5FE3A

Crystal structure of human pcaf bromodomain in complex with fragment mb360 (fragment 4)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
109
structure length
109
Chain Sequence
RDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT2B
publication title Structure-Based Identification of Inhibitory Fragments Targeting the p300/CBP-Associated Factor Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 41
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fe3A00
4XY8A 5TCMA 5D3LA 4AKNA 5HQ7A 5K29A 3I3JA 5ETBA 3D7CA 4UYFB 4CL9A 4TYLA 5H1TA 4TT2A 4YH4A 4CFLA 5AMFA 4X2IA 5F61A 4N4FA 4J3IA 5E3DA 4NUEA 5ENFA 4YBMA 4IR6A 4NUCA 2RNXA 5F60A 2NXBA 4BJXA 5HFRA 5C7NA 5EV9A 4QSQA 5LJ2A 5FE9A 5ENBA 4UYDA 5EISA 3AADA 3TLPA 4CUPA 4J1PA 4UIYA 4NXJA 5E7DA 4A9LA 3Q2EA 4NRBA 4YK0A 5F62A 4O7BA 5HCLA 4YYIA 4C66A 3MUKA 5EICA 4QSUA 4CUQA 2DWWA 4BHWA 4UIVA 4YY6A 4HXLA 4A9OA 4QUTA 4YYGA 5H85A 5L8TA 5CUCA 4YYKA 5ENHA 3HMEA 4NRCA 4WHUA 4WHWA 5FE1A 5D3TA 4XY9A 5FG5A 5F3AA 5CQ6A 5C4QA 5DYAA 4A9MA 5HRWA 2E7NA 4QSSA 5D3JA 2YEMA 2D9EA 5ACYA 3AQAA 5EWCA 5FB0A 5HRXA 5I89A 4UYEA 5EWVA 5HQ5A 2F6JA 4QSWA 2RS9B 2F6NA 4IR4A 5DKHA 4QB3A 4HXMA 4O7CA 5CQ8A 4LZRA 4LZ2A 2RNWA 5DYUA 5C85A 3FKMX 4O72A 1F68A 4IR3A 5IG6A 2KTBB 4HXOA 5CUAA 3G0JA 4YBTA 4NR9A 3O34A 3O35A 4UIUA 4HBVA 4OUFA 4LYWA 4HXRA 4IR5A 5DYCA 4O75A 5IBNA 4BW2A 5DFBA 4Y03A 4QBMA 4MR5A 4IORA 5BT3A 3DAIA 3O36A 5DLXA 5CUEA 5I83A 2YEKA 4BW3A 4QC3A 2YW5A 5IIDA 5F36A 4QR4A 4NR6A 4O7AA 2R0VA 2DATA 5I7YA 4N4HA 4NQMA 1JSPB 2E7OA 5E9IA 5FFVA 4HBYA 5LJ0A 5A5QA 5EWDA 5FB1A 5CU8A 3UVYA 4HXKA 5A5SA 4HBXA 3P1DA 2YDWA 1ZS5A 4NQNA 5HM0A 5L96A 5FG6A 3U5MA 5J0DA 5FFYA 4QSRA 5D7XA 5G4SA 5D24A 5FH6A 3S92A 4J0SA 5ENEA 5A82A 5EPSA 2I8NA 4WIVA 2G4AA 4KV4A 5IGKA 4UIWA 5F1LA 5TB6A 3O33A 5F5ZA 4A9JA 4QSPA 3S91A 5E9KA 5AD2A 5DLZA 2I7KA 2OUOA 4DONA 5I86A 1WUGA 4A9IA 4QR5A 3UVWA 5FE6A 2DKWA 3ZYUA 5HQ6A 4N3WA 5CY9A 2FSAA 5G4RA 4O77A 4QSTA 4NR4A 4O76A 5HENA 4UYHA 4YADA 4QYDA 5FG4A 5KU3A 2WP2A 2RO1A 5EM3A 4YYJA 3O37A 5CRZA 4IOOA 5IGLA 5ENCA 4YABA 2L5EA 4NR5A 5HELA 4ALHA 3IU6A 4ZC9A 5EA1A 4UIXA 1N72A 4QEVA 5I1QA 5EWHA 4Z6HA 5E0RA 4NR7A 4LDFA 5I7XA 5CPEA 4YYHA 4QC1A 4O70A 3HMHA 4Z93A 5EU1A 3RCWA 5AMEA 5ENIA 2MJVB 4UIZA 5EI4A 5BT4A 5C8GA 5CUBA 5DFDA 4LZSA 3Q2FA 2N9GA 4HBWA 5KTUA 5IGMA 5CP5A 3LQHA 2DVVA 2LSPB 4PY6A 5CRMA 5C87A 4QZSA 3UW9A 4BW4A 3SVGA 2R0YA 2RI7A 3UV5A 5FH7A 4CFKA 1JM4B 5DFCA 1E6IA 5E9LA 4UYGA 2DVQA 5E9YA 2D82A 5JWMA 4XYAA 3NXBA 3U5KA 4YYMA 4Z1SA 5EVAA 5I29A 5DX4A 3U5JA 4QY4A 2YELA 3LJWA 2OSSA 5CQTA 5CUDA 4PCEA 5LJ1A 5IGNA 4CUTA 5FE7A 4TU6A 4LC2A 2L84A 2GRCA 5AD3A 3LXJA 4CLBA 1X0JA 5I88A 4Q0NA 4PCIA 3JVLA 3JVKA 4UYFA 5LVRA 4MEPA 4XUBA 5DKDA 3GG3A 3U5PA 4A9HA 3MXFA 3UV4A 4ALGA 4YYNA 5I80A 2RFJA 4A9KA 5E73A 5F63A 2RNYA 3QZSA 5FE5A 4NS5A 5KO4A 4GPJA 5FE3A 5A83A 5FE4A 4YC9A 4CURA 4MEOA 5LKTA 3U5OA 4KV1A 5A7CA 5KHMA 3JVJA 3DWYA 5DBMA 5EK9A 5II2A 4YY4A 2OO1A 4LR6A 2WP1A 4PTBA 4A9EA 5ENJA 5ETDA 5II1A 4QUUA 4TTEA 3SVHA 5F2PA 4TT6A 2R0SA 4LYSA 5A5NA 5ENGA 5EGUA 4QSVA 3P1EA 5FBXA 5DW2A 5L97A 5H1VA 3UV2A 4Z6IA 4Z1QA 1WUMA 4LYIA 3IU5A 4OGIA 3G0LA 5L99A 5CUGA 5A5OA 5E9MA 5D3PA 5FE8A 4MR3A 5EPRA 4TU4A 5D26A 2R10A 3UVXA 3P5OA 5D3HA 5D25A 5HFQA 4NRAA 3ONIA 4TT4A 5I40A 3U5NA 5L98A 4MENA 4O74A 5A5PA 5CFWA 2DVRA 3MB3A 5E3GA 4O71A 3LQJA 5EWWA 3K2JA 2YYNA 1EQFA 4QEUA 5CQ3A 5CGPA 4OGJA 4A9FA 3SVFA 4QYLA 3MB4A 3MULA 3MQMA 5E74A 5CQAA 4ZQLA 4LRGA 5DKCA 4FLPA 5HLSA 4YAXA 4TZ8A 5A5RA 4MR4A 4QR3A 5CZGA 2H60A 3P1FA 