5FE3A

Crystal structure of human pcaf bromodomain in complex with fragment mb360 (fragment 4)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
109
structure length
109
Chain Sequence
RDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Histone acetyltransferase KAT2B
publication title Structure-Based Identification of Inhibitory Fragments Targeting the p300/CBP-Associated Factor Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fe3A00
2E7NA 5EWWA 5L8TA 5DKHA 4Z6HA 5DFBA 4QUTA 4O75A 4CLBA 3U5NA 4A9MA 4MR4A 4LYSA 4XYAA 4YYIA 3MUKA 5LJ1A 4NUCA 4N4FA 3HMEA 2H60A 5A82A 2MJVB 5L99A 2RNWA 3Q2EA 2RS9B 3P1FA 5CFWA 5F36A 5DYUA 5D3SA 4IOOA 5CQ3A 3DWYA 3ZYUA 3QZSA 5A5SA 5ENCA 4QEWA 5KTWA 5HENA 3IU5A 5CQ4A 2R0YA 3ONIA 4FLPA 4YH4A 4MR3A 3SVGA 4AKNA 4Q0NA 5I29A 3GG3A 4N4IA 4YK0A 5E7DA 4TYLA 4YAXA 4IR4A 5TCMA 4A9JA 5HQ5A 4A9KA 5LUUA 3UV2A 5A83A 3HMHA 5ENIA 5CU8A 4A9FA 3U5PA 2RNYA 3UVDA 5I89A 5LVQA 4O7BA 4YH3A 5I1QA 4BHWA 5L8UA 4UIWA 5FE9A 2YW5A 5L97A 5I80A 4TS8A 5ENGA 4YYJA 5HRXA 4QEUA 5AMFA 2OSSA 2YEMA 5ENJA 5FG4A 2F6NA 4YC9A 3UV5A 2KTBB 5CS8A 5D3PA 3SVFA 5ENBA 3IU6A 1JM4B 5I88A 4NR6A 4NR8A 5CZGA 4UYGA 5A5RA 5A81A 4J0RA 5L96A 5JI8A 4O76A 5IBNA 5D3HA 5IGNA 2DVQA 5CUDA 5HCLA 5CPEA 4GPJA 5D3RA 4C66A 4MR6A 5LJ0A 4A9LA 4WIVA 4YBMA 4OGIA 5EPSA 5HM0A 5F25A 5AD3A 4PS5A 4UITA 5DX4A 5FB1A 4N4GA 4QSSA 2DVSA 4HBXA 5D3JA 4O7EA 2YYNA 3O36A 3LQHA 5FDZA 4RVRA 3JVLA 3O34A 4XY9A 5IG6A 5H1VA 5LKZA 5D0CA 5CUBA 3JVKA 3P1CA 5HEMA 5IIDA 5E74A 5HRVA 4BW3A 4NQMA 4PKLA 5ENEA 4XUAA 4XY8A 5II2A 5DLXA 4BW2A 4WHUA 3UVYA 4YY6A 5IGMA 4CUTA 4O7CA 4PCEA 5C8GA 4QSXA 4C67A 4A9HA 5FG5A 4DONA 4TT2A 4E96A 4O78A 2YELA 4UIXA 4NUDA 5EQ1A 5A5NA 5FE1A 5E9LA 4ZW1A 4NYXA 4IORA 3Q2FA 4KV1A 4YBSA 5BT5A 5KTUA 4QEVA 5K29A 5F1LA 3LQJA 4CUQA 5J0DA 3MB3A 5ETBA 5A5OA 5H1TA 5CQ5A 2NXBA 2I7KA 5EPBA 5CRZA 4MEOA 4A9IA 3P5OA 5EM3A 5EGUA 4TU4A 2DVVA 5FBXA 4QSQA 5F1HA 5AMEA 5A85A 4QUUA 5FE2A 2G4AA 5LKXA 4HXLA 4TZ2A 3G0LA 1F68A 2DWWA 4HBWA 4HBYA 5TB6A 2LSPB 5E9KA 3D7CA 5FH6A 4QYDA 5HQ7A 4UIUA 4MEQA 3DAIA 3SVHA 4O7AA 5DYCA 4ALGA 5CQTA 2E3KA 5EK9A 5II1A 4YADA 4PY6A 4QR3A 4MEPA 5F3AA 5G4RA 3MQMA 4YBTA 2L84A 4LYWA 4NRAA 4NRBA 5A5QA 3TLPA 3U5MA 2YQDA 3O33A 5FE5A 3JVJA 5D3NA 5I40A 3LQIA 5CQ7A 4HXRA 3UVWA 5ENHA 5DKCA 4NR9A 3U5LA 4O71A 5D24A 5E9MA 5H1UA 4A9EA 5C89A 5DYXA 4J3IA 1X0JA 4XUBA 5COIA 2GRCA 4HXSA 3MULA 4CUSA 4N3WA 5A7CA 4TT6A 5D25A 4BJXA 2RFJA 3NXBA 5LVRA 3RCWA 4UIZA 5CUGA 5ETDA 5I7XA 4TU6A 3U5OA 4LR6A 5F60A 5DFDA 5EP7A 3JVMA 3LJWA 3P1DA 5D7XA 4HXKA 4YYMA 4NR5A 1WUGA 5CRMA 5CQAA 5DYAA 5HFRA 4LZ2A 5C7NA 5FE8A 4TZ8A 5I83A 4IR3A 3S92A 5DW1A 2L85A 4UYHA 4YYHA 3S91A 5DY7A 2DKWA 4UYFA 4QSPA 4Z1QA 4QC1A 5CQ6A 4NUEA 5G4SA 5JWMA 2N9GA 4O74A 4IOQA 5CP5A 3O37A 5CUEA 2FSAA 5KTXA 5FE0A 2D9EA 5LKTA 4OUFA 4QR4A 4N4HA 2RI7A 4NS5A 5CQ8A 4Q0OA 4Z6IA 5DFCA 3AADA 5FH8A 5I7YA 4O77A 5ENFA 4NR7A 3UW9A 4IR5A 3U5KA 5D3TA 2OUOA 4QSUA 3K2JA 4HXNA 4TT4A 5FFYA 3P1EA 5I86A 5HJCA 4QY4A 4A9OA 4CFKA 3MB4A 5KHMA 5FFWA 5ACYA 3MXFA 4F3IA 5EICA 4UIVA 5C85A 4ALHA 4ZC9A 4Z93A 4WHWA 2OO1A 5H85A 3LXJA 4HXMA 5D3LA 5IGLA 4UYFB 4UYEA 5CUAA 5C87A 5EWVA 5F2PA 4NQNA 4QC3A 5F63A 4ZQLA 5C4QA 5AD2A 4YYDA 4X2IA 4CL9A 5LJ2A 5HELA 2E7OA 2RNXA 4BW4A 4QSVA 4CUPA 2R0VA 4YATA 2F6JA 5FE7A 5FFVA 5EISA 4CUUA 4J0SA 4YYKA 5KU3A 4QBMA 5EA1A 5E73A 5E0RA 2DATA 4UYDA 5EWHA 5HFQA 2WP2A 2YDWA 4Y03A 5FG6A 4QSRA 4O70A 4Z1SA 5CY9A 4CFLA 4QSWA 4KCXA 5FE4A 1WUMA 5FB0A 4BW1A 5DW2A 5FE3A 5EPRA 3UVXA 5HRWA 3I3JA 4LZSA 5EWDA 4YABA 