5KTXA

Crebbp bromodomain in complex with cpd59 ((s)-1-(3-((2-fluoro-4-(1-methyl-1h-pyrazol-4-yl)phenyl)amino)-1-(tetrahydrofuran-3-yl)-6,7-dihydro-1h-pyrazolo[4,3-c]pyridin-5(4h)-yl)ethanone)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
114
structure length
114
Chain Sequence
AAFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CREB-binding protein
publication title Discovery of a Potent and Selective in Vivo Probe (GNE-272) for the Bromodomains of CBP/EP300.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 114
sequence length 114
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ktxA00
4RVRA 5EICA 4YH4A 3TLPA 4DONA 4N3WA 3O34A 5F3AA 5C7NA 4MR6A 4UIWA 4NR7A 3IU5A 3QZVA 5DFDA 5FE2A 4O7CA 4CURA 3IU6A 2OSSA 5J0DA 5CGPA 4QEWA 5FE3A 5HM0A 4HXRA 5EI4A 3K2JA 4J0RA 4NQNA 5EP7A 5AMFA 1ZS5A 4BW2A 5CQ6A 5G4RA 5H85A 5DW1A 5L99A 4HBYA 5A5NA 4CFKA 3MUKA 5A5QA 4MEOA 2LSPB 5FE6A 5A82A 5HFRA 2YEMA 4NUDA 4XUAA 5DFBA 2GRCA 3LQJA 5KTUA 5E7DA 2FSAA 4O74A 4TT6A 2RNYA 5FH7A 4A9KA 4C66A 4XY8A 5CPEA 5ENJA 4QSXA 4QNSA 3LXJA 4YATA 5KTWA 5CU8A 5DY7A 3UV4A 3MULA 3NXBA 3JVLA 5LKZA 5BT5A 4QEUA 4O71A 2RS9B 4Q0OA 4TYLA 5A5RA 4UYFB 3O37A 5EISA 5L97A 5HQ5A 4NUCA 2E7NA 4YY6A 4F3IA 4A9IA 1N72A 5E9IA 5E9YA 5LVQA 5CQ7A 5KHMA 4QSTA 4YC9A 3O36A 4CUPA 5D3PA 5I80A 2YYNA 5H1UA 3FKMX 5CRMA 5FH8A 4N4IA 4YBMA 3P1DA 4QBMA 2RI7A 2YEKA 4YABA 4YYGA 5BT4A 3HMHA 5F36A 4NXJA 5LJ2A 4LZ2A 5K29A 4UYDA 4J0SA 2WP2A 5DYUA 5CS8A 5II1A 4X2IA 5E9MA 4XY9A 5CQTA 3MB4A 4YBSA 2E3KA 5FFVA 4UIUA 4NYWA 4OGJA 5HFQA 4UIZA 4HXLA 4BHWA 3ZYUA 2L85A 4N4FA 4CLBA 5KO4A 2I8NA 3MXFA 2WP1A 4NRAA 4HXOA 5IGKA 3G0JA 5EPBA 4WIVA 5II2A 4QR4A 4TT2A 5CUAA 5CQAA 5EPRA 5A5OA 5L96A 4Q0NA 2YQDA 4QY4A 1E6IA 5DLZA 2F6JA 4QSVA 4WHUA 4UIXA 4MEPA 4Z6HA 5HRXA 4YH3A 5EQ1A 4OGIA 5IGNA 4CFLA 1EQFA 4YADA 5FB0A 5FE9A 5D25A 5I1QA 4ZC9A 4TT4A 5CRZA 4MR5A 3UW9A 5FG5A 5LKTA 4NR5A 5IGLA 3HMEA 4MR4A 5A5SA 4QUTA 5ACYA 4NR8A 5F1HA 4NUEA 5I89A 3Q2FA 4NRCA 4QUUA 4TTEA 4ZQLA 4N4GA 5FFYA 5EM3A 5AMEA 5I29A 4IR5A 5LJ0A 5F62A 5HRWA 4CL9A 5I86A 5EWVA 4PTBA 2F6NA 4BW1A 2G4AA 4UIYA 5F1LA 3P5OA 5COIA 3U5PA 1F68A 4PKLA 5HEMA 5I88A 4NYXA 5A81A 4BW4A 4NR6A 5KTXA 5ENHA 1JSPB 3HMFA 3JVJA 5CQ3A 3MB3A 3U5LA 5AD3A 5HELA 4OUFA 2DWWA 5DYCA 5LKXA 5FE4A 4A9HA 5EPSA 4LYWA 5EWDA 4HBXA 5ETDA 3P1EA 5FG4A 5IIDA 2H60A 2DVQA 5TB6A 4A9EA 4NQMA 4QSPA 4NRBA 4A9NA 5D3TA 5KU3A 5EWHA 5DX4A 4A9MA 5CUEA 4GPJA 2RNXA 4Y03A 4J3IA 4UYHA 5IG6A 5HENA 5E3GA 4QR3A 4O77A 4PCEA 4YYDA 2RFJA 4E96A 3UVYA 4A9OA 4IOQA 4HBWA 5HQ6A 4KCXA 5HQ7A 5DKDA 2YELA 5A5PA 5D0CA 5DYAA 4QSWA 5A83A 3DAIA 3Q2EA 5ENFA 5FE7A 4O7AA 3D7CA 5I83A 5ENBA 5CP5A 4O7EA 5HCLA 5D3NA 4ALHA 5F60A 3S92A 2DATA 5E74A 2YW5A 3U5OA 4TU4A 4QSUA 5HJCA 