4IOQA 5FH8A 4TZ2A 3HMFA 4PKLA 5BT5A 5DW1A 4NYXA 2DVSA 5A85A 2YQDA 5EP7A 5HEMA 4F3IA 5KTWA 4TS8A 5D0CA 5LKUA 4N4IA 4QSXA 4HXNA 4N4GA 4YH3A 5E9VA 4YBSA 5F25A 5F1HA 4CUSA 4O78A 5FDZA 5D3RA 2L85A 4YATA 4QNSA 5DYXA 4YYDA 2E3KA 5FFWA 4Q0OA 5EQ1A 4NR8A 3U5LA 3JVMA 5HJCA 5DY7A 4J0RA 3LQIA 5HRVA 4ZW1A 5CQ4A 4C67A 5FE2A 5EPBA 5LKZA 3UVDA 4NUDA 5CQ7A 3QZTA 5CQ5A 5KTXA 4NYVA 4BW1A 4TQNA 4E96A 4O7EA 4QEWA 4CUUA 3P1CA 4XUAA 3QZVA 5JI8A 5D3NA 4A9NA 5LKXA 4HXSA 4UITA 4MEQA 5FE0A 5CS8A 5H1UA 5A81A 5CTLA 5L8UA 4HXPA 5C89A 4NYWA 4MR6A 4PS5A 4O7FA 5LVQA 4RVRA 5COIA 5LUUA 5D3SA 4KCXA
chains in the Genus database with same CATH superfamily
3D1DA 4XY8A 5TCMA 5D3LA 4AKNA 5HQ7A 5K29A 3I3JA 5ETBA 3D7CA 4UYFB 4CL9A 4TYLA 5H1TA 4TT2A 4YH4A 4CFLA 5AMFA 4X2IA 5F61A 4N4FA 4J3IA 5E3DA 4NUEA 5ENFA 4YBMA 4IR6A 4NUCA 2RNXA 5F60A 2NXBA 4BJXA 2EJNA 5HFRA 5C7NA 5EV9A 4QSQA 5LJ2A 5FE9A 5ENBA 4UYDA 5EISA 3AADA 3TLPA 4CUPA 4J1PA 4UIYA 4NXJA 5E7DA 4A9LA 3Q2EA 4NRBA 4YK0A 5F62A 4O7BA 5HCLA 4YYIA 4C66A 3MUKA 5EICA 4QSUA 4CUQA 2DWWA 4BHWA 4UIVA 4YY6A 4HXLA 4A9OA 4QUTA 4YYGA 1ZKRA 5H85A 5L8TA 5CUCA 4YYKA 5ENHA 3HMEA 4NRCA 4WHUA 4WHWA 5FE1A 5D3TA 4XY9A 5FG5A 5F3AA 5CQ6A 5C4QA 5DYAA 4A9MA 5HRWA 2E7NA 4QSSA 5D3JA 2YEMA 2D9EA 5ACYA 3AQAA 4AKIA 5EWCA 5FB0A 5HRXA 5I89A 4UYEA 5EWVA 5HQ5A 2F6JA 4QSWA 2RS9B 2F6NA 4IR4A 5DKHA 4QB3A 4HXMA 4O7CA 5CQ8A 4LZRA 4LZ2A 2RNWA 5DYUA 5C85A 3FKMX 4O72A 1F68A 4IR3A 5IG6A 2KTBB 4HXOA 5CUAA 3G0JA 4YBTA 4NR9A 3O34A 3O35A 4UIUA 4HBVA 4OUFA 4LYWA 4HXRA 4IR5A 5DYCA 4O75A 5IBNA 4BW2A 5DFBA 4Y03A 4QBMA 4MR5A 4IORA 5BT3A 3DAIA 3O36A 5DLXA 5CUEA 5I83A 2YEKA 4BW3A 4QC3A 2YW5A 5IIDA 5F36A 4QR4A 4NR6A 4O7AA 2R0VA 2DATA 5I7YA 4N4HA 4NQMA 1JSPB 2E7OA 5E9IA 5FFVA 4HBYA 5LJ0A 5A5QA 5EWDA 5FB1A 5CU8A 3UVYA 4HXKA 5A5SA 4HBXA 3P1DA 2YDWA 1ZS5A 4NQNA 5HM0A 5L96A 5FG6A 3U5MA 5J0DA 5FFYA 4QSRA 5D7XA 5G4SA 5D24A 5FH6A 3S92A 4J0SA 5ENEA 5A82A 5EPSA 2I8NA 4WIVA 2G4AA 4KV4A 5IGKA 4UIWA 5F1LA 5TB6A 3O33A 5F5ZA 4A9JA 4QSPA 3S91A 5E9KA 5AD2A 5DLZA 2I7KA 2OUOA 4DONA 5I86A 1WUGA 4A9IA 4QR5A 3UVWA 1PUOA 5FE6A 2DKWA 3ZYUA 5HQ6A 4N3WA 5CY9A 2FSAA 5G4RA 4O77A 4QSTA 4NR4A 4O76A 5HENA 4UYHA 4YADA 4QYDA 5FG4A 5KU3A 2WP2A 2RO1A 5EM3A 4YYJA 3O37A 5CRZA 4IOOA 5IGLA 5ENCA 4YABA 2L5EA 4NR5A 5HELA 4ALHA 3IU6A 4ZC9A 5EA1A 4UIXA 1N72A 4QEVA 5I1QA 5EWHA 4Z6HA 5E0RA 4NR7A 4LDFA 5I7XA 5CPEA 4YYHA 4QC1A 4O70A 3HMHA 4Z93A 5EU1A 3RCWA 4AKHA 5AMEA 5ENIA 2MJVB 4UIZA 5EI4A 5BT4A 5C8GA 5CUBA 5DFDA 4LZSA 3Q2FA 2N9GA 4HBWA 5KTUA 5IGMA 5CP5A 3LQHA 2DVVA 2LSPB 4PY6A 5CRMA 5C87A 4QZSA 3UW9A 4BW4A 3SVGA 2R0YA 2RI7A 3UV5A 5FH7A 4CFKA 1JM4B 5DFCA 1E6IA 5E9LA 4UYGA 2DVQA 5E9YA 2D82A 5JWMA 4XYAA 3NXBA 3U5KA 4YYMA 4Z1SA 5EVAA 5I29A 5DX4A 3U5JA 4QY4A 2YELA 3LJWA 2OSSA 5CQTA 5CUDA 4PCEA 5LJ1A 5IGNA 4CUTA 5FE7A 4TU6A 4LC2A 2L84A 2GRCA 5AD3A 3LXJA 4CLBA 1X0JA 5I88A 4Q0NA 4PCIA 3JVLA 3JVKA 4UYFA 5LVRA 3VKHA 4MEPA 4XUBA 5DKDA 3GG3A 3U5PA 4A9HA 3MXFA 3UV4A 4ALGA 4YYNA 5I80A 2RFJA 4A9KA 5E73A 5F63A 2RNYA 3QZSA 5FE5A 4NS5A 5KO4A 4GPJA 5FE3A 5A83A 5FE4A 4YC9A 4CURA 4MEOA 5LKTA 3U5OA 4KV1A 5A7CA 5KHMA 3JVJA 3DWYA 5DBMA 5EK9A 5II2A 4YY4A 2OO1A 4LR6A 2WP1A 4PTBA 4A9EA 5ENJA 5ETDA 5II1A 4QUUA 4TTEA 3SVHA 5F2PA 4TT6A 2R0SA 4LYSA 5A5NA 5ENGA 5EGUA 4QSVA 3P1EA 5FBXA 5DW2A 5L97A 5H1VA 3UV2A 4Z6IA 4Z1QA 1WUMA 4LYIA 3IU5A 4OGIA 3G0LA 5L99A 5CUGA 4AKGA 5A5OA 3ERRA 5E9MA 5D3PA 5FE8A 4MR3A 5EPRA 4TU4A 5D26A 2R10A 3UVXA 3P5OA 5D3HA 5D25A 5HFQA 4AI6A 4NRAA 3ONIA 4TT4A 5I40A 3U5NA 5L98A 4MENA 4O74A 5A5PA 