5FH7A 5HLSA 4HXOA 5A5PA 1N72A 4KV4A 5EWCA 4J1PA 3QZVA 5L98A 2D82A 1JSPB 4QR5A 4PCIA 5CTLA 5EU1A 4NRCA 4YYNA 4O7FA 4LC2A 5FE6A 3FKMX 5E9IA 1E6IA 5CUCA 1EQFA 4MENA 5DLZA 3AQAA 2YEKA 4HXPA 4QZSA 4NYWA 4LDFA 4YY4A 4QSTA 3HMFA 5KO4A 3QZTA 4QYLA 4QB3A 5EV9A 2I8NA 5DKDA 4A9NA 3UV4A 2R10A 4MR5A 5E3GA 4HBVA 5IGKA 4LZRA 4LRGA 4CURA 4NYVA 2WP1A 2DVRA 4O72A 3U5JA 2R0SA 5E9VA 5EVAA 4OGJA 4NXJA 5F62A 4QNSA 2L5EA 4TQNA 4IR6A 4UIYA 5BT4A 3O35A 4NR4A 5DBMA 5E3DA 5HQ6A 5EI4A 5BT3A 1ZS5A 5LKUA 5F5ZA 5F61A 5D26A 4PTBA 5E9YA 4LYIA 3G0JA 4TTEA 4YYGA 5CGPA 2RO1A
chains in the Genus database with same CATH superfamily
2E7NA 5EWWA 5L8TA 5DKHA 4Z6HA 5DFBA 4QUTA 4O75A 4CLBA 3U5NA 4A9MA 4MR4A 4LYSA 4XYAA 4YYIA 3MUKA 5LJ1A 3VKHA 4NUCA 4N4FA 3HMEA 2H60A 5A82A 2MJVB 5L99A 2RNWA 3Q2EA 2RS9B 3P1FA 5CFWA 5F36A 5DYUA 5D3SA 4IOOA 5CQ3A 3DWYA 3ZYUA 3QZSA 5A5SA 5ENCA 4QEWA 5KTWA 5HENA 3IU5A 5CQ4A 2R0YA 3ONIA 4FLPA 4YH4A 4MR3A 3SVGA 4AKNA 4Q0NA 5I29A 3GG3A 4N4IA 4YK0A 1PUOA 5E7DA 4TYLA 4YAXA 4IR4A 5TCMA 4A9JA 5HQ5A 4A9KA 5LUUA 3UV2A 5A83A 3HMHA 5ENIA 5CU8A 4A9FA 3U5PA 2RNYA 3UVDA 5I89A 5LVQA 4O7BA 4YH3A 5I1QA 4BHWA 5L8UA 4UIWA 5FE9A 2YW5A 5L97A 5I80A 4TS8A 5ENGA 4YYJA 5HRXA 4QEUA 5AMFA 2OSSA 2YEMA 5ENJA 5FG4A 2F6NA 4YC9A 3UV5A 2KTBB 5CS8A 5D3PA 3SVFA 5ENBA 3IU6A 1JM4B 5I88A 4NR6A 4NR8A 5CZGA 4UYGA 5A5RA 5A81A 4J0RA 5L96A 5JI8A 4O76A 5IBNA 5D3HA 5IGNA 2DVQA 5CUDA 5HCLA 5CPEA 4GPJA 5D3RA 4C66A 4MR6A 5LJ0A 4A9LA 4WIVA 4YBMA 4OGIA 5EPSA 5HM0A 5F25A 5AD3A 4PS5A 4UITA 5DX4A 5FB1A 4N4GA 4QSSA 2DVSA 4HBXA 5D3JA 4O7EA 2YYNA 3O36A 3LQHA 5FDZA 4RVRA 3JVLA 3O34A 4XY9A 5IG6A 5H1VA 5LKZA 5D0CA 5CUBA 3JVKA 3P1CA 5HEMA 5IIDA 5E74A 5HRVA 4BW3A 4NQMA 4PKLA 5ENEA 4XUAA 4XY8A 5II2A 5DLXA 4BW2A 4WHUA 3UVYA 4YY6A 5IGMA 4CUTA 4O7CA 4PCEA 5C8GA 4QSXA 4C67A 4A9HA 5FG5A 4DONA 4TT2A 4E96A 4AKIA 4O78A 2YELA 4UIXA 4NUDA 5EQ1A 5A5NA 5FE1A 5E9LA 4ZW1A 4NYXA 4IORA 3Q2FA 4KV1A 4YBSA 3ERRA 5BT5A 5KTUA 4QEVA 5K29A 5F1LA 3LQJA 4CUQA 5J0DA 3MB3A 5ETBA 5A5OA 3VKGA 5H1TA 5CQ5A 2NXBA 2I7KA 5EPBA 5CRZA 4MEOA 4A9IA 3P5OA 5EM3A 5EGUA 4TU4A 2DVVA 5FBXA 4QSQA 5F1HA 5AMEA 5A85A 4QUUA 5FE2A 2G4AA 5LKXA 4HXLA 4TZ2A 3G0LA 1F68A 2DWWA 4HBWA 4HBYA 5TB6A 2LSPB 5E9KA 3D7CA 5FH6A 4QYDA 5HQ7A 4UIUA 4MEQA 3DAIA 3SVHA 4O7AA 5DYCA 4ALGA 5CQTA 2E3KA 5EK9A 5II1A 4YADA 4PY6A 4QR3A 4MEPA 5F3AA 5G4RA 4AKHA 3MQMA 4YBTA 2L84A 4LYWA 4NRAA 4NRBA 5A5QA 3TLPA 3U5MA 2YQDA 3O33A 5FE5A 3JVJA 5D3NA 5I40A 3LQIA 5CQ7A 4HXRA 3UVWA 5ENHA 5DKCA 4NR9A 3U5LA 4O71A 5D24A 5E9MA 5H1UA 4A9EA 5C89A 5DYXA 4J3IA 1X0JA 4XUBA 5COIA 2GRCA 4HXSA 3MULA 4CUSA 4N3WA 5A7CA 4TT6A 5D25A 4BJXA 2RFJA 3NXBA 5LVRA 3RCWA 4UIZA 5CUGA 5ETDA 5I7XA 4TU6A 3U5OA 4LR6A 5F60A 5DFDA 5EP7A 3JVMA 3LJWA 3P1DA 5D7XA 4HXKA 4YYMA 4NR5A 1WUGA 5CRMA 5CQAA 5DYAA 5HFRA 4LZ2A 5C7NA 5FE8A 4TZ8A 5I83A 4IR3A 3S92A 5DW1A 2L85A 4UYHA 4YYHA 3S91A 5DY7A 2DKWA 4UYFA 4QSPA 4Z1QA 4QC1A 5CQ6A 4NUEA 5G4SA 5JWMA 2N9GA 4O74A 4IOQA 5CP5A 3O37A 5CUEA 2FSAA 5KTXA 5FE0A 2D9EA 5LKTA 4OUFA 4QR4A 4N4HA 2RI7A 4NS5A 5CQ8A 4Q0OA 4Z6IA 5DFCA 3AADA 5FH8A 5I7YA 4O77A 5ENFA 4NR7A 3UW9A 4IR5A 3U5KA 5D3TA 2OUOA 4QSUA 3K2JA 4HXNA 4TT4A 5FFYA 3P1EA 5I86A 5HJCA 4QY4A 4A9OA 4CFKA 3MB4A 5KHMA 5FFWA 5ACYA 3MXFA 4F3IA 5EICA 4UIVA 5C85A 4ALHA 4ZC9A 4Z93A 4WHWA 2OO1A 5H85A 3LXJA 4HXMA 5D3LA 5IGLA 4UYFB 4UYEA 5CUAA 5C87A 5EWVA 5F2PA 4NQNA 4QC3A 5F63A 4ZQLA 5C4QA 5AD2A 4YYDA 4X2IA 4CL9A 5LJ2A 5HELA 2E7OA 2RNXA 4AI6A 4BW4A 4QSVA 4CUPA 2R0VA 4YATA 2F6JA 5FE7A 5FFVA 5EISA 4CUUA 4J0SA 4YYKA 5KU3A 