4IORA 4XUBA 5HRVA 5LVRA 2R0YA 4QZSA 5G4SA 3UVDA 2RNWA 4LZSA 4MEQA 4LYSA 5BT3A 5CFWA 4HXMA 3QZSA 2KTBB 4YAXA 5CQ8A 2N9GA 4Z6IA 5I7YA 4ZW1A 2L5EA 4O76A 2DKWA 4HXSA 5D3LA 5FE8A 5E9VA 4XYAA 3G0LA 4C67A 4J1PA 5AD2A 5DLXA 5FBXA 4MENA 5F2PA 3RCWA 5C89A 3U5KA 5EGUA 3I3JA 5CQ4A 5D24A 3P1CA 4CUQA 5C87A 2RO1A 4YYKA 5EVAA 4WHWA 4PS5A 5EU1A 3DWYA 4A9JA 4KV1A 5E9KA 4YBTA 2R0VA 4UYGA 2D82A 3U5JA 4IR3A 4TS8A 4CUSA 4UIVA 4A9LA 4PCIA 3S91A 5TCMA 4O75A 3ONIA 5JWMA 4BJXA 5EWWA 3UV5A 4O72A 3LQIA 4Z93A 4QSRA 5L98A 5LKUA 5DKHA 3O33A 4LC2A 5ENGA 5CUBA 1WUGA 2OO1A 4LDFA 5D3SA 2R0SA 5DKCA 2DVRA 4YYHA 4YYNA 5E73A 5EA1A 2L84A 4KV4A 5FH6A 4LZRA 3GG3A 2D9EA 4HXKA 2I7KA 4FLPA 5I40A 5C4QA 4QSSA 5DW2A 4TU6A 5LJ1A 5ETBA 5F61A 1JM4B 5FE1A 4HXNA 4YY4A 4PY6A 5DFCA 5DYXA 5ENIA 4QEVA 3JVMA 5D3HA 3P1FA 5A85A 3MQMA 5L8TA 5CTLA 4LYIA 4QSQA 4O78A 5C8GA 4BW3A 5E3DA 5L8UA 5DBMA 4A9FA 5F5ZA 5CUCA 5D3JA 5F25A 4AKNA 4LR6A 5CY9A 5EWCA 3JVKA 1WUMA 5E9LA 3U5NA 5ENCA 5EK9A 4O7FA 4CUUA 3SVFA 3O35A 3SVGA 3UV2A 4N4HA 5CUGA 4IR4A 1X0JA 4QR5A 4LRGA 4UYFA 4TQNA 4CUTA 5E0RA 5H1TA 5LUUA 5FE5A 5HLSA 3UVXA 4Z1QA 4IOOA 4HBVA 2DVVA 5FFWA 2NXBA 4NYVA 3U5MA 4NR9A 4YYMA 5F63A 5I7XA 5FDZA 5EV9A 4QC3A 5FB1A 3UVWA 4QB3A 4UITA 5CZGA 4QC1A 3LQHA 4QYDA 2MJVB 4YK0A 4TZ2A 5A7CA 3AADA 5JI8A 5ENEA 2R10A 4NR4A 4ALGA 5D3RA 5IGMA 3LJWA 5IBNA 5C85A 5FG6A 5CQ5A 3SVHA 3QZTA 4TZ8A 4NS5A 5D7XA 5H1VA 5CUDA 4HXPA 4YYJA 4Z1SA 5D26A 2YDWA 2DVSA 4YYIA 2E7OA 4MR3A 4QYLA 4IR6A 2OUOA 3AQAA 4UYEA 4O7BA 5FE0A 4O70A
chains in the Genus database with same CATH superfamily
4RVRA 5EICA 4YH4A 3TLPA 4DONA 4N3WA 3O34A 5F3AA 5C7NA 4MR6A 4UIWA 4NR7A 3IU5A 3QZVA 5DFDA 5FE2A 4O7CA 4CURA 3IU6A 2OSSA 5J0DA 5CGPA 4QEWA 5FE3A 5HM0A 3VKHA 4HXRA 5EI4A 3K2JA 4J0RA 4NQNA 5EP7A 5AMFA 1ZS5A 4BW2A 5CQ6A 5G4RA 5H85A 5DW1A 5L99A 4HBYA 5A5NA 4CFKA 3MUKA 5A5QA 4MEOA 2LSPB 5FE6A 5A82A 5HFRA 2YEMA 4NUDA 4XUAA 5DFBA 2GRCA 3LQJA 5KTUA 5E7DA 2FSAA 4O74A 4TT6A 2RNYA 5FH7A 4A9KA 4C66A 4XY8A 5CPEA 5ENJA 4QSXA 4QNSA 3LXJA 4YATA 5KTWA 5CU8A 5DY7A 3UV4A 3MULA 3NXBA 3JVLA 5LKZA 5BT5A 4QEUA 4O71A 2RS9B 4Q0OA 4TYLA 5A5RA 4UYFB 3O37A 5EISA 5L97A 5HQ5A 4NUCA 2E7NA 4YY6A 4F3IA 4A9IA 1N72A 5E9IA 5E9YA 5LVQA 5CQ7A 5KHMA 4QSTA 4YC9A 3O36A 4CUPA 5D3PA 5I80A 2YYNA 5H1UA 3FKMX 5CRMA 5FH8A 4N4IA 4YBMA 3P1DA 4QBMA 2RI7A 2YEKA 4YABA 4YYGA 5BT4A 3HMHA 5F36A 4NXJA 5LJ2A 4LZ2A 5K29A 4UYDA 4J0SA 2WP2A 5DYUA 5CS8A 5II1A 4X2IA 5E9MA 4XY9A 5CQTA 3MB4A 4YBSA 2E3KA 5FFVA 4UIUA 4NYWA 4OGJA 5HFQA 4UIZA 4HXLA 4BHWA 3ZYUA 2L85A 4N4FA 4CLBA 5KO4A 2I8NA 3MXFA 2WP1A 4AKGA 4NRAA 4HXOA 5IGKA 3G0JA 5EPBA 4WIVA 5II2A 4QR4A 4TT2A 5CUAA 5CQAA 5EPRA 5A5OA 5L96A 4Q0NA 2YQDA 4QY4A 1E6IA 5DLZA 2F6JA 4QSVA 4AKHA 4WHUA 4UIXA 4MEPA 4Z6HA 5HRXA 