5CFWA 2DVRA 3MB3A 5E3GA 4O71A 3LQJA 5EWWA 3K2JA 2YYNA 1EQFA 4QEUA 5CQ3A 5CGPA 4OGJA 4A9FA 3SVFA 4QYLA 3MB4A 3MULA 3MQMA 5E74A 5CQAA 4ZQLA 4LRGA 5DKCA 4FLPA 5HLSA 4YAXA 4TZ8A 5A5RA 4MR4A 4QR3A 5CZGA 3D1BA 2H60A 3P1FA 4IOQA 5FH8A 4TZ2A 3HMFA 4PKLA 5BT5A 5DW1A 4NYXA 2DVSA 5A85A 2YQDA 5EP7A 5HEMA 4F3IA 5KTWA 4TS8A 5D0CA 5LKUA 4N4IA 4QSXA 3VKGA 4HXNA 4N4GA 4YH3A 5E9VA 4YBSA 5F25A 5F1HA 4CUSA 4O78A 5FDZA 5D3RA 2L85A 4YATA 4QNSA 5DYXA 4YYDA 2E3KA 5FFWA 4Q0OA 5EQ1A 4NR8A 3U5LA 3JVMA 5HJCA 5DY7A 4J0RA 3LQIA 5HRVA 4ZW1A 5CQ4A 4C67A 5FE2A 5EPBA 5LKZA 3UVDA 4NUDA 5CQ7A 3QZTA 5CQ5A 5KTXA 4NYVA 4BW1A 4TQNA 4E96A 4O7EA 4QEWA 4CUUA 3P1CA 4XUAA 3QZVA 5JI8A 5D3NA 4A9NA 5LKXA 4HXSA 4UITA 4MEQA 5FE0A 5CS8A 5H1UA 5A81A 5CTLA 5L8UA 4HXPA 5C89A 4NYWA 4MR6A 4PS5A 4O7FA 5LVQA 4RVRA 5COIA 5LUUA 5D3SA 4KCXA
chains in the Genus database with same CATH topology
4XY8A 5TCMA 5D3LA 4AKNA 5HQ7A 5K29A 3I3JA 5ETBA 3D7CA 4UYFB 4CL9A 4TYLA 5H1TA 4TT2A 4YH4A 4CFLA 5AMFA 4X2IA 5F61A 4N4FA 4J3IA 5E3DA 4NUEA 5ENFA 4YBMA 4IR6A 4NUCA 2RNXA 5F60A 2NXBA 4BJXA 5HFRA 5C7NA 5EV9A 4QSQA 5LJ2A 5FE9A 5ENBA 4UYDA 5EISA 3AADA 3TLPA 4CUPA 4J1PA 4UIYA 4NXJA 5E7DA 4A9LA 3Q2EA 4NRBA 4YK0A 5F62A 4O7BA 5HCLA 4YYIA 4C66A 3MUKA 5EICA 4QSUA 4CUQA 2DWWA 4BHWA 4UIVA 4YY6A 4HXLA 4A9OA 4QUTA 4YYGA 5H85A 5L8TA 5CUCA 4YYKA 5ENHA 3HMEA 4NRCA 4WHUA 4WHWA 5FE1A 5D3TA 4XY9A 5FG5A 5F3AA 5CQ6A 5C4QA 5DYAA 4A9MA 5HRWA 2E7NA 4QSSA 5D3JA 2YEMA 2D9EA 5ACYA 3AQAA 5EWCA 5FB0A 5HRXA 5I89A 4UYEA 5EWVA 5HQ5A 2F6JA 4QSWA 2RS9B 2F6NA 4IR4A 5DKHA 4QB3A 4HXMA 4O7CA 5CQ8A 4LZRA 4LZ2A 2RNWA 5DYUA 5C85A 3FKMX 4O72A 1F68A 4IR3A 5IG6A 2KTBB 4HXOA 5CUAA 3G0JA 4YBTA 4NR9A 3O34A 3O35A 4UIUA 4HBVA 4OUFA 4LYWA 4HXRA 4IR5A 5DYCA 4O75A 5IBNA 4BW2A 5DFBA 4Y03A 4QBMA 4MR5A 4IORA 5BT3A 3DAIA 3O36A 5DLXA 5CUEA 5I83A 2YEKA 4BW3A 4QC3A 2YW5A 5IIDA 5F36A 4QR4A 4NR6A 4O7AA 2R0VA 2DATA 5I7YA 4N4HA 4NQMA 1JSPB 2E7OA 5E9IA 5FFVA 4HBYA 5LJ0A 5A5QA 5EWDA 5FB1A 5CU8A 3UVYA 4HXKA 5A5SA 4HBXA 3P1DA 2YDWA 1ZS5A 4NQNA 5HM0A 5L96A 5FG6A 3U5MA 5J0DA 5FFYA 4QSRA 5D7XA 5G4SA 5D24A 5FH6A 3S92A 4J0SA 5ENEA 5A82A 5EPSA 2I8NA 4WIVA 2G4AA 4KV4A 5IGKA 4UIWA 5F1LA 5TB6A 3O33A 5F5ZA 4A9JA 4QSPA 3S91A 5E9KA 5AD2A 5DLZA 2I7KA 2OUOA 4DONA 5I86A 1WUGA 4A9IA 4QR5A 3UVWA 5FE6A 2DKWA 3ZYUA 5HQ6A 4N3WA 5CY9A 2FSAA 5G4RA 4O77A 4QSTA 4NR4A 4O76A 5HENA 4UYHA 4YADA 4QYDA 5FG4A 5KU3A 2WP2A 2RO1A 5EM3A 4YYJA 3O37A 5CRZA 4IOOA 5IGLA 5ENCA 4YABA 2L5EA 4NR5A 5HELA 4ALHA 3IU6A 4ZC9A 5EA1A 4UIXA 1N72A 4QEVA 5I1QA 5EWHA 4Z6HA 5E0RA 4NR7A 4LDFA 5I7XA 5CPEA 4YYHA 4QC1A 4O70A 3HMHA 4Z93A 5EU1A 3RCWA 5AMEA 5ENIA 2MJVB 4UIZA 5EI4A 5BT4A 5C8GA 5CUBA 5DFDA 4LZSA 3Q2FA 2N9GA 4HBWA 5KTUA 5IGMA 5CP5A 3LQHA 2DVVA 2LSPB 4PY6A 5CRMA 5C87A 4QZSA 3UW9A 4BW4A 3SVGA 2R0YA 2RI7A 3UV5A 5FH7A 4CFKA 1JM4B 5DFCA 1E6IA 5E9LA 4UYGA 2DVQA 5E9YA 2D82A 5JWMA 4XYAA 3NXBA 3U5KA 4YYMA 4Z1SA 5EVAA 5I29A 5DX4A 3U5JA 4QY4A 2YELA 3LJWA 2OSSA 5CQTA 5CUDA 4PCEA 5LJ1A 5IGNA 4CUTA 5FE7A 4TU6A 4LC2A 2L84A 2GRCA 5AD3A 3LXJA 4CLBA 1X0JA 5I88A 4Q0NA 4PCIA 3JVLA 3JVKA 4UYFA 5LVRA 4MEPA 4XUBA 5DKDA 3GG3A 3U5PA 4A9HA 3MXFA 3UV4A 4ALGA 4YYNA 5I80A 2RFJA 4A9KA 5E73A 5F63A 2RNYA 3QZSA 5FE5A 4NS5A 5KO4A 4GPJA 5FE3A 5A83A 5FE4A 4YC9A 4CURA 4MEOA 5LKTA 3U5OA 4KV1A 5A7CA 5KHMA 3JVJA 3DWYA 5DBMA 5EK9A 5II2A 4YY4A 2OO1A 4LR6A 2WP1A 4PTBA 4A9EA 5ENJA 5ETDA 5II1A 4QUUA 4TTEA 3SVHA 5F2PA 4TT6A 2R0SA 4LYSA 5A5NA 5ENGA 5EGUA 4QSVA 3P1EA 5FBXA 5DW2A 5L97A 5H1VA 3UV2A 4Z6IA 4Z1QA 1WUMA 4LYIA 3IU5A 