4QBMA 5EA1A 5E73A 5E0RA 2DATA 4UYDA 5EWHA 5HFQA 2WP2A 2YDWA 4Y03A 5FG6A 4QSRA 4O70A 4Z1SA 5CY9A 4CFLA 4QSWA 4KCXA 5FE4A 4AKGA 1WUMA 5FB0A 4BW1A 5DW2A 5FE3A 5EPRA 3UVXA 5HRWA 3I3JA 4LZSA 5EWDA 4YABA 5FH7A 5HLSA 4HXOA 5A5PA 1N72A 4KV4A 5EWCA 4J1PA 3QZVA 5L98A 2D82A 1JSPB 4QR5A 4PCIA 5CTLA 5EU1A 4NRCA 4YYNA 4O7FA 4LC2A 5FE6A 3FKMX 5E9IA 1E6IA 5CUCA 1EQFA 4MENA 5DLZA 3AQAA 2YEKA 4HXPA 4QZSA 4NYWA 4LDFA 4YY4A 3D1BA 4QSTA 3HMFA 5KO4A 3QZTA 4QYLA 4QB3A 5EV9A 2I8NA 5DKDA 4A9NA 3UV4A 2R10A 4MR5A 5E3GA 4HBVA 5IGKA 4LZRA 4LRGA 4CURA 4NYVA 2WP1A 2DVRA 4O72A 3U5JA 2R0SA 5E9VA 5EVAA 4OGJA 4NXJA 5F62A 4QNSA 2L5EA 4TQNA 1ZKRA 4IR6A 4UIYA 5BT4A 3O35A 4NR4A 5DBMA 5E3DA 5HQ6A 5EI4A 5BT3A 1ZS5A 5LKUA 2EJNA 5F5ZA 5F61A 5D26A 4PTBA 5E9YA 4LYIA 3G0JA 4TTEA 4YYGA 5CGPA 3D1DA 2RO1A
chains in the Genus database with same CATH topology
2E7NA 5EWWA 5L8TA 5DKHA 4Z6HA 5DFBA 4QUTA 4O75A 4CLBA 3U5NA 4A9MA 4MR4A 4LYSA 4XYAA 4YYIA 3MUKA 5LJ1A 4NUCA 4N4FA 3HMEA 2H60A 5A82A 2MJVB 5L99A 2RNWA 3Q2EA 2RS9B 3P1FA 5CFWA 5F36A 5DYUA 5D3SA 4IOOA 5CQ3A 3DWYA 3ZYUA 3QZSA 5A5SA 5ENCA 4QEWA 5KTWA 5HENA 3IU5A 5CQ4A 2R0YA 3ONIA 4FLPA 4YH4A 4MR3A 3SVGA 4AKNA 4Q0NA 5I29A 3GG3A 4N4IA 4YK0A 5E7DA 4TYLA 4YAXA 4IR4A 5TCMA 4A9JA 5HQ5A 4A9KA 5LUUA 3UV2A 5A83A 3HMHA 5ENIA 5CU8A 4A9FA 3U5PA 2RNYA 3UVDA 5I89A 5LVQA 4O7BA 4YH3A 5I1QA 4BHWA 5L8UA 4UIWA 5FE9A 2YW5A 5L97A 5I80A 4TS8A 5ENGA 4YYJA 5HRXA 4QEUA 5AMFA 2OSSA 2YEMA 5ENJA 5FG4A 2F6NA 4YC9A 3UV5A 2KTBB 5CS8A 5D3PA 3SVFA 5ENBA 3IU6A 1JM4B 5I88A 4NR6A 4NR8A 5CZGA 4UYGA 5A5RA 5A81A 4J0RA 5L96A 5JI8A 4O76A 5IBNA 5D3HA 5IGNA 2DVQA 5CUDA 5HCLA 5CPEA 4GPJA 5D3RA 4C66A 4MR6A 5LJ0A 4A9LA 4WIVA 4YBMA 4OGIA 5EPSA 5HM0A 5F25A 5AD3A 4PS5A 4UITA 5DX4A 5FB1A 4N4GA 4QSSA 2DVSA 4HBXA 5D3JA 4O7EA 2YYNA 3O36A 3LQHA 5FDZA 4RVRA 3JVLA 3O34A 4XY9A 5IG6A 5H1VA 5LKZA 5D0CA 5CUBA 3JVKA 3P1CA 5HEMA 5IIDA 5E74A 5HRVA 4BW3A 4NQMA 4PKLA 5ENEA 4XUAA 4XY8A 5II2A 5DLXA 4BW2A 4WHUA 3UVYA 4YY6A 5IGMA 4CUTA 4O7CA 4PCEA 5C8GA 4QSXA 4C67A 4A9HA 5FG5A 4DONA 4TT2A 4E96A 4O78A 2YELA 4UIXA 4NUDA 5EQ1A 5A5NA 5FE1A 5E9LA 4ZW1A 4NYXA 4IORA 3Q2FA 4KV1A 4YBSA 5BT5A 5KTUA 4QEVA 5K29A 5F1LA 3LQJA 4CUQA 5J0DA 3MB3A 5ETBA 5A5OA 5H1TA 5CQ5A 2NXBA 2I7KA 5EPBA 5CRZA 4MEOA 4A9IA 3P5OA 5EM3A 5EGUA 4TU4A 2DVVA 5FBXA 4QSQA 5F1HA 5AMEA 5A85A 4QUUA 5FE2A 2G4AA 5LKXA 4HXLA 4TZ2A 3G0LA 1F68A 2DWWA 4HBWA 4HBYA 5TB6A 2LSPB 5E9KA 3D7CA 5FH6A 4QYDA 5HQ7A 4UIUA 4MEQA 3DAIA 3SVHA 4O7AA 5DYCA 4ALGA 5CQTA 2E3KA 5EK9A 5II1A 4YADA 4PY6A 4QR3A 4MEPA 5F3AA 5G4RA 3MQMA 4YBTA 2L84A 4LYWA 4NRAA 4NRBA 5A5QA 3TLPA 3U5MA 2YQDA 3O33A 5FE5A 3JVJA 5D3NA 5I40A 3LQIA 5CQ7A 4HXRA 3UVWA 5ENHA 5DKCA 4NR9A 3U5LA 4O71A 5D24A 5E9MA 5H1UA 4A9EA 5C89A 5DYXA 4J3IA 1X0JA 4XUBA 5COIA 2GRCA 4HXSA 3MULA 4CUSA 4N3WA 5A7CA 4TT6A 5D25A 4BJXA 2RFJA 3NXBA 5LVRA 3RCWA 4UIZA 5CUGA 5ETDA 5I7XA 4TU6A 3U5OA 4LR6A 5F60A 5DFDA 5EP7A 3JVMA 3LJWA 3P1DA 5D7XA 4HXKA 4YYMA 4NR5A 1WUGA 5CRMA 5CQAA 5DYAA 5HFRA 4LZ2A 5C7NA 5FE8A 4TZ8A 5I83A 4IR3A 3S92A 5DW1A 2L85A 4UYHA 4YYHA 3S91A 5DY7A 2DKWA 4UYFA 4QSPA 4Z1QA 4QC1A 5CQ6A 4NUEA 5G4SA 5JWMA 2N9GA 4O74A 4IOQA 5CP5A 3O37A 5CUEA 2FSAA 5KTXA 5FE0A 2D9EA 5LKTA 4OUFA 4QR4A 4N4HA 2RI7A 4NS5A 5CQ8A 4Q0OA 4Z6IA 5DFCA 3AADA 5FH8A 5I7YA 4O77A 5ENFA 4NR7A 3UW9A 4IR5A 3U5KA 5D3TA 2OUOA 4QSUA 3K2JA 4HXNA 4TT4A 5FFYA 3P1EA 5I86A 5HJCA 4QY4A 4A9OA 4CFKA 3MB4A 5KHMA 5FFWA 5ACYA 3MXFA 4F3IA 5EICA 4UIVA 5C85A 4ALHA 4ZC9A 4Z93A 4WHWA 2OO1A 5H85A 3LXJA 4HXMA 5D3LA 5IGLA 4UYFB 