4YH3A 5EQ1A 4OGIA 5IGNA 4CFLA 1EQFA 4YADA 5FB0A 5FE9A 5D25A 5I1QA 4ZC9A 4TT4A 5CRZA 4MR5A 3UW9A 5FG5A 5LKTA 4AI6A 4NR5A 5IGLA 3HMEA 4MR4A 5A5SA 4QUTA 5ACYA 4NR8A 5F1HA 4NUEA 5I89A 3Q2FA 4NRCA 4QUUA 4TTEA 4ZQLA 4N4GA 5FFYA 5EM3A 5AMEA 5I29A 4IR5A 5LJ0A 5F62A 5HRWA 4CL9A 5I86A 5EWVA 4PTBA 2F6NA 4BW1A 2G4AA 4UIYA 5F1LA 3P5OA 5COIA 3U5PA 1F68A 4PKLA 5HEMA 5I88A 4NYXA 3D1BA 5A81A 4BW4A 4NR6A 5KTXA 5ENHA 1JSPB 3HMFA 3JVJA 5CQ3A 3MB3A 3U5LA 5AD3A 5HELA 4OUFA 2DWWA 5DYCA 5LKXA 5FE4A 4A9HA 5EPSA 4LYWA 5EWDA 4HBXA 5ETDA 3P1EA 5FG4A 5IIDA 2H60A 2DVQA 5TB6A 4A9EA 4NQMA 4QSPA 4NRBA 4A9NA 5D3TA 5KU3A 5EWHA 5DX4A 4A9MA 5CUEA 4GPJA 2RNXA 4Y03A 4J3IA 4UYHA 5IG6A 5HENA 5E3GA 4QR3A 4O77A 4PCEA 4YYDA 2RFJA 4E96A 3UVYA 4A9OA 4IOQA 4HBWA 5HQ6A 4KCXA 5HQ7A 5DKDA 2YELA 5A5PA 5D0CA 5DYAA 4QSWA 5A83A 3DAIA 3Q2EA 5ENFA 5FE7A 4O7AA 3D7CA 3ERRA 5I83A 5ENBA 5CP5A 4O7EA 5HCLA 1PUOA 5D3NA 4ALHA 5F60A 3S92A 2DATA 5E74A 2YW5A 3U5OA 4TU4A 4QSUA 5HJCA 4IORA 1ZKRA 4XUBA 5HRVA 5LVRA 2R0YA 4QZSA 5G4SA 3UVDA 2RNWA 4LZSA 4MEQA 4LYSA 5BT3A 5CFWA 4HXMA 3QZSA 2KTBB 4YAXA 5CQ8A 2N9GA 4Z6IA 5I7YA 2EJNA 4ZW1A 2L5EA 4O76A 2DKWA 4HXSA 5D3LA 5FE8A 5E9VA 4XYAA 3G0LA 4C67A 4J1PA 5AD2A 5DLXA 5FBXA 4MENA 5F2PA 3RCWA 5C89A 3U5KA 5EGUA 3I3JA 5CQ4A 5D24A 3P1CA 4CUQA 5C87A 2RO1A 4YYKA 5EVAA 4WHWA 4PS5A 5EU1A 3DWYA 4A9JA 4KV1A 5E9KA 4YBTA 2R0VA 4UYGA 2D82A 3U5JA 3D1DA 4IR3A 4TS8A 4CUSA 4UIVA 4A9LA 4PCIA 3S91A 5TCMA 4O75A 3ONIA 5JWMA 4BJXA 5EWWA 3UV5A 4O72A 3LQIA 4Z93A 4QSRA 5L98A 5LKUA 5DKHA 3O33A 4LC2A 5ENGA 5CUBA 1WUGA 3VKGA 2OO1A 4LDFA 5D3SA 2R0SA 5DKCA 2DVRA 4YYHA 4YYNA 5E73A 5EA1A 2L84A 4KV4A 5FH6A 4LZRA 3GG3A 2D9EA 4HXKA 2I7KA 4FLPA 5I40A 5C4QA 4QSSA 5DW2A 4TU6A 5LJ1A 5ETBA 5F61A 1JM4B 5FE1A 4HXNA 4YY4A 4PY6A 5DFCA 5DYXA 5ENIA 4QEVA 3JVMA 5D3HA 3P1FA 5A85A 3MQMA 5L8TA 5CTLA 4LYIA 4QSQA 4O78A 5C8GA 4BW3A 5E3DA 5L8UA 5DBMA 4A9FA 5F5ZA 5CUCA 5D3JA 5F25A 4AKNA 4LR6A 5CY9A 5EWCA 3JVKA 1WUMA 5E9LA 3U5NA 5ENCA 5EK9A 4O7FA 4CUUA 3SVFA 3O35A 3SVGA 3UV2A 4N4HA 5CUGA 4IR4A 1X0JA 4QR5A 4LRGA 4UYFA 4TQNA 4CUTA 5E0RA 5H1TA 5LUUA 5FE5A 5HLSA 3UVXA 4Z1QA 4IOOA 4HBVA 2DVVA 5FFWA 2NXBA 4NYVA 3U5MA 4NR9A 4YYMA 5F63A 5I7XA 5FDZA 5EV9A 4QC3A 5FB1A 3UVWA 4QB3A 4UITA 5CZGA 4QC1A 3LQHA 4QYDA 2MJVB 4YK0A 4TZ2A 5A7CA 3AADA 5JI8A 5ENEA 2R10A 4NR4A 4ALGA 5D3RA 5IGMA 3LJWA 5IBNA 5C85A 5FG6A 5CQ5A 3SVHA 3QZTA 4TZ8A 4NS5A 5D7XA 5H1VA 5CUDA 4HXPA 4YYJA 4Z1SA 5D26A 2YDWA 2DVSA 4YYIA 4AKIA 2E7OA 4MR3A 4QYLA 4IR6A 2OUOA 3AQAA 4UYEA 4O7BA 5FE0A 4O70A
chains in the Genus database with same CATH topology