4OGIA 3G0LA 5L99A 5CUGA 5A5OA 5E9MA 5D3PA 5FE8A 4MR3A 5EPRA 4TU4A 5D26A 2R10A 3UVXA 3P5OA 5D3HA 5D25A 5HFQA 4NRAA 3ONIA 4TT4A 5I40A 3U5NA 5L98A 4MENA 4O74A 5A5PA 5CFWA 2DVRA 3MB3A 5E3GA 4O71A 3LQJA 5EWWA 3K2JA 2YYNA 1EQFA 4QEUA 5CQ3A 5CGPA 4OGJA 4A9FA 3SVFA 4QYLA 3MB4A 3MULA 3MQMA 5E74A 5CQAA 4ZQLA 4LRGA 5DKCA 4FLPA 5HLSA 4YAXA 4TZ8A 5A5RA 4MR4A 4QR3A 5CZGA 2H60A 3P1FA 4IOQA 5FH8A 4TZ2A 3HMFA 4PKLA 5BT5A 5DW1A 4NYXA 2DVSA 5A85A 2YQDA 5EP7A 5HEMA 4F3IA 5KTWA 4TS8A 5D0CA 5LKUA 4N4IA 4QSXA 4HXNA 4N4GA 4YH3A 5E9VA 4YBSA 5F25A 5F1HA 4CUSA 4O78A 5FDZA 5D3RA 2L85A 4YATA 4QNSA 5DYXA 4YYDA 2E3KA 5FFWA 4Q0OA 5EQ1A 4NR8A 3U5LA 3JVMA 5HJCA 5DY7A 4J0RA 3LQIA 5HRVA 4ZW1A 5CQ4A 4C67A 5FE2A 5EPBA 5LKZA 3UVDA 4NUDA 5CQ7A 3QZTA 5CQ5A 5KTXA 4NYVA 4BW1A 4TQNA 4E96A 4O7EA 4QEWA 4CUUA 3P1CA 4XUAA 3QZVA 5JI8A 5D3NA 4A9NA 5LKXA 4HXSA 4UITA 4MEQA 5FE0A 5CS8A 5H1UA 5A81A 5CTLA 5L8UA 4HXPA 5C89A 4NYWA 4MR6A 4PS5A 4O7FA 5LVQA 4RVRA 5COIA 5LUUA 5D3SA 4KCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XY8 A;  5TCM A;  5D3L A;  4AKN A;  5HQ7 A;  5K29 A;  3I3J A;  5ETB A;  3D7C A;  4UYF B;  4CL9 A;  4TYL A;  5H1T A;  4TT2 A;  4YH4 A;  4CFL A;  5AMF A;  4X2I A;  5F61 A;  4N4F A;  4J3I A;  5E3D A;  4NUE A;  5ENF A;  4YBM A;  4IR6 A;  4NUC A;  2RNX A;  5F60 A;  2NXB A;  4BJX A;  5HFR A;  5C7N A;  5EV9 A;  4QSQ A;  5LJ2 A;  5FE9 A;  5ENB A;  4UYD A;  5EIS A;  3AAD A;  3TLP A;  4CUP A;  4J1P A;  4UIY A;  4NXJ A;  5E7D A;  4A9L A;  3Q2E A;  4NRB A;  4YK0 A;  5F62 A;  4O7B A;  5HCL A;  4YYI A;  4C66 A;  3MUK A;  5EIC A;  4QSU A;  4CUQ A;  2DWW A;  4BHW A;  4UIV A;  4YY6 A;  4HXL A;  4A9O A;  4QUT A;  4YYG A;  5H85 A;  5L8T A;  5CUC A;  4YYK A;  5ENH A;  3HME A;  4NRC A;  4WHU A;  4WHW A;  5FE1 A;  5D3T A;  4XY9 A;  5FG5 A;  5F3A A;  5CQ6 A;  5C4Q A;  5DYA A;  4A9M A;  5HRW A;  2E7N A;  4QSS A;  5D3J A;  2YEM A;  2D9E A;  5ACY A;  3AQA A;  5EWC A;  5FB0 A;  5HRX A;  5I89 A;  4UYE A;  5EWV A;  5HQ5 A;  2F6J A;  4QSW A;  2RS9 B;  2F6N A;  4IR4 A;  5DKH A;  4QB3 A;  4HXM A;  4O7C A;  5CQ8 A;  4LZR A;  4LZ2 A;  2RNW A;  5DYU A;  5C85 A;  3FKM X;  4O72 A;  1F68 A;  4IR3 A;  5IG6 A;  2KTB B;  4HXO A;  5CUA A;  3G0J A;  4YBT A;  4NR9 A;  3O34 A;  3O35 A;  4UIU A;  4HBV A;  4OUF A;  4LYW A;  4HXR A;  4IR5 A;  5DYC A;  4O75 A;  5IBN A;  4BW2 A;  5DFB A;  4Y03 A;  4QBM A;  4MR5 A;  4IOR A;  5BT3 A;  3DAI A;  3O36 A;  5DLX A;  5CUE A;  5I83 A;  2YEK A;  4BW3 A;  4QC3 A;  2YW5 A;  5IID A;  5F36 A;  4QR4 A;  4NR6 A;  4O7A A;  2R0V A;  2DAT A;  5I7Y A;  4N4H A;  4NQM A;  1JSP B;  2E7O A;  5E9I A;  5FFV A;  4HBY A;  5LJ0 A;  5A5Q A;  5EWD A;  5FB1 A;  5CU8 A;  3UVY A;  4HXK A;  5A5S A;  4HBX A;  3P1D A;  2YDW A;  1ZS5 A;  4NQN A;  5HM0 A;  5L96 A;  5FG6 A;  3U5M A;  5J0D A;  5FFY A;  4QSR A;  5D7X A;  5G4S A;  5D24 A;  5FH6 A;  3S92 A;  4J0S A;  5ENE A;  5A82 A;  5EPS A;  2I8N A;  4WIV A;  2G4A A;  4KV4 A;  5IGK A;  4UIW A;  5F1L A;  5TB6 A;  3O33 A;  5F5Z A;  4A9J A;  4QSP A;  3S91 A;  5E9K A;  5AD2 A;  5DLZ A;  2I7K A;  2OUO A;  4DON A;  5I86 A;  1WUG A;  4A9I A;  4QR5 A;  3UVW A;  5FE6 A;  2DKW A;  3ZYU A;  5HQ6 A;  4N3W A;  5CY9 A;  2FSA A;  5G4R A;  4O77 A;  4QST A;  4NR4 A;  4O76 A;  5HEN A;  4UYH A;  4YAD A;  4QYD A;  5FG4 A;  5KU3 A;  2WP2 A;  2RO1 A;  5EM3 A;  4YYJ A;  3O37 A;  5CRZ A;  4IOO A;  5IGL A;  5ENC A;  4YAB A;  2L5E A;  4NR5 A;  5HEL A;  4ALH A;  3IU6 A;  4ZC9 A;  5EA1 A;  4UIX A;  1N72 A;  4QEV A;  5I1Q A;  5EWH A;  4Z6H A;  