4UYEA 5CUAA 5C87A 5EWVA 5F2PA 4NQNA 4QC3A 5F63A 4ZQLA 5C4QA 5AD2A 4YYDA 4X2IA 4CL9A 5LJ2A 5HELA 2E7OA 2RNXA 4BW4A 4QSVA 4CUPA 2R0VA 4YATA 2F6JA 5FE7A 5FFVA 5EISA 4CUUA 4J0SA 4YYKA 5KU3A 4QBMA 5EA1A 5E73A 5E0RA 2DATA 4UYDA 5EWHA 5HFQA 2WP2A 2YDWA 4Y03A 5FG6A 4QSRA 4O70A 4Z1SA 5CY9A 4CFLA 4QSWA 4KCXA 5FE4A 1WUMA 5FB0A 4BW1A 5DW2A 5FE3A 5EPRA 3UVXA 5HRWA 3I3JA 4LZSA 5EWDA 4YABA 5FH7A 5HLSA 4HXOA 5A5PA 1N72A 4KV4A 5EWCA 4J1PA 3QZVA 5L98A 2D82A 1JSPB 4QR5A 4PCIA 5CTLA 5EU1A 4NRCA 4YYNA 4O7FA 4LC2A 5FE6A 3FKMX 5E9IA 1E6IA 5CUCA 1EQFA 4MENA 5DLZA 3AQAA 2YEKA 4HXPA 4QZSA 4NYWA 4LDFA 4YY4A 4QSTA 3HMFA 5KO4A 3QZTA 4QYLA 4QB3A 5EV9A 2I8NA 5DKDA 4A9NA 3UV4A 2R10A 4MR5A 5E3GA 4HBVA 5IGKA 4LZRA 4LRGA 4CURA 4NYVA 2WP1A 2DVRA 4O72A 3U5JA 2R0SA 5E9VA 5EVAA 4OGJA 4NXJA 5F62A 4QNSA 2L5EA 4TQNA 4IR6A 4UIYA 5BT4A 3O35A 4NR4A 5DBMA 5E3DA 5HQ6A 5EI4A 5BT3A 1ZS5A 5LKUA 5F5ZA 5F61A 5D26A 4PTBA 5E9YA 4LYIA 3G0JA 4TTEA 4YYGA 5CGPA 2RO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E7N A;  5EWW A;  5L8T A;  5DKH A;  4Z6H A;  5DFB A;  4QUT A;  4O75 A;  4CLB A;  3U5N A;  4A9M A;  4MR4 A;  4LYS A;  4XYA A;  4YYI A;  3MUK A;  5LJ1 A;  4NUC A;  4N4F A;  3HME A;  2H60 A;  5A82 A;  2MJV B;  5L99 A;  2RNW A;  3Q2E A;  2RS9 B;  3P1F A;  5CFW A;  5F36 A;  5DYU A;  5D3S A;  4IOO A;  5CQ3 A;  3DWY A;  3ZYU A;  3QZS A;  5A5S A;  5ENC A;  4QEW A;  5KTW A;  5HEN A;  3IU5 A;  5CQ4 A;  2R0Y A;  3ONI A;  4FLP A;  4YH4 A;  4MR3 A;  3SVG A;  4AKN A;  4Q0N A;  5I29 A;  3GG3 A;  4N4I A;  4YK0 A;  5E7D A;  4TYL A;  4YAX A;  4IR4 A;  5TCM A;  4A9J A;  5HQ5 A;  4A9K A;  5LUU A;  3UV2 A;  5A83 A;  3HMH A;  5ENI A;  5CU8 A;  4A9F A;  3U5P A;  2RNY A;  3UVD A;  5I89 A;  5LVQ A;  4O7B A;  4YH3 A;  5I1Q A;  4BHW A;  5L8U A;  4UIW A;  5FE9 A;  2YW5 A;  5L97 A;  5I80 A;  4TS8 A;  5ENG A;  4YYJ A;  5HRX A;  4QEU A;  5AMF A;  2OSS A;  2YEM A;  5ENJ A;  5FG4 A;  2F6N A;  4YC9 A;  3UV5 A;  2KTB B;  5CS8 A;  5D3P A;  3SVF A;  5ENB A;  3IU6 A;  1JM4 B;  5I88 A;  4NR6 A;  4NR8 A;  5CZG A;  4UYG A;  5A5R A;  5A81 A;  4J0R A;  5L96 A;  5JI8 A;  4O76 A;  5IBN A;  5D3H A;  5IGN A;  2DVQ A;  5CUD A;  5HCL A;  5CPE A;  4GPJ A;  5D3R A;  4C66 A;  4MR6 A;  5LJ0 A;  4A9L A;  4WIV A;  4YBM A;  4OGI A;  5EPS A;  5HM0 A;  5F25 A;  5AD3 A;  4PS5 A;  4UIT A;  5DX4 A;  5FB1 A;  4N4G A;  4QSS A;  2DVS A;  4HBX A;  5D3J A;  4O7E A;  2YYN A;  3O36 A;  3LQH A;  5FDZ A;  4RVR A;  3JVL A;  3O34 A;  4XY9 A;  5IG6 A;  5H1V A;  5LKZ A;  5D0C A;  5CUB A;  3JVK A;  3P1C A;  5HEM A;  5IID A;  5E74 A;  5HRV A;  4BW3 A;  4NQM A;  4PKL A;  5ENE A;  4XUA A;  4XY8 A;  5II2 A;  5DLX A;  4BW2 A;  4WHU A;  3UVY A;  4YY6 A;  5IGM A;  4CUT A;  4O7C A;  4PCE A;  5C8G A;  4QSX A;  4C67 A;  4A9H A;  5FG5 A;  4DON A;  4TT2 A;  4E96 A;  4O78 A;  2YEL A;  4UIX A;  4NUD A;  5EQ1 A;  5A5N A;  5FE1 A;  5E9L A;  4ZW1 A;  4NYX A;  4IOR A;  3Q2F A;  4KV1 A;  4YBS A;  5BT5 A;  5KTU A;  4QEV A;  5K29 A;  5F1L A;  3LQJ A;  4CUQ A;  5J0D A;  3MB3 A;  5ETB A;  5A5O A;  5H1T A;  5CQ5 A;  2NXB A;  2I7K A;  5EPB A;  5CRZ A;  4MEO A;  4A9I A;  3P5O A;  5EM3 A;  5EGU A;  4TU4 A;  2DVV A;  5FBX A;  4QSQ A;  5F1H A;  5AME A;  5A85 A;  4QUU A;  5FE2 A;  2G4A A;  5LKX A;  4HXL A;  4TZ2 A;  3G0L A;  1F68 A;  2DWW A;  4HBW A;  4HBY A;  5TB6 A;  2LSP B;  5E9K A;  3D7C A;  5FH6 A;  4QYD A;  5HQ7 A;  4UIU A;  4MEQ A;  3DAI A;  3SVH A;  4O7A A;  5DYC A;  4ALG A;  5CQT A;  2E3K A;  5EK9 A;  5II1 A;  4YAD A;  4PY6 A;  4QR3 