4RVRA 5EICA 4YH4A 3TLPA 4DONA 4N3WA 3O34A 5F3AA 5C7NA 4MR6A 4UIWA 4NR7A 3IU5A 3QZVA 5DFDA 5FE2A 4O7CA 4CURA 3IU6A 2OSSA 5J0DA 5CGPA 4QEWA 5FE3A 5HM0A 4HXRA 5EI4A 3K2JA 4J0RA 4NQNA 5EP7A 5AMFA 1ZS5A 4BW2A 5CQ6A 5G4RA 5H85A 5DW1A 5L99A 4HBYA 5A5NA 4CFKA 3MUKA 5A5QA 4MEOA 2LSPB 5FE6A 5A82A 5HFRA 2YEMA 4NUDA 4XUAA 5DFBA 2GRCA 3LQJA 5KTUA 5E7DA 2FSAA 4O74A 4TT6A 2RNYA 5FH7A 4A9KA 4C66A 4XY8A 5CPEA 5ENJA 4QSXA 4QNSA 3LXJA 4YATA 5KTWA 5CU8A 5DY7A 3UV4A 3MULA 3NXBA 3JVLA 5LKZA 5BT5A 4QEUA 4O71A 2RS9B 4Q0OA 4TYLA 5A5RA 4UYFB 3O37A 5EISA 5L97A 5HQ5A 4NUCA 2E7NA 4YY6A 4F3IA 4A9IA 1N72A 5E9IA 5E9YA 5LVQA 5CQ7A 5KHMA 4QSTA 4YC9A 3O36A 4CUPA 5D3PA 5I80A 2YYNA 5H1UA 3FKMX 5CRMA 5FH8A 4N4IA 4YBMA 3P1DA 4QBMA 2RI7A 2YEKA 4YABA 4YYGA 5BT4A 3HMHA 5F36A 4NXJA 5LJ2A 4LZ2A 5K29A 4UYDA 4J0SA 2WP2A 5DYUA 5CS8A 5II1A 4X2IA 5E9MA 4XY9A 5CQTA 3MB4A 4YBSA 2E3KA 5FFVA 4UIUA 4NYWA 4OGJA 5HFQA 4UIZA 4HXLA 4BHWA 3ZYUA 2L85A 4N4FA 4CLBA 5KO4A 2I8NA 3MXFA 2WP1A 4NRAA 4HXOA 5IGKA 3G0JA 5EPBA 4WIVA 5II2A 4QR4A 4TT2A 5CUAA 5CQAA 5EPRA 5A5OA 5L96A 4Q0NA 2YQDA 4QY4A 1E6IA 5DLZA 2F6JA 4QSVA 4WHUA 4UIXA 4MEPA 4Z6HA 5HRXA 4YH3A 5EQ1A 4OGIA 5IGNA 4CFLA 1EQFA 4YADA 5FB0A 5FE9A 5D25A 5I1QA 4ZC9A 4TT4A 5CRZA 4MR5A 3UW9A 5FG5A 5LKTA 4NR5A 5IGLA 3HMEA 4MR4A 5A5SA 4QUTA 5ACYA 4NR8A 5F1HA 4NUEA 5I89A 3Q2FA 4NRCA 4QUUA 4TTEA 4ZQLA 4N4GA 5FFYA 5EM3A 5AMEA 5I29A 4IR5A 5LJ0A 5F62A 5HRWA 4CL9A 5I86A 5EWVA 4PTBA 2F6NA 4BW1A 2G4AA 4UIYA 5F1LA 3P5OA 5COIA 3U5PA 1F68A 4PKLA 5HEMA 5I88A 4NYXA 5A81A 4BW4A 4NR6A 5KTXA 5ENHA 1JSPB 3HMFA 3JVJA 5CQ3A 3MB3A 3U5LA 5AD3A 5HELA 4OUFA 2DWWA 5DYCA 5LKXA 5FE4A 4A9HA 5EPSA 4LYWA 5EWDA 4HBXA 5ETDA 3P1EA 5FG4A 5IIDA 2H60A 2DVQA 5TB6A 4A9EA 4NQMA 4QSPA 4NRBA 4A9NA 5D3TA 5KU3A 5EWHA 5DX4A 4A9MA 5CUEA 4GPJA 2RNXA 4Y03A 4J3IA 4UYHA 5IG6A 5HENA 5E3GA 4QR3A 4O77A 4PCEA 4YYDA 2RFJA 4E96A 3UVYA 4A9OA 4IOQA 4HBWA 5HQ6A 4KCXA 5HQ7A 5DKDA 2YELA 5A5PA 5D0CA 5DYAA 4QSWA 5A83A 3DAIA 3Q2EA 5ENFA 5FE7A 4O7AA 3D7CA 5I83A 5ENBA 5CP5A 4O7EA 5HCLA 5D3NA 4ALHA 5F60A 3S92A 2DATA 5E74A 2YW5A 3U5OA 4TU4A 4QSUA 5HJCA 4IORA 4XUBA 5HRVA 5LVRA 2R0YA 4QZSA 5G4SA 3UVDA 2RNWA 4LZSA 4MEQA 4LYSA 5BT3A 5CFWA 4HXMA 3QZSA 2KTBB 4YAXA 5CQ8A 2N9GA 4Z6IA 5I7YA 4ZW1A 2L5EA 4O76A 2DKWA 4HXSA 5D3LA 5FE8A 5E9VA 4XYAA 3G0LA 4C67A 4J1PA 5AD2A 5DLXA 5FBXA 4MENA 5F2PA 3RCWA 5C89A 3U5KA 5EGUA 3I3JA 5CQ4A 5D24A 3P1CA 4CUQA 5C87A 2RO1A 4YYKA 5EVAA 4WHWA 4PS5A 5EU1A 3DWYA 4A9JA 4KV1A 5E9KA 4YBTA 2R0VA 4UYGA 2D82A 3U5JA 4IR3A 4TS8A 4CUSA 4UIVA 4A9LA 4PCIA 3S91A 5TCMA 4O75A 3ONIA 5JWMA 4BJXA 5EWWA 3UV5A 4O72A 3LQIA 4Z93A 4QSRA 5L98A 5LKUA 5DKHA 3O33A 4LC2A 5ENGA 5CUBA 1WUGA 2OO1A 4LDFA 5D3SA 2R0SA 5DKCA 2DVRA 4YYHA 4YYNA 5E73A 5EA1A 2L84A 4KV4A 5FH6A 4LZRA 3GG3A 2D9EA 4HXKA 2I7KA 4FLPA 5I40A 5C4QA 4QSSA 5DW2A 4TU6A 5LJ1A 5ETBA 5F61A 1JM4B 5FE1A 4HXNA 4YY4A 4PY6A 5DFCA 5DYXA 5ENIA 4QEVA 3JVMA 5D3HA 3P1FA 5A85A 