5E0R A;  4NR7 A;  4LDF A;  5I7X A;  5CPE A;  4YYH A;  4QC1 A;  4O70 A;  3HMH A;  4Z93 A;  5EU1 A;  3RCW A;  5AME A;  5ENI A;  2MJV B;  4UIZ A;  5EI4 A;  5BT4 A;  5C8G A;  5CUB A;  5DFD A;  4LZS A;  3Q2F A;  2N9G A;  4HBW A;  5KTU A;  5IGM A;  5CP5 A;  3LQH A;  2DVV A;  2LSP B;  4PY6 A;  5CRM A;  5C87 A;  4QZS A;  3UW9 A;  4BW4 A;  3SVG A;  2R0Y A;  2RI7 A;  3UV5 A;  5FH7 A;  4CFK A;  1JM4 B;  5DFC A;  1E6I A;  5E9L A;  4UYG A;  2DVQ A;  5E9Y A;  2D82 A;  5JWM A;  4XYA A;  3NXB A;  3U5K A;  4YYM A;  4Z1S A;  5EVA A;  5I29 A;  5DX4 A;  3U5J A;  4QY4 A;  2YEL A;  3LJW A;  2OSS A;  5CQT A;  5CUD A;  4PCE A;  5LJ1 A;  5IGN A;  4CUT A;  5FE7 A;  4TU6 A;  4LC2 A;  2L84 A;  2GRC A;  5AD3 A;  3LXJ A;  4CLB A;  1X0J A;  5I88 A;  4Q0N A;  4PCI A;  3JVL A;  3JVK A;  4UYF A;  5LVR A;  4MEP A;  4XUB A;  5DKD A;  3GG3 A;  3U5P A;  4A9H A;  3MXF A;  3UV4 A;  4ALG A;  4YYN A;  5I80 A;  2RFJ A;  4A9K A;  5E73 A;  5F63 A;  2RNY A;  3QZS A;  5FE5 A;  4NS5 A;  5KO4 A;  4GPJ A;  5FE3 A;  5A83 A;  5FE4 A;  4YC9 A;  4CUR A;  4MEO A;  5LKT A;  3U5O A;  4KV1 A;  5A7C A;  5KHM A;  3JVJ A;  3DWY A;  5DBM A;  5EK9 A;  5II2 A;  4YY4 A;  2OO1 A;  4LR6 A;  2WP1 A;  4PTB A;  4A9E A;  5ENJ A;  5ETD A;  5II1 A;  4QUU A;  4TTE A;  3SVH A;  5F2P A;  4TT6 A;  2R0S A;  4LYS A;  5A5N A;  5ENG A;  5EGU A;  4QSV A;  3P1E A;  5FBX A;  5DW2 A;  5L97 A;  5H1V A;  3UV2 A;  4Z6I A;  4Z1Q A;  1WUM A;  4LYI A;  3IU5 A;  4OGI A;  3G0L A;  5L99 A;  5CUG A;  5A5O A;  5E9M A;  5D3P A;  5FE8 A;  4MR3 A;  5EPR A;  4TU4 A;  5D26 A;  2R10 A;  3UVX A;  3P5O A;  5D3H A;  5D25 A;  5HFQ A;  4NRA A;  3ONI A;  4TT4 A;  5I40 A;  3U5N A;  5L98 A;  4MEN A;  4O74 A;  5A5P A;  5CFW A;  2DVR A;  3MB3 A;  5E3G A;  4O71 A;  3LQJ A;  5EWW A;  3K2J A;  2YYN A;  1EQF A;  4QEU A;  5CQ3 A;  5CGP A;  4OGJ A;  4A9F A;  3SVF A;  4QYL A;  3MB4 A;  3MUL A;  3MQM A;  5E74 A;  5CQA A;  4ZQL A;  4LRG A;  5DKC A;  4FLP A;  5HLS A;  4YAX A;  4TZ8 A;  5A5R A;  4MR4 A;  4QR3 A;  5CZG A;  2H60 A;  3P1F A;  4IOQ A;  5FH8 A;  4TZ2 A;  3HMF A;  4PKL A;  5BT5 A;  5DW1 A;  4NYX A;  2DVS A;  5A85 A;  2YQD A;  5EP7 A;  5HEM A;  4F3I A;  5KTW A;  4TS8 A;  5D0C A;  5LKU A;  4N4I A;  4QSX A;  4HXN A;  4N4G A;  4YH3 A;  5E9V A;  4YBS A;  5F25 A;  5F1H A;  4CUS A;  4O78 A;  5FDZ A;  5D3R A;  2L85 A;  4YAT A;  4QNS A;  5DYX A;  4YYD A;  2E3K A;  5FFW A;  4Q0O A;  5EQ1 A;  4NR8 A;  3U5L A;  3JVM A;  5HJC A;  5DY7 A;  4J0R A;  3LQI A;  5HRV A;  4ZW1 A;  5CQ4 A;  4C67 A;  5FE2 A;  5EPB A;  5LKZ A;  3UVD A;  4NUD A;  5CQ7 A;  3QZT A;  5CQ5 A;  5KTX A;  4NYV A;  4BW1 A;  4TQN A;  4E96 A;  4O7E A;  4QEW A;  4CUU A;  3P1C A;  4XUA A;  3QZV A;  5JI8 A;  5D3N A;  4A9N A;  5LKX A;  4HXS A;  4UIT A;  4MEQ A;  5FE0 A;  5CS8 A;  5H1U A;  5A81 A;  5CTL A;  5L8U A;  4HXP A;  5C89 A;  4NYW A;  4MR6 A;  4PS5 A;  4O7F A;  5LVQ A;  4RVR A;  5COI A;  5LUU A;  5D3S A;  4KCX A; 
#chains in the Genus database with same CATH topology