A;  4MEP A;  5F3A A;  5G4R A;  3MQM A;  4YBT A;  2L84 A;  4LYW A;  4NRA A;  4NRB A;  5A5Q A;  3TLP A;  3U5M A;  2YQD A;  3O33 A;  5FE5 A;  3JVJ A;  5D3N A;  5I40 A;  3LQI A;  5CQ7 A;  4HXR A;  3UVW A;  5ENH A;  5DKC A;  4NR9 A;  3U5L A;  4O71 A;  5D24 A;  5E9M A;  5H1U A;  4A9E A;  5C89 A;  5DYX A;  4J3I A;  1X0J A;  4XUB A;  5COI A;  2GRC A;  4HXS A;  3MUL A;  4CUS A;  4N3W A;  5A7C A;  4TT6 A;  5D25 A;  4BJX A;  2RFJ A;  3NXB A;  5LVR A;  3RCW A;  4UIZ A;  5CUG A;  5ETD A;  5I7X A;  4TU6 A;  3U5O A;  4LR6 A;  5F60 A;  5DFD A;  5EP7 A;  3JVM A;  3LJW A;  3P1D A;  5D7X A;  4HXK A;  4YYM A;  4NR5 A;  1WUG A;  5CRM A;  5CQA A;  5DYA A;  5HFR A;  4LZ2 A;  5C7N A;  5FE8 A;  4TZ8 A;  5I83 A;  4IR3 A;  3S92 A;  5DW1 A;  2L85 A;  4UYH A;  4YYH A;  3S91 A;  5DY7 A;  2DKW A;  4UYF A;  4QSP A;  4Z1Q A;  4QC1 A;  5CQ6 A;  4NUE A;  5G4S A;  5JWM A;  2N9G A;  4O74 A;  4IOQ A;  5CP5 A;  3O37 A;  5CUE A;  2FSA A;  5KTX A;  5FE0 A;  2D9E A;  5LKT A;  4OUF A;  4QR4 A;  4N4H A;  2RI7 A;  4NS5 A;  5CQ8 A;  4Q0O A;  4Z6I A;  5DFC A;  3AAD A;  5FH8 A;  5I7Y A;  4O77 A;  5ENF A;  4NR7 A;  3UW9 A;  4IR5 A;  3U5K A;  5D3T A;  2OUO A;  4QSU A;  3K2J A;  4HXN A;  4TT4 A;  5FFY A;  3P1E A;  5I86 A;  5HJC A;  4QY4 A;  4A9O A;  4CFK A;  3MB4 A;  5KHM A;  5FFW A;  5ACY A;  3MXF A;  4F3I A;  5EIC A;  4UIV A;  5C85 A;  4ALH A;  4ZC9 A;  4Z93 A;  4WHW A;  2OO1 A;  5H85 A;  3LXJ A;  4HXM A;  5D3L A;  5IGL A;  4UYF B;  4UYE A;  5CUA A;  5C87 A;  5EWV A;  5F2P A;  4NQN A;  4QC3 A;  5F63 A;  4ZQL A;  5C4Q A;  5AD2 A;  4YYD A;  4X2I A;  4CL9 A;  5LJ2 A;  5HEL A;  2E7O A;  2RNX A;  4BW4 A;  4QSV A;  4CUP A;  2R0V A;  4YAT A;  2F6J A;  5FE7 A;  5FFV A;  5EIS A;  4CUU A;  4J0S A;  4YYK A;  5KU3 A;  4QBM A;  5EA1 A;  5E73 A;  5E0R A;  2DAT A;  4UYD A;  5EWH A;  5HFQ A;  2WP2 A;  2YDW A;  4Y03 A;  5FG6 A;  4QSR A;  4O70 A;  4Z1S A;  5CY9 A;  4CFL A;  4QSW A;  4KCX A;  5FE4 A;  1WUM A;  5FB0 A;  4BW1 A;  5DW2 A;  5FE3 A;  5EPR A;  3UVX A;  5HRW A;  3I3J A;  4LZS A;  5EWD A;  4YAB A;  5FH7 A;  5HLS A;  4HXO A;  5A5P A;  1N72 A;  4KV4 A;  5EWC A;  4J1P A;  3QZV A;  5L98 A;  2D82 A;  1JSP B;  4QR5 A;  4PCI A;  5CTL A;  5EU1 A;  4NRC A;  4YYN A;  4O7F A;  4LC2 A;  5FE6 A;  3FKM X;  5E9I A;  1E6I A;  5CUC A;  1EQF A;  4MEN A;  5DLZ A;  3AQA A;  2YEK A;  4HXP A;  4QZS A;  4NYW A;  4LDF A;  4YY4 A;  4QST A;  3HMF A;  5KO4 A;  3QZT A;  4QYL A;  4QB3 A;  5EV9 A;  2I8N A;  5DKD A;  4A9N A;  3UV4 A;  2R10 A;  4MR5 A;  5E3G A;  4HBV A;  5IGK A;  4LZR A;  4LRG A;  4CUR A;  4NYV A;  2WP1 A;  2DVR A;  4O72 A;  3U5J A;  2R0S A;  5E9V A;  5EVA A;  4OGJ A;  4NXJ A;  5F62 A;  4QNS A;  2L5E A;  4TQN A;  4IR6 A;  4UIY A;  5BT4 A;  3O35 A;  4NR4 A;  5DBM A;  5E3D A;  5HQ6 A;  5EI4 A;  5BT3 A;  1ZS5 A;  5LKU A;  5F5Z A;  5F61 A;  5D26 A;  4PTB A;  5E9Y A;  4LYI A;  3G0J A;  4TTE A;  4YYG A;  5CGP A;  2RO1 A; 
#chains in the Genus database with same CATH topology
 2E7N A;  5EWW A;  5L8T A;  5DKH A;  4Z6H A;  5DFB A;  4QUT A;  4O75 A;  4CLB A;  3U5N A;  4A9M A;  4MR4 A;  4LYS A;  4XYA A;  4YYI A;  3MUK A;  5LJ1 A;  3VKH A;  4NUC A;  4N4F A;  3HME A;  2H60 A;  5A82 A;  2MJV B;  5L99 A;  2RNW A;  3Q2E A;  2RS9 B;  3P1F A;  5CFW A;  5F36 A;  5DYU A;  5D3S A;  4IOO A;  5CQ3 A;  3DWY A;  3ZYU A;  3QZS A;  5A5S A;  5ENC A;  4QEW A;  5KTW A;  5HEN A;  3IU5 A;  5CQ4 A;  2R0Y A;  3ONI A;  4FLP A;  4YH4 A;  4MR3 A;  3SVG A;  4AKN A;  4Q0N A;  5I29 A;  3GG3 A;  4N4I A;  