3MQMA 5L8TA 5CTLA 4LYIA 4QSQA 4O78A 5C8GA 4BW3A 5E3DA 5L8UA 5DBMA 4A9FA 5F5ZA 5CUCA 5D3JA 5F25A 4AKNA 4LR6A 5CY9A 5EWCA 3JVKA 1WUMA 5E9LA 3U5NA 5ENCA 5EK9A 4O7FA 4CUUA 3SVFA 3O35A 3SVGA 3UV2A 4N4HA 5CUGA 4IR4A 1X0JA 4QR5A 4LRGA 4UYFA 4TQNA 4CUTA 5E0RA 5H1TA 5LUUA 5FE5A 5HLSA 3UVXA 4Z1QA 4IOOA 4HBVA 2DVVA 5FFWA 2NXBA 4NYVA 3U5MA 4NR9A 4YYMA 5F63A 5I7XA 5FDZA 5EV9A 4QC3A 5FB1A 3UVWA 4QB3A 4UITA 5CZGA 4QC1A 3LQHA 4QYDA 2MJVB 4YK0A 4TZ2A 5A7CA 3AADA 5JI8A 5ENEA 2R10A 4NR4A 4ALGA 5D3RA 5IGMA 3LJWA 5IBNA 5C85A 5FG6A 5CQ5A 3SVHA 3QZTA 4TZ8A 4NS5A 5D7XA 5H1VA 5CUDA 4HXPA 4YYJA 4Z1SA 5D26A 2YDWA 2DVSA 4YYIA 2E7OA 4MR3A 4QYLA 4IR6A 2OUOA 3AQAA 4UYEA 4O7BA 5FE0A 4O70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RVR A;  5EIC A;  4YH4 A;  3TLP A;  4DON A;  4N3W A;  3O34 A;  5F3A A;  5C7N A;  4MR6 A;  4UIW A;  4NR7 A;  3IU5 A;  3QZV A;  5DFD A;  5FE2 A;  4O7C A;  4CUR A;  3IU6 A;  2OSS A;  5J0D A;  5CGP A;  4QEW A;  5FE3 A;  5HM0 A;  4HXR A;  5EI4 A;  3K2J A;  4J0R A;  4NQN A;  5EP7 A;  5AMF A;  1ZS5 A;  4BW2 A;  5CQ6 A;  5G4R A;  5H85 A;  5DW1 A;  5L99 A;  4HBY A;  5A5N A;  4CFK A;  3MUK A;  5A5Q A;  4MEO A;  2LSP B;  5FE6 A;  5A82 A;  5HFR A;  2YEM A;  4NUD A;  4XUA A;  5DFB A;  2GRC A;  3LQJ A;  5KTU A;  5E7D A;  2FSA A;  4O74 A;  4TT6 A;  2RNY A;  5FH7 A;  4A9K A;  4C66 A;  4XY8 A;  5CPE A;  5ENJ A;  4QSX A;  4QNS A;  3LXJ A;  4YAT A;  5KTW A;  5CU8 A;  5DY7 A;  3UV4 A;  3MUL A;  3NXB A;  3JVL A;  5LKZ A;  5BT5 A;  4QEU A;  4O71 A;  2RS9 B;  4Q0O A;  4TYL A;  5A5R A;  4UYF B;  3O37 A;  5EIS A;  5L97 A;  5HQ5 A;  4NUC A;  2E7N A;  4YY6 A;  4F3I A;  4A9I A;  1N72 A;  5E9I A;  5E9Y A;  5LVQ A;  5CQ7 A;  5KHM A;  4QST A;  4YC9 A;  3O36 A;  4CUP A;  5D3P A;  5I80 A;  2YYN A;  5H1U A;  3FKM X;  5CRM A;  5FH8 A;  4N4I A;  4YBM A;  3P1D A;  4QBM A;  2RI7 A;  2YEK A;  4YAB A;  4YYG A;  5BT4 A;  3HMH A;  5F36 A;  4NXJ A;  5LJ2 A;  4LZ2 A;  5K29 A;  4UYD A;  4J0S A;  2WP2 A;  5DYU A;  5CS8 A;  5II1 A;  4X2I A;  5E9M A;  4XY9 A;  5CQT A;  3MB4 A;  4YBS A;  2E3K A;  5FFV A;  4UIU A;  4NYW A;  4OGJ A;  5HFQ A;  4UIZ A;  4HXL A;  4BHW A;  3ZYU A;  2L85 A;  4N4F A;  4CLB A;  5KO4 A;  2I8N A;  3MXF A;  2WP1 A;  4NRA A;  4HXO A;  5IGK A;  3G0J A;  5EPB A;  4WIV A;  5II2 A;  4QR4 A;  4TT2 A;  5CUA A;  5CQA A;  5EPR A;  5A5O A;  5L96 A;  4Q0N A;  2YQD A;  4QY4 A;  1E6I A;  5DLZ A;  2F6J A;  4QSV A;  4WHU A;  4UIX A;  4MEP A;  4Z6H A;  5HRX A;  4YH3 A;  5EQ1 A;  4OGI A;  5IGN A;  4CFL A;  1EQF A;  4YAD A;  5FB0 A;  5FE9 A;  5D25 A;  5I1Q A;  4ZC9 A;  4TT4 A;  5CRZ A;  4MR5 A;  3UW9 A;  5FG5 A;  5LKT A;  4NR5 A;  5IGL A;  3HME A;  4MR4 A;  5A5S A;  4QUT A;  5ACY A;  4NR8 A;  5F1H A;  4NUE A;  