 3D1D A;  4XY8 A;  5TCM A;  5D3L A;  4AKN A;  5HQ7 A;  5K29 A;  3I3J A;  5ETB A;  3D7C A;  4UYF B;  4CL9 A;  4TYL A;  5H1T A;  4TT2 A;  4YH4 A;  4CFL A;  5AMF A;  4X2I A;  5F61 A;  4N4F A;  4J3I A;  5E3D A;  4NUE A;  5ENF A;  4YBM A;  4IR6 A;  4NUC A;  2RNX A;  5F60 A;  2NXB A;  4BJX A;  2EJN A;  5HFR A;  5C7N A;  5EV9 A;  4QSQ A;  5LJ2 A;  5FE9 A;  5ENB A;  4UYD A;  5EIS A;  3AAD A;  3TLP A;  4CUP A;  4J1P A;  4UIY A;  4NXJ A;  5E7D A;  4A9L A;  3Q2E A;  4NRB A;  4YK0 A;  5F62 A;  4O7B A;  5HCL A;  4YYI A;  4C66 A;  3MUK A;  5EIC A;  4QSU A;  4CUQ A;  2DWW A;  4BHW A;  4UIV A;  4YY6 A;  4HXL A;  4A9O A;  4QUT A;  4YYG A;  1ZKR A;  5H85 A;  5L8T A;  5CUC A;  4YYK A;  5ENH A;  3HME A;  4NRC A;  4WHU A;  4WHW A;  5FE1 A;  5D3T A;  4XY9 A;  5FG5 A;  5F3A A;  5CQ6 A;  5C4Q A;  5DYA A;  4A9M A;  5HRW A;  2E7N A;  4QSS A;  5D3J A;  2YEM A;  2D9E A;  5ACY A;  3AQA A;  4AKI A;  5EWC A;  5FB0 A;  5HRX A;  5I89 A;  4UYE A;  5EWV A;  5HQ5 A;  2F6J A;  4QSW A;  2RS9 B;  2F6N A;  4IR4 A;  5DKH A;  4QB3 A;  4HXM A;  4O7C A;  5CQ8 A;  4LZR A;  4LZ2 A;  2RNW A;  5DYU A;  5C85 A;  3FKM X;  4O72 A;  1F68 A;  4IR3 A;  5IG6 A;  2KTB B;  4HXO A;  5CUA A;  3G0J A;  4YBT A;  4NR9 A;  3O34 A;  3O35 A;  4UIU A;  4HBV A;  4OUF A;  4LYW A;  4HXR A;  4IR5 A;  5DYC A;  4O75 A;  5IBN A;  4BW2 A;  5DFB A;  4Y03 A;  4QBM A;  4MR5 A;  4IOR A;  5BT3 A;  3DAI A;  3O36 A;  5DLX A;  5CUE A;  5I83 A;  2YEK A;  4BW3 A;  4QC3 A;  2YW5 A;  5IID A;  5F36 A;  4QR4 A;  4NR6 A;  4O7A A;  2R0V A;  2DAT A;  5I7Y A;  4N4H A;  4NQM A;  1JSP B;  2E7O A;  5E9I A;  5FFV A;  4HBY A;  5LJ0 A;  5A5Q A;  5EWD A;  5FB1 A;  5CU8 A;  3UVY A;  4HXK A;  5A5S A;  4HBX A;  3P1D A;  2YDW A;  1ZS5 A;  4NQN A;  5HM0 A;  5L96 A;  5FG6 A;  3U5M A;  5J0D A;  5FFY A;  4QSR A;  5D7X A;  5G4S A;  5D24 A;  5FH6 A;  3S92 A;  4J0S A;  5ENE A;  5A82 A;  5EPS A;  2I8N A;  4WIV A;  2G4A A;  4KV4 A;  5IGK A;  4UIW A;  5F1L A;  5TB6 A;  3O33 A;  5F5Z A;  4A9J A;  4QSP A;  3S91 A;  5E9K A;  5AD2 A;  5DLZ A;  2I7K A;  2OUO A;  4DON A;  5I86 A;  1WUG A;  4A9I A;  4QR5 A;  3UVW A;  1PUO A;  5FE6 A;  2DKW A;  3ZYU A;  5HQ6 A;  4N3W A;  5CY9 A;  2FSA A;  5G4R A;  4O77 A;  4QST A;  4NR4 A;  4O76 A;  5HEN A;  4UYH A;  4YAD A;  4QYD A;  5FG4 A;  5KU3 A;  2WP2 A;  2RO1 A;  5EM3 A;  4YYJ A;  3O37 A;  5CRZ A;  4IOO A;  5IGL A;  5ENC A;  4YAB A;  2L5E A;  4NR5 A;  5HEL A;  4ALH A;  3IU6 A;  4ZC9 A;  5EA1 A;  4UIX A;  1N72 A;  4QEV A;  5I1Q A;  5EWH A;  4Z6H A;  5E0R A;  4NR7 A;  4LDF A;  5I7X A;  5CPE A;  4YYH A;  4QC1 A;  4O70 A;  3HMH A;  4Z93 A;  5EU1 A;  3RCW A;  4AKH A;  5AME A;  5ENI A;  2MJV B;  4UIZ A;  5EI4 A;  5BT4 A;  5C8G A;  5CUB A;  5DFD A;  4LZS A;  3Q2F A;  2N9G A;  4HBW A;  5KTU A;  5IGM A;  5CP5 A;  3LQH A;  2DVV A;  2LSP B;  4PY6 A;  5CRM A;  5C87 A;  4QZS A;  3UW9 A;  4BW4 A;  3SVG A;  2R0Y A;  2RI7 A;  3UV5 A;  5FH7 A;  4CFK A;  1JM4 B;  5DFC A;  1E6I A;  5E9L A;  4UYG A;  2DVQ A;  5E9Y A;  2D82 A;  5JWM A;  4XYA A;  3NXB A;  3U5K A;  4YYM A;  4Z1S A;  5EVA A;  5I29 A;  5DX4 A;  3U5J A;  4QY4 A;  2YEL A;  3LJW A;  2OSS A;  5CQT A;  5CUD A;  4PCE A;  5LJ1 A;  5IGN A;  4CUT A;  5FE7 A;  4TU6 A;  4LC2 A;  2L84 A;  2GRC A;  5AD3 A;  3LXJ A;  4CLB A;  1X0J A;  5I88 A;  4Q0N A;  4PCI A;  3JVL A;  3JVK A;  4UYF A;  5LVR A;  3VKH A;  4MEP A;  4XUB A;  5DKD A;  3GG3 A;  3U5P A;  4A9H A;  3MXF A;  3UV4 A;  4ALG A;  4YYN A;  5I80 A;  2RFJ A;  4A9K A;  5E73 A;  5F63 A;  2RNY A;  3QZS A;  5FE5 A;  4NS5 A;  5KO4 A;  4GPJ A;  5FE3 A;  5A83 A;  5FE4 A;  4YC9 A;  4CUR A;  4MEO A;  5LKT A;  3U5O A;  4KV1 A;  5A7C A;  5KHM A;  3JVJ A;  3DWY A;  5DBM A;  5EK9 A;  5II2 A;  4YY4 A;  2OO1 A;  4LR6 A;  2WP1 A;  4PTB A;  4A9E A;  5ENJ A;  5ETD A;  5II1 A;  4QUU A;  4TTE A;  3SVH A;  5F2P A;  4TT6 A;  2R0S A;  4LYS A;  5A5N A;  5ENG A;  5EGU A;  4QSV A;  3P1E A;  5FBX A;  5DW2 A;  5L97 A;  5H1V A;  3UV2 A;  4Z6I A;  4Z1Q A;  1WUM A;  4LYI A;  3IU5 A;  4OGI A;  3G0L A;  5L99 A;  