4YK0 A;  1PUO A;  5E7D A;  4TYL A;  4YAX A;  4IR4 A;  5TCM A;  4A9J A;  5HQ5 A;  4A9K A;  5LUU A;  3UV2 A;  5A83 A;  3HMH A;  5ENI A;  5CU8 A;  4A9F A;  3U5P A;  2RNY A;  3UVD A;  5I89 A;  5LVQ A;  4O7B A;  4YH3 A;  5I1Q A;  4BHW A;  5L8U A;  4UIW A;  5FE9 A;  2YW5 A;  5L97 A;  5I80 A;  4TS8 A;  5ENG A;  4YYJ A;  5HRX A;  4QEU A;  5AMF A;  2OSS A;  2YEM A;  5ENJ A;  5FG4 A;  2F6N A;  4YC9 A;  3UV5 A;  2KTB B;  5CS8 A;  5D3P A;  3SVF A;  5ENB A;  3IU6 A;  1JM4 B;  5I88 A;  4NR6 A;  4NR8 A;  5CZG A;  4UYG A;  5A5R A;  5A81 A;  4J0R A;  5L96 A;  5JI8 A;  4O76 A;  5IBN A;  5D3H A;  5IGN A;  2DVQ A;  5CUD A;  5HCL A;  5CPE A;  4GPJ A;  5D3R A;  4C66 A;  4MR6 A;  5LJ0 A;  4A9L A;  4WIV A;  4YBM A;  4OGI A;  5EPS A;  5HM0 A;  5F25 A;  5AD3 A;  4PS5 A;  4UIT A;  5DX4 A;  5FB1 A;  4N4G A;  4QSS A;  2DVS A;  4HBX A;  5D3J A;  4O7E A;  2YYN A;  3O36 A;  3LQH A;  5FDZ A;  4RVR A;  3JVL A;  3O34 A;  4XY9 A;  5IG6 A;  5H1V A;  5LKZ A;  5D0C A;  5CUB A;  3JVK A;  3P1C A;  5HEM A;  5IID A;  5E74 A;  5HRV A;  4BW3 A;  4NQM A;  4PKL A;  5ENE A;  4XUA A;  4XY8 A;  5II2 A;  5DLX A;  4BW2 A;  4WHU A;  3UVY A;  4YY6 A;  5IGM A;  4CUT A;  4O7C A;  4PCE A;  5C8G A;  4QSX A;  4C67 A;  4A9H A;  5FG5 A;  4DON A;  4TT2 A;  4E96 A;  4AKI A;  4O78 A;  2YEL A;  4UIX A;  4NUD A;  5EQ1 A;  5A5N A;  5FE1 A;  5E9L A;  4ZW1 A;  4NYX A;  4IOR A;  3Q2F A;  4KV1 A;  4YBS A;  3ERR A;  5BT5 A;  5KTU A;  4QEV A;  5K29 A;  5F1L A;  3LQJ A;  4CUQ A;  5J0D A;  3MB3 A;  5ETB A;  5A5O A;  3VKG A;  5H1T A;  5CQ5 A;  2NXB A;  2I7K A;  5EPB A;  5CRZ A;  4MEO A;  4A9I A;  3P5O A;  5EM3 A;  5EGU A;  4TU4 A;  2DVV A;  5FBX A;  4QSQ A;  5F1H A;  5AME A;  5A85 A;  4QUU A;  5FE2 A;  2G4A A;  5LKX A;  4HXL A;  4TZ2 A;  3G0L A;  1F68 A;  2DWW A;  4HBW A;  4HBY A;  5TB6 A;  2LSP B;  5E9K A;  3D7C A;  5FH6 A;  4QYD A;  5HQ7 A;  4UIU A;  4MEQ A;  3DAI A;  3SVH A;  4O7A A;  5DYC A;  4ALG A;  5CQT A;  2E3K A;  5EK9 A;  5II1 A;  4YAD A;  4PY6 A;  4QR3 A;  4MEP A;  5F3A A;  5G4R A;  4AKH A;  3MQM A;  4YBT A;  2L84 A;  4LYW A;  4NRA A;  4NRB A;  5A5Q A;  3TLP A;  3U5M A;  2YQD A;  3O33 A;  5FE5 A;  3JVJ A;  5D3N A;  5I40 A;  3LQI A;  5CQ7 A;  4HXR A;  3UVW A;  5ENH A;  5DKC A;  4NR9 A;  3U5L A;  4O71 A;  5D24 A;  5E9M A;  5H1U A;  4A9E A;  5C89 A;  5DYX A;  4J3I A;  1X0J A;  4XUB A;  5COI A;  2GRC A;  4HXS A;  3MUL A;  4CUS A;  4N3W A;  5A7C A;  4TT6 A;  5D25 A;  4BJX A;  2RFJ A;  3NXB A;  5LVR A;  3RCW A;  4UIZ A;  5CUG A;  5ETD A;  5I7X A;  4TU6 A;  3U5O A;  4LR6 A;  5F60 A;  5DFD A;  5EP7 A;  3JVM A;  3LJW A;  3P1D A;  5D7X A;  4HXK A;  4YYM A;  4NR5 A;  1WUG A;  5CRM A;  5CQA A;  5DYA A;  5HFR A;  4LZ2 A;  5C7N A;  5FE8 A;  4TZ8 A;  5I83 A;  4IR3 A;  3S92 A;  5DW1 A;  2L85 A;  4UYH A;  4YYH A;  3S91 A;  5DY7 A;  2DKW A;  4UYF A;  4QSP A;  4Z1Q A;  4QC1 A;  5CQ6 A;  4NUE A;  5G4S A;  5JWM A;  2N9G A;  4O74 A;  4IOQ A;  5CP5 A;  3O37 A;  5CUE A;  2FSA A;  5KTX A;  5FE0 A;  2D9E A;  5LKT A;  4OUF A;  4QR4 A;  4N4H A;  2RI7 A;  4NS5 A;  5CQ8 A;  4Q0O A;  4Z6I A;  5DFC A;  3AAD A;  5FH8 A;  5I7Y A;  4O77 A;  5ENF A;  4NR7 A;  3UW9 A;  4IR5 A;  3U5K A;  5D3T A;  2OUO A;  4QSU A;  3K2J A;  4HXN A;  4TT4 A;  5FFY A;  3P1E A;  5I86 A;  5HJC A;  4QY4 A;  4A9O A;  4CFK A;  3MB4 A;  5KHM A;  5FFW A;  5ACY A;  3MXF A;  4F3I A;  5EIC A;  4UIV A;  5C85 A;  4ALH A;  4ZC9 A;  4Z93 A;  4WHW A;  2OO1 A;  5H85 A;  3LXJ A;  4HXM A;  5D3L A;  5IGL A;  4UYF B;  4UYE A;  5CUA