5I89 A;  3Q2F A;  4NRC A;  4QUU A;  4TTE A;  4ZQL A;  4N4G A;  5FFY A;  5EM3 A;  5AME A;  5I29 A;  4IR5 A;  5LJ0 A;  5F62 A;  5HRW A;  4CL9 A;  5I86 A;  5EWV A;  4PTB A;  2F6N A;  4BW1 A;  2G4A A;  4UIY A;  5F1L A;  3P5O A;  5COI A;  3U5P A;  1F68 A;  4PKL A;  5HEM A;  5I88 A;  4NYX A;  5A81 A;  4BW4 A;  4NR6 A;  5KTX A;  5ENH A;  1JSP B;  3HMF A;  3JVJ A;  5CQ3 A;  3MB3 A;  3U5L A;  5AD3 A;  5HEL A;  4OUF A;  2DWW A;  5DYC A;  5LKX A;  5FE4 A;  4A9H A;  5EPS A;  4LYW A;  5EWD A;  4HBX A;  5ETD A;  3P1E A;  5FG4 A;  5IID A;  2H60 A;  2DVQ A;  5TB6 A;  4A9E A;  4NQM A;  4QSP A;  4NRB A;  4A9N A;  5D3T A;  5KU3 A;  5EWH A;  5DX4 A;  4A9M A;  5CUE A;  4GPJ A;  2RNX A;  4Y03 A;  4J3I A;  4UYH A;  5IG6 A;  5HEN A;  5E3G A;  4QR3 A;  4O77 A;  4PCE A;  4YYD A;  2RFJ A;  4E96 A;  3UVY A;  4A9O A;  4IOQ A;  4HBW A;  5HQ6 A;  4KCX A;  5HQ7 A;  5DKD A;  2YEL A;  5A5P A;  5D0C A;  5DYA A;  4QSW A;  5A83 A;  3DAI A;  3Q2E A;  5ENF A;  5FE7 A;  4O7A A;  3D7C A;  5I83 A;  5ENB A;  5CP5 A;  4O7E A;  5HCL A;  5D3N A;  4ALH A;  5F60 A;  3S92 A;  2DAT A;  5E74 A;  2YW5 A;  3U5O A;  4TU4 A;  4QSU A;  5HJC A;  4IOR A;  4XUB A;  5HRV A;  5LVR A;  2R0Y A;  4QZS A;  5G4S A;  3UVD A;  2RNW A;  4LZS A;  4MEQ A;  4LYS A;  5BT3 A;  5CFW A;  4HXM A;  3QZS A;  2KTB B;  4YAX A;  5CQ8 A;  2N9G A;  4Z6I A;  5I7Y A;  4ZW1 A;  2L5E A;  4O76 A;  2DKW A;  4HXS A;  5D3L A;  5FE8 A;  5E9V A;  4XYA A;  3G0L A;  4C67 A;  4J1P A;  5AD2 A;  5DLX A;  5FBX A;  4MEN A;  5F2P A;  3RCW A;  5C89 A;  3U5K A;  5EGU A;  3I3J A;  5CQ4 A;  5D24 A;  3P1C A;  4CUQ A;  5C87 A;  2RO1 A;  4YYK A;  5EVA A;  4WHW A;  4PS5 A;  5EU1 A;  3DWY A;  4A9J A;  4KV1 A;  5E9K A;  4YBT A;  2R0V A;  4UYG A;  2D82 A;  3U5J A;  4IR3 A;  4TS8 A;  4CUS A;  4UIV A;  4A9L A;  4PCI A;  3S91 A;  5TCM A;  4O75 A;  3ONI A;  5JWM A;  4BJX A;  5EWW A;  3UV5 A;  4O72 A;  3LQI A;  4Z93 A;  4QSR A;  5L98 A;  5LKU A;  5DKH A;  3O33 A;  4LC2 A;  5ENG A;  5CUB A;  1WUG A;  2OO1 A;  4LDF A;  5D3S A;  2R0S A;  5DKC A;  2DVR A;  4YYH A;  4YYN A;  5E73 A;  5EA1 A;  2L84 A;  4KV4 A;  5FH6 A;  4LZR A;  3GG3 A;  2D9E A;  4HXK A;  2I7K A;  4FLP A;  5I40 A;  5C4Q A;  4QSS A;  5DW2 A;  4TU6 A;  5LJ1 A;  5ETB A;  5F61 A;  1JM4 B;  5FE1 A;  4HXN A;  4YY4 A;  4PY6 A;  5DFC A;  5DYX A;  5ENI A;  4QEV A;  3JVM A;  5D3H A;  3P1F A;  5A85 A;  3MQM A;  5L8T A;  5CTL A;  4LYI A;  4QSQ A;  4O78 A;  5C8G A;  4BW3 A;  5E3D A;  5L8U A;  5DBM A;  4A9F A;  5F5Z A;  5CUC A;  5D3J A;  5F25 A;  4AKN A;  4LR6 A;  5CY9 A;  5EWC A;  3JVK A;  1WUM A;  5E9L A;  3U5N A;  5ENC A;  5EK9 A;  4O7F A;  4CUU A;  3SVF A;  3O35 A;  3SVG A;  3UV2 A;  4N4H A;  5CUG A;  4IR4 A;  1X0J A;  4QR5 A;  4LRG A;  