5CUG A;  4AKG A;  5A5O A;  3ERR A;  5E9M A;  5D3P A;  5FE8 A;  4MR3 A;  5EPR A;  4TU4 A;  5D26 A;  2R10 A;  3UVX A;  3P5O A;  5D3H A;  5D25 A;  5HFQ A;  4AI6 A;  4NRA A;  3ONI A;  4TT4 A;  5I40 A;  3U5N A;  5L98 A;  4MEN A;  4O74 A;  5A5P A;  5CFW A;  2DVR A;  3MB3 A;  5E3G A;  4O71 A;  3LQJ A;  5EWW A;  3K2J A;  2YYN A;  1EQF A;  4QEU A;  5CQ3 A;  5CGP A;  4OGJ A;  4A9F A;  3SVF A;  4QYL A;  3MB4 A;  3MUL A;  3MQM A;  5E74 A;  5CQA A;  4ZQL A;  4LRG A;  5DKC A;  4FLP A;  5HLS A;  4YAX A;  4TZ8 A;  5A5R A;  4MR4 A;  4QR3 A;  5CZG A;  3D1B A;  2H60 A;  3P1F A;  4IOQ A;  5FH8 A;  4TZ2 A;  3HMF A;  4PKL A;  5BT5 A;  5DW1 A;  4NYX A;  2DVS A;  5A85 A;  2YQD A;  5EP7 A;  5HEM A;  4F3I A;  5KTW A;  4TS8 A;  5D0C A;  5LKU A;  4N4I A;  4QSX A;  3VKG A;  4HXN A;  4N4G A;  4YH3 A;  5E9V A;  4YBS A;  5F25 A;  5F1H A;  4CUS A;  4O78 A;  5FDZ A;  5D3R A;  2L85 A;  4YAT A;  4QNS A;  5DYX A;  4YYD A;  2E3K A;  5FFW A;  4Q0O A;  5EQ1 A;  4NR8 A;  3U5L A;  3JVM A;  5HJC A;  5DY7 A;  4J0R A;  3LQI A;  5HRV A;  4ZW1 A;  5CQ4 A;  4C67 A;  5FE2 A;  5EPB A;  5LKZ A;  3UVD A;  4NUD A;  5CQ7 A;  3QZT A;  5CQ5 A;  5KTX A;  4NYV A;  4BW1 A;  4TQN A;  4E96 A;  4O7E A;  4QEW A;  4CUU A;  3P1C A;  4XUA A;  3QZV A;  5JI8 A;  5D3N A;  4A9N A;  5LKX A;  4HXS A;  4UIT A;  4MEQ A;  5FE0 A;  5CS8 A;  5H1U A;  5A81 A;  5CTL A;  5L8U A;  4HXP A;  5C89 A;  4NYW A;  4MR6 A;  4PS5 A;  4O7F A;  5LVQ A;  4RVR A;  5COI A;  5LUU A;  5D3S A;  4KCX A; 
#chains in the Genus database with same CATH homology
 4XY8 A;  5TCM A;  5D3L A;  4AKN A;  5HQ7 A;  5K29 A;  3I3J A;  5ETB A;  3D7C A;  4UYF B;  4CL9 A;  4TYL A;  5H1T A;  4TT2 A;  4YH4 A;  4CFL A;  5AMF A;  4X2I A;  5F61 A;  4N4F A;  4J3I A;  5E3D A;  4NUE A;  5ENF A;  4YBM A;  4IR6 A;  4NUC A;  2RNX A;  5F60 A;  2NXB A;  4BJX A;  5HFR A;  5C7N A;  5EV9 A;  4QSQ A;  5LJ2 A;  5FE9 A;  5ENB A;  4UYD A;  5EIS A;  3AAD A;  3TLP A;  4CUP A;  4J1P A;  4UIY A;  4NXJ A;  5E7D A;  4A9L A;  3Q2E A;  4NRB A;  4YK0 A;  5F62 A;  4O7B A;  5HCL A;  4YYI A;  4C66 A;  3MUK A;  5EIC A;  4QSU A;  4CUQ A;  2DWW A;  4BHW A;  4UIV A;  4YY6 A;  4HXL A;  4A9O A;  4QUT A;  4YYG A;  5H85 A;  5L8T A;  5CUC A;  4YYK A;  5ENH A;  3HME A;  4NRC A;  4WHU A;  4WHW A;  5FE1 A;  5D3T A;  4XY9 A;  5FG5 A;  5F3A A;  5CQ6 A;  5C4Q A;  5DYA A;  4A9M A;  5HRW A;  2E7N A;  4QSS A;  5D3J A;  2YEM A;  2D9E A;  5ACY A;  3AQA A;  5EWC A;  5FB0 A;  5HRX A;  5I89 A;  4UYE A;  5EWV A;  5HQ5 A;  2F6J A;  4QSW A;  2RS9 B;  2F6N A;  4IR4 A;  5DKH A;  4QB3 A;  4HXM A;  4O7C A;  5CQ8 A;  4LZR A;  4LZ2 A;  2RNW A;  5DYU A;  5C85 A;  3FKM X;  4O72 A;  1F68 A;  4IR3 A;  5IG6 A;  2KTB B;  4HXO A;  5CUA A;  3G0J A;  4YBT A;  4NR9 A;  3O34 A;  3O35 A;  4UIU A;  4HBV A;  4OUF A;  4LYW A;  4HXR A;  4IR5 A;  5DYC A;  4O75 A;  5IBN A;  4BW2 A;  5DFB A;  4Y03 A;  4QBM A;  4MR5 A;  4IOR A;  5BT3 A;  3DAI A;  3O36 A;  5DLX A;  5CUE A;  5I83 A;  2YEK A;  4BW3 A;  4QC3 A;  2YW5 A;  5IID A;  5F36 A;  4QR4 A;  4NR6 A;  4O7A A;  2R0V A;  2DAT A;  5I7Y A;  4N4H A;  4NQM A;  1JSP B;  2E7O A;  5E9I A;  5FFV A;  4HBY A;  5LJ0 A;  5A5Q A;  5EWD A;  5FB1 A;  5CU8 A;  3UVY A;  4HXK A;  5A5S A;  4HBX A;  3P1D A;  2YDW A;  1ZS5 A;  4NQN A;  5HM0 A;  5L96 A;  5FG6 A;  3U5M A;  5J0D A;  5FFY A;  4QSR A;  5D7X A;  5G4S A;  5D24 A;  5FH6 A;  3S92 A;  4J0S A;  5ENE A;  5A82 A;  5EPS A;  2I8N A;  4WIV A;  2G4A A;  4KV4 A;  5IGK A;  4UIW A;  5F1L A;  5TB6 A;  3O33 A;  5F5Z