A;  5C87 A;  5EWV A;  5F2P A;  4NQN A;  4QC3 A;  5F63 A;  4ZQL A;  5C4Q A;  5AD2 A;  4YYD A;  4X2I A;  4CL9 A;  5LJ2 A;  5HEL A;  2E7O A;  2RNX A;  4AI6 A;  4BW4 A;  4QSV A;  4CUP A;  2R0V A;  4YAT A;  2F6J A;  5FE7 A;  5FFV A;  5EIS A;  4CUU A;  4J0S A;  4YYK A;  5KU3 A;  4QBM A;  5EA1 A;  5E73 A;  5E0R A;  2DAT A;  4UYD A;  5EWH A;  5HFQ A;  2WP2 A;  2YDW A;  4Y03 A;  5FG6 A;  4QSR A;  4O70 A;  4Z1S A;  5CY9 A;  4CFL A;  4QSW A;  4KCX A;  5FE4 A;  4AKG A;  1WUM A;  5FB0 A;  4BW1 A;  5DW2 A;  5FE3 A;  5EPR A;  3UVX A;  5HRW A;  3I3J A;  4LZS A;  5EWD A;  4YAB A;  5FH7 A;  5HLS A;  4HXO A;  5A5P A;  1N72 A;  4KV4 A;  5EWC A;  4J1P A;  3QZV A;  5L98 A;  2D82 A;  1JSP B;  4QR5 A;  4PCI A;  5CTL A;  5EU1 A;  4NRC A;  4YYN A;  4O7F A;  4LC2 A;  5FE6 A;  3FKM X;  5E9I A;  1E6I A;  5CUC A;  1EQF A;  4MEN A;  5DLZ A;  3AQA A;  2YEK A;  4HXP A;  4QZS A;  4NYW A;  4LDF A;  4YY4 A;  3D1B A;  4QST A;  3HMF A;  5KO4 A;  3QZT A;  4QYL A;  4QB3 A;  5EV9 A;  2I8N A;  5DKD A;  4A9N A;  3UV4 A;  2R10 A;  4MR5 A;  5E3G A;  4HBV A;  5IGK A;  4LZR A;  4LRG A;  4CUR A;  4NYV A;  2WP1 A;  2DVR A;  4O72 A;  3U5J A;  2R0S A;  5E9V A;  5EVA A;  4OGJ A;  4NXJ A;  5F62 A;  4QNS A;  2L5E A;  4TQN A;  1ZKR A;  4IR6 A;  4UIY A;  5BT4 A;  3O35 A;  4NR4 A;  5DBM A;  5E3D A;  5HQ6 A;  5EI4 A;  5BT3 A;  1ZS5 A;  5LKU A;  2EJN A;  5F5Z A;  5F61 A;  5D26 A;  4PTB A;  5E9Y A;  4LYI A;  3G0J A;  4TTE A;  4YYG A;  5CGP A;  3D1D A;  2RO1 A; 
#chains in the Genus database with same CATH homology
 2E7N A;  5EWW A;  5L8T A;  5DKH A;  4Z6H A;  5DFB A;  4QUT A;  4O75 A;  4CLB A;  3U5N A;  4A9M A;  4MR4 A;  4LYS A;  4XYA A;  4YYI A;  3MUK A;  5LJ1 A;  4NUC A;  4N4F A;  3HME A;  2H60 A;  5A82 A;  2MJV B;  5L99 A;  2RNW A;  3Q2E A;  2RS9 B;  3P1F A;  5CFW A;  5F36 A;  5DYU A;  5D3S A;  4IOO A;  5CQ3 A;  3DWY A;  3ZYU A;  3QZS A;  5A5S A;  5ENC A;  4QEW A;  5KTW A;  5HEN A;  3IU5 A;  5CQ4 A;  2R0Y A;  3ONI A;  4FLP A;  4YH4 A;  4MR3 A;  3SVG A;  4AKN A;  4Q0N A;  5I29 A;  3GG3 A;  4N4I A;  4YK0 A;  5E7D A;  4TYL A;  4YAX A;  4IR4 A;  5TCM A;  4A9J A;  5HQ5 A;  4A9K A;  5LUU A;  3UV2 A;  5A83 A;  3HMH A;  5ENI A;  5CU8 A;  4A9F A;  3U5P A;  2RNY A;  3UVD A;  5I89 A;  5LVQ A;  4O7B A;  4YH3 A;  5I1Q A;  4BHW A;  5L8U A;  4UIW A;  5FE9 A;  2YW5 A;  5L97 A;  5I80 A;  4TS8 A;  5ENG A;  4YYJ A;  5HRX A;  4QEU A;  5AMF A;  2OSS A;  2YEM A;  5ENJ A;  5FG4 A;  2F6N A;  4YC9 A;  3UV5 A;  2KTB B;  5CS8 A;  5D3P A;  3SVF A;  5ENB A;  3IU6 A;  1JM4 B;  5I88 A;  4NR6 A;  4NR8 A;  5CZG A;  4UYG A;  5A5R A;  5A81 A;  4J0R A;  5L96 A;  5JI8 A;  4O76 A;  5IBN A;  5D3H A;  5IGN A;  2DVQ A;  5CUD A;  5HCL A;  5CPE A;  4GPJ A;  5D3R A;  4C66 A;  4MR6 A;  5LJ0 A;  4A9L A;  4WIV A;  4YBM A;  4OGI A;  5EPS A;  5HM0 A;  5F25 A;  5AD3 A;  4PS5 A;  4UIT A;  5DX4 A;  5FB1 A;  4N4G A;  4QSS A;  2DVS A;  4HBX A;  5D3J A;  4O7E A;  2YYN A;  3O36 A;  3LQH A;  5FDZ A;  4RVR A;  3JVL A;  3O34 A;  4XY9 A;  5IG6 A;  5H1V A;  5LKZ A;  5D0C A;  5CUB A;  3JVK A;  3P1C A;  5HEM A;  5IID A;  5E74 A;  5HRV A;  4BW3 A;  4NQM A;  4PKL A;  5ENE A;  4XUA A;  4XY8 A;  5II2 A;  5DLX A;  4BW2 A;  4WHU A;  3UVY A;  4YY6 A;  5IGM A;  4CUT A;  4O7C A;  4PCE A;  5C8G A;  4QSX A;  4C67 A;  4A9H A;  5FG5 A;  4DON A;  4TT2 A;  4E96 A;  4O78 A;  2YEL A;  4UIX A;  4NUD A;  5EQ1 A;  5A5N A;  5FE1 A;  5E9L A;  4ZW1 A;  4NYX A;  4IOR A;  3Q2F A;  4KV1 A;  4YBS A;  5BT5 A;  5KTU A;  4QEV A;  5K29 A;  