4UYF A;  4TQN A;  4CUT A;  5E0R A;  5H1T A;  5LUU A;  5FE5 A;  5HLS A;  3UVX A;  4Z1Q A;  4IOO A;  4HBV A;  2DVV A;  5FFW A;  2NXB A;  4NYV A;  3U5M A;  4NR9 A;  4YYM A;  5F63 A;  5I7X A;  5FDZ A;  5EV9 A;  4QC3 A;  5FB1 A;  3UVW A;  4QB3 A;  4UIT A;  5CZG A;  4QC1 A;  3LQH A;  4QYD A;  2MJV B;  4YK0 A;  4TZ2 A;  5A7C A;  3AAD A;  5JI8 A;  5ENE A;  2R10 A;  4NR4 A;  4ALG A;  5D3R A;  5IGM A;  3LJW A;  5IBN A;  5C85 A;  5FG6 A;  5CQ5 A;  3SVH A;  3QZT A;  4TZ8 A;  4NS5 A;  5D7X A;  5H1V A;  5CUD A;  4HXP A;  4YYJ A;  4Z1S A;  5D26 A;  2YDW A;  2DVS A;  4YYI A;  2E7O A;  4MR3 A;  4QYL A;  4IR6 A;  2OUO A;  3AQA A;  4UYE A;  4O7B A;  5FE0 A;  4O70 A; 
#chains in the Genus database with same CATH topology
 4RVR A;  5EIC A;  4YH4 A;  3TLP A;  4DON A;  4N3W A;  3O34 A;  5F3A A;  5C7N A;  4MR6 A;  4UIW A;  4NR7 A;  3IU5 A;  3QZV A;  5DFD A;  5FE2 A;  4O7C A;  4CUR A;  3IU6 A;  2OSS A;  5J0D A;  5CGP A;  4QEW A;  5FE3 A;  5HM0 A;  3VKH A;  4HXR A;  5EI4 A;  3K2J A;  4J0R A;  4NQN A;  5EP7 A;  5AMF A;  1ZS5 A;  4BW2 A;  5CQ6 A;  5G4R A;  5H85 A;  5DW1 A;  5L99 A;  4HBY A;  5A5N A;  4CFK A;  3MUK A;  5A5Q A;  4MEO A;  2LSP B;  5FE6 A;  5A82 A;  5HFR A;  2YEM A;  4NUD A;  4XUA A;  5DFB A;  2GRC A;  3LQJ A;  5KTU A;  5E7D A;  2FSA A;  4O74 A;  4TT6 A;  2RNY A;  5FH7 A;  4A9K A;  4C66 A;  4XY8 A;  5CPE A;  5ENJ A;  4QSX A;  4QNS A;  3LXJ A;  4YAT A;  5KTW A;  5CU8 A;  5DY7 A;  3UV4 A;  3MUL A;  3NXB A;  3JVL A;  5LKZ A;  5BT5 A;  4QEU A;  4O71 A;  2RS9 B;  4Q0O A;  4TYL A;  5A5R A;  4UYF B;  3O37 A;  5EIS A;  5L97 A;  5HQ5 A;  4NUC A;  2E7N A;  4YY6 A;  4F3I A;  4A9I A;  1N72 A;  5E9I A;  5E9Y A;  5LVQ A;  5CQ7 A;  5KHM A;  4QST A;  4YC9 A;  3O36 A;  4CUP A;  5D3P A;  5I80 A;  2YYN A;  5H1U A;  3FKM X;  5CRM A;  5FH8 A;  4N4I A;  4YBM A;  3P1D A;  4QBM A;  2RI7 A;  2YEK A;  4YAB A;  4YYG A;  5BT4 A;  3HMH A;  5F36 A;  4NXJ A;  5LJ2 A;  4LZ2 A;  5K29 A;  4UYD A;  4J0S A;  2WP2 A;  5DYU A;  5CS8 A;  5II1 A;  4X2I A;  5E9M A;  4XY9 A;  5CQT A;  3MB4 A;  4YBS A;  2E3K A;  5FFV A;  4UIU A;  4NYW A;  4OGJ A;  5HFQ A;  4UIZ A;  4HXL A;  4BHW A;  3ZYU A;  2L85 A;  4N4F A;  4CLB A;  5KO4 A;  2I8N A;  3MXF A;  2WP1 A;  4AKG A;  4NRA A;  4HXO A;  5IGK A;  3G0J A;  5EPB A;  4WIV A;  5II2 A;  4QR4 A;  4TT2 A;  5CUA A;  5CQA A;  5EPR A;  5A5O A;  5L96 A;  4Q0N A;  2YQD A;  4QY4 A;  1E6I A;  5DLZ A;  2F6J A;  4QSV A;  4AKH A;  4WHU A;  4UIX A;  4MEP A;  4Z6H A;  5HRX A;  4YH3 A;  5EQ1 A;  4OGI A;  5IGN A;  4CFL A;  1EQF A;  4YAD A;  5FB0 A;  5FE9 A;  5D25 A;  5I1Q A;  4ZC9 A;  4TT4 A;  5CRZ A;  4MR5 A;  3UW9 A;  5FG5 A;  5LKT A;  4AI6 A;  4NR5 A;  5IGL A;  3HME A;  4MR4 A;  5A5S A;  4QUT A;  5ACY A;  