A;  4A9J A;  4QSP A;  3S91 A;  5E9K A;  5AD2 A;  5DLZ A;  2I7K A;  2OUO A;  4DON A;  5I86 A;  1WUG A;  4A9I A;  4QR5 A;  3UVW A;  5FE6 A;  2DKW A;  3ZYU A;  5HQ6 A;  4N3W A;  5CY9 A;  2FSA A;  5G4R A;  4O77 A;  4QST A;  4NR4 A;  4O76 A;  5HEN A;  4UYH A;  4YAD A;  4QYD A;  5FG4 A;  5KU3 A;  2WP2 A;  2RO1 A;  5EM3 A;  4YYJ A;  3O37 A;  5CRZ A;  4IOO A;  5IGL A;  5ENC A;  4YAB A;  2L5E A;  4NR5 A;  5HEL A;  4ALH A;  3IU6 A;  4ZC9 A;  5EA1 A;  4UIX A;  1N72 A;  4QEV A;  5I1Q A;  5EWH A;  4Z6H A;  5E0R A;  4NR7 A;  4LDF A;  5I7X A;  5CPE A;  4YYH A;  4QC1 A;  4O70 A;  3HMH A;  4Z93 A;  5EU1 A;  3RCW A;  5AME A;  5ENI A;  2MJV B;  4UIZ A;  5EI4 A;  5BT4 A;  5C8G A;  5CUB A;  5DFD A;  4LZS A;  3Q2F A;  2N9G A;  4HBW A;  5KTU A;  5IGM A;  5CP5 A;  3LQH A;  2DVV A;  2LSP B;  4PY6 A;  5CRM A;  5C87 A;  4QZS A;  3UW9 A;  4BW4 A;  3SVG A;  2R0Y A;  2RI7 A;  3UV5 A;  5FH7 A;  4CFK A;  1JM4 B;  5DFC A;  1E6I A;  5E9L A;  4UYG A;  2DVQ A;  5E9Y A;  2D82 A;  5JWM A;  4XYA A;  3NXB A;  3U5K A;  4YYM A;  4Z1S A;  5EVA A;  5I29 A;  5DX4 A;  3U5J A;  4QY4 A;  2YEL A;  3LJW A;  2OSS A;  5CQT A;  5CUD A;  4PCE A;  5LJ1 A;  5IGN A;  4CUT A;  5FE7 A;  4TU6 A;  4LC2 A;  2L84 A;  2GRC A;  5AD3 A;  3LXJ A;  4CLB A;  1X0J A;  5I88 A;  4Q0N A;  4PCI A;  3JVL A;  3JVK A;  4UYF A;  5LVR A;  4MEP A;  4XUB A;  5DKD A;  3GG3 A;  3U5P A;  4A9H A;  3MXF A;  3UV4 A;  4ALG A;  4YYN A;  5I80 A;  2RFJ A;  4A9K A;  5E73 A;  5F63 A;  2RNY A;  3QZS A;  5FE5 A;  4NS5 A;  5KO4 A;  4GPJ A;  5FE3 A;  5A83 A;  5FE4 A;  4YC9 A;  4CUR A;  4MEO A;  5LKT A;  3U5O A;  4KV1 A;  5A7C A;  5KHM A;  3JVJ A;  3DWY A;  5DBM A;  5EK9 A;  5II2 A;  4YY4 A;  2OO1 A;  4LR6 A;  2WP1 A;  4PTB A;  4A9E A;  5ENJ A;  5ETD A;  5II1 A;  4QUU A;  4TTE A;  3SVH A;  5F2P A;  4TT6 A;  2R0S A;  4LYS A;  5A5N A;  5ENG A;  5EGU A;  4QSV A;  3P1E A;  5FBX A;  5DW2 A;  5L97 A;  5H1V A;  3UV2 A;  4Z6I A;  4Z1Q A;  1WUM A;  4LYI A;  3IU5 A;  4OGI A;  3G0L A;  5L99 A;  5CUG A;  5A5O A;  5E9M A;  5D3P A;  5FE8 A;  4MR3 A;  5EPR A;  4TU4 A;  5D26 A;  2R10 A;  3UVX A;  3P5O A;  5D3H A;  5D25 A;  5HFQ A;  4NRA A;  3ONI A;  4TT4 A;  5I40 A;  3U5N A;  5L98 A;  4MEN A;  4O74 A;  5A5P A;  5CFW A;  2DVR A;  3MB3 A;  5E3G A;  4O71 A;  3LQJ A;  5EWW A;  3K2J A;  2YYN A;  1EQF A;  4QEU A;  5CQ3 A;  5CGP A;  4OGJ A;  4A9F A;  3SVF A;  4QYL A;  3MB4 A;  3MUL A;  3MQM A;  5E74 A;  5CQA A;  4ZQL A;  4LRG A;  5DKC A;  4FLP A;  5HLS A;  4YAX A;  4TZ8 A;  5A5R A;  4MR4 A;  4QR3 A;  5CZG A;  2H60 A;  3P1F A;  4IOQ A;  5FH8 A;  4TZ2 A;  3HMF A;  4PKL A;  5BT5 A;  5DW1 A;  4NYX A;  2DVS A;  5A85 A;  2YQD A;  5EP7 A;  5HEM A;  4F3I A;  5KTW A;  4TS8 A;  5D0C A;  5LKU A;  4N4I A;  4QSX A;  4HXN A;  4N4G A;  4YH3 A;  5E9V A;  4YBS A;  5F25 A;  5F1H A;  4CUS A;  4O78 A;  5FDZ A;  5D3R A;  2L85 A;  4YAT A;  4QNS A;  5DYX A;  4YYD A;  2E3K A;  5FFW A;  4Q0O A;  5EQ1 A;  4NR8 A;  3U5L A;  3JVM A;  5HJC A;  5DY7 A;  4J0R A;  3LQI A;  5HRV A;  4ZW1 A;  5CQ4 A;  4C67 A;  5FE2 A;  5EPB A;  5LKZ A;  3UVD A;  4NUD A;  5CQ7 A;  3QZT A;  5CQ5 A;  5KTX A;  4NYV A;  4BW1 A;  4TQN A;  4E96 A;  4O7E A;  4QEW A;  4CUU A;  3P1C A;  4XUA A;  3QZV A;  5JI8 A;  5D3N A;  4A9N A;  5LKX A;  4HXS A;  4UIT A;  4MEQ A;  5FE0 A;  5CS8 A;  5H1U A;  5A81 A;  5CTL A;  5L8U A;  4HXP A;  5C89 A;  4NYW A;  4MR6 A;  4PS5 A;  4O7F A;  5LVQ A;  4RVR A;  5COI A;  5LUU A;  5D3S A;  4KCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...