5F1L A;  3LQJ A;  4CUQ A;  5J0D A;  3MB3 A;  5ETB A;  5A5O A;  5H1T A;  5CQ5 A;  2NXB A;  2I7K A;  5EPB A;  5CRZ A;  4MEO A;  4A9I A;  3P5O A;  5EM3 A;  5EGU A;  4TU4 A;  2DVV A;  5FBX A;  4QSQ A;  5F1H A;  5AME A;  5A85 A;  4QUU A;  5FE2 A;  2G4A A;  5LKX A;  4HXL A;  4TZ2 A;  3G0L A;  1F68 A;  2DWW A;  4HBW A;  4HBY A;  5TB6 A;  2LSP B;  5E9K A;  3D7C A;  5FH6 A;  4QYD A;  5HQ7 A;  4UIU A;  4MEQ A;  3DAI A;  3SVH A;  4O7A A;  5DYC A;  4ALG A;  5CQT A;  2E3K A;  5EK9 A;  5II1 A;  4YAD A;  4PY6 A;  4QR3 A;  4MEP A;  5F3A A;  5G4R A;  3MQM A;  4YBT A;  2L84 A;  4LYW A;  4NRA A;  4NRB A;  5A5Q A;  3TLP A;  3U5M A;  2YQD A;  3O33 A;  5FE5 A;  3JVJ A;  5D3N A;  5I40 A;  3LQI A;  5CQ7 A;  4HXR A;  3UVW A;  5ENH A;  5DKC A;  4NR9 A;  3U5L A;  4O71 A;  5D24 A;  5E9M A;  5H1U A;  4A9E A;  5C89 A;  5DYX A;  4J3I A;  1X0J A;  4XUB A;  5COI A;  2GRC A;  4HXS A;  3MUL A;  4CUS A;  4N3W A;  5A7C A;  4TT6 A;  5D25 A;  4BJX A;  2RFJ A;  3NXB A;  5LVR A;  3RCW A;  4UIZ A;  5CUG A;  5ETD A;  5I7X A;  4TU6 A;  3U5O A;  4LR6 A;  5F60 A;  5DFD A;  5EP7 A;  3JVM A;  3LJW A;  3P1D A;  5D7X A;  4HXK A;  4YYM A;  4NR5 A;  1WUG A;  5CRM A;  5CQA A;  5DYA A;  5HFR A;  4LZ2 A;  5C7N A;  5FE8 A;  4TZ8 A;  5I83 A;  4IR3 A;  3S92 A;  5DW1 A;  2L85 A;  4UYH A;  4YYH A;  3S91 A;  5DY7 A;  2DKW A;  4UYF A;  4QSP A;  4Z1Q A;  4QC1 A;  5CQ6 A;  4NUE A;  5G4S A;  5JWM A;  2N9G A;  4O74 A;  4IOQ A;  5CP5 A;  3O37 A;  5CUE A;  2FSA A;  5KTX A;  5FE0 A;  2D9E A;  5LKT A;  4OUF A;  4QR4 A;  4N4H A;  2RI7 A;  4NS5 A;  5CQ8 A;  4Q0O A;  4Z6I A;  5DFC A;  3AAD A;  5FH8 A;  5I7Y A;  4O77 A;  5ENF A;  4NR7 A;  3UW9 A;  4IR5 A;  3U5K A;  5D3T A;  2OUO A;  4QSU A;  3K2J A;  4HXN A;  4TT4 A;  5FFY A;  3P1E A;  5I86 A;  5HJC A;  4QY4 A;  4A9O A;  4CFK A;  3MB4 A;  5KHM A;  5FFW A;  5ACY A;  3MXF A;  4F3I A;  5EIC A;  4UIV A;  5C85 A;  4ALH A;  4ZC9 A;  4Z93 A;  4WHW A;  2OO1 A;  5H85 A;  3LXJ A;  4HXM A;  5D3L A;  5IGL A;  4UYF B;  4UYE A;  5CUA A;  5C87 A;  5EWV A;  5F2P A;  4NQN A;  4QC3 A;  5F63 A;  4ZQL A;  5C4Q A;  5AD2 A;  4YYD A;  4X2I A;  4CL9 A;  5LJ2 A;  5HEL A;  2E7O A;  2RNX A;  4BW4 A;  4QSV A;  4CUP A;  2R0V A;  4YAT A;  2F6J A;  5FE7 A;  5FFV A;  5EIS A;  4CUU A;  4J0S A;  4YYK A;  5KU3 A;  4QBM A;  5EA1 A;  5E73 A;  5E0R A;  2DAT A;  4UYD A;  5EWH A;  5HFQ A;  2WP2 A;  2YDW A;  4Y03 A;  5FG6 A;  4QSR A;  4O70 A;  4Z1S A;  5CY9 A;  4CFL A;  4QSW A;  4KCX A;  5FE4 A;  1WUM A;  5FB0 A;  4BW1 A;  5DW2 A;  5FE3 A;  5EPR A;  3UVX A;  5HRW A;  3I3J A;  4LZS A;  5EWD A;  4YAB A;  5FH7 A;  5HLS A;  4HXO A;  5A5P A;  1N72 A;  4KV4 A;  5EWC A;  4J1P A;  3QZV A;  5L98 A;  2D82 A;  1JSP B;  4QR5 A;  4PCI A;  5CTL A;  5EU1 A;  4NRC A;  4YYN A;  4O7F A;  4LC2 A;  5FE6 A;  3FKM X;  5E9I A;  1E6I A;  5CUC A;  1EQF A;  4MEN A;  5DLZ A;  3AQA A;  2YEK A;  4HXP A;  4QZS A;  4NYW A;  4LDF A;  4YY4 A;  4QST A;  3HMF A;  5KO4 A;  3QZT A;  4QYL A;  4QB3 A;  5EV9 A;  2I8N A;  5DKD A;  4A9N A;  3UV4 A;  2R10 A;  4MR5 A;  5E3G A;  4HBV A;  5IGK A;  4LZR A;  4LRG A;  4CUR A;  4NYV A;  2WP1 A;  2DVR A;  4O72 A;  3U5J A;  2R0S A;  5E9V A;  5EVA A;  4OGJ A;  4NXJ A;  5F62 A;  4QNS A;  2L5E A;  4TQN A;  4IR6 A;  4UIY A;  5BT4 A;  3O35 A;  4NR4 A;  5DBM A;  5E3D A;  5HQ6 A;  5EI4 A;  5BT3 A;  1ZS5 A;  5LKU A;  5F5Z A;  5F61 A;  5D26 A;  4PTB A;  5E9Y A;  4LYI A;  3G0J A;  4TTE A;  4YYG A;  5CGP A;  2RO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...