 A;  4UYD A;  4UYF A;  3U5N A;  5EWD A;  4N4H A;  5LVQ A;  3I3J A;  5F3A A;  4CUS A;  4NR5 A;  4NUE A;  4A9L A;  5CU8 A;  2DVQ A;  3P5O A;  4C66 A;  5D25 A;  3LJW A;  3RCW A;  5FE7 A;  2H60 A;  5DFD A;  5DYC A;  4CL9 A;  2YEL A;  5HLS A;  4O72 A;  4F3I A;  4HXK A;  5IG6 A;  3MXF A;  4QYL A;  5EVA A;  5DLX A;  2RNX A;  5CRZ A;  5D3H A;  5HFR A;  2YW5 A;  5J0D A;  5D7X A;  4QSX A;  5HQ7 A;  3ONI A;  4QUT A;  4MEQ A;  5D3R A;  4CLB A;  5F63 A;  5E74 A;  4QSV A;  4NRA A;  5C8G A;  4QSW A;  5CQ8 A;  3ZYU A;  5FE4 A;  4YAB A;  5ENH A;  5DYA A;  4UYF B;  5DBM A;  4BW3 A;  4TTE A;  4LYW A;  4UIV A;  4CUP A;  5A5Q A;  4MR4 A;  5LJ0 A;  3O37 A;  4QR3 A;  5FG4 A;  5ENI A;  3UVD A;  5I7X A;  4NS5 A;  4RVR A;  5I29 A;  4QSU A;  5II2 A;  5A5N A;  4CFK A;  5FG6 A;  4XUB A;  2FSA A;  5L96 A;  3QZS A;  4NR9 A;  5EWW A;  3S92 A;  5EPR A;  4NYV A;  5L98 A;  3JVJ A;  5H1V A;  4NQN A;  4IOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...