4NR8 A;  5F1H A;  4NUE A;  5I89 A;  3Q2F A;  4NRC A;  4QUU A;  4TTE A;  4ZQL A;  4N4G A;  5FFY A;  5EM3 A;  5AME A;  5I29 A;  4IR5 A;  5LJ0 A;  5F62 A;  5HRW A;  4CL9 A;  5I86 A;  5EWV A;  4PTB A;  2F6N A;  4BW1 A;  2G4A A;  4UIY A;  5F1L A;  3P5O A;  5COI A;  3U5P A;  1F68 A;  4PKL A;  5HEM A;  5I88 A;  4NYX A;  3D1B A;  5A81 A;  4BW4 A;  4NR6 A;  5KTX A;  5ENH A;  1JSP B;  3HMF A;  3JVJ A;  5CQ3 A;  3MB3 A;  3U5L A;  5AD3 A;  5HEL A;  4OUF A;  2DWW A;  5DYC A;  5LKX A;  5FE4 A;  4A9H A;  5EPS A;  4LYW A;  5EWD A;  4HBX A;  5ETD A;  3P1E A;  5FG4 A;  5IID A;  2H60 A;  2DVQ A;  5TB6 A;  4A9E A;  4NQM A;  4QSP A;  4NRB A;  4A9N A;  5D3T A;  5KU3 A;  5EWH A;  5DX4 A;  4A9M A;  5CUE A;  4GPJ A;  2RNX A;  4Y03 A;  4J3I A;  4UYH A;  5IG6 A;  5HEN A;  5E3G A;  4QR3 A;  4O77 A;  4PCE A;  4YYD A;  2RFJ A;  4E96 A;  3UVY A;  4A9O A;  4IOQ A;  4HBW A;  5HQ6 A;  4KCX A;  5HQ7 A;  5DKD A;  2YEL A;  5A5P A;  5D0C A;  5DYA A;  4QSW A;  5A83 A;  3DAI A;  3Q2E A;  5ENF A;  5FE7 A;  4O7A A;  3D7C A;  3ERR A;  5I83 A;  5ENB A;  5CP5 A;  4O7E A;  5HCL A;  1PUO A;  5D3N A;  4ALH A;  5F60 A;  3S92 A;  2DAT A;  5E74 A;  2YW5 A;  3U5O A;  4TU4 A;  4QSU A;  5HJC A;  4IOR A;  1ZKR A;  4XUB A;  5HRV A;  5LVR A;  2R0Y A;  4QZS A;  5G4S A;  3UVD A;  2RNW A;  4LZS A;  4MEQ A;  4LYS A;  5BT3 A;  5CFW A;  4HXM A;  3QZS A;  2KTB B;  4YAX A;  5CQ8 A;  2N9G A;  4Z6I A;  5I7Y A;  2EJN A;  4ZW1 A;  2L5E A;  4O76 A;  2DKW A;  4HXS A;  5D3L A;  5FE8 A;  5E9V A;  4XYA A;  3G0L A;  4C67 A;  4J1P A;  5AD2 A;  5DLX A;  5FBX A;  4MEN A;  5F2P A;  3RCW A;  5C89 A;  3U5K A;  5EGU A;  3I3J A;  5CQ4 A;  5D24 A;  3P1C A;  4CUQ A;  5C87 A;  2RO1 A;  4YYK A;  5EVA A;  4WHW A;  4PS5 A;  5EU1 A;  3DWY A;  4A9J A;  4KV1 A;  5E9K A;  4YBT A;  2R0V A;  4UYG A;  2D82 A;  3U5J A;  3D1D A;  4IR3 A;  4TS8 A;  4CUS A;  4UIV A;  4A9L A;  4PCI A;  3S91 A;  5TCM A;  4O75 A;  3ONI A;  5JWM A;  4BJX A;  5EWW A;  3UV5 A;  4O72 A;  3LQI A;  4Z93 A;  4QSR A;  5L98 A;  5LKU A;  5DKH A;  3O33 A;  4LC2 A;  5ENG A;  5CUB A;  1WUG A;  3VKG A;  2OO1 A;  4LDF A;  5D3S A;  2R0S A;  5DKC A;  2DVR A;  4YYH A;  4YYN A;  5E73 A;  5EA1 A;  2L84 A;  4KV4 A;  5FH6 A;  4LZR A;  3GG3 A;  2D9E A;  4HXK A;  2I7K A;  4FLP A;  5I40 A;  5C4Q A;  4QSS A;  5DW2 A;  4TU6 A;  5LJ1 A;  5ETB A;  5F61 A;  1JM4 B;  5FE1 A;  4HXN A;  4YY4 A;  4PY6 A;  5DFC A;  5DYX A;  5ENI A;  4QEV A;  3JVM A;  5D3H A;  3P1F A;  5A85 A;  3MQM A;  5L8T A;  5CTL A;  4LYI A;  4QSQ A;  4O78 A;  5C8G A;  4BW3 A;  5E3D A;  5L8U A;  5DBM A;  4A9F A;  5F5Z A;  5CUC A;  5D3J A;  5F25 A;  4AKN A;  4LR6 A;  5CY9 A;  5EWC A;  3JVK A;  1WUM A;  5E9L A;  3U5N A;  5ENC A;  5EK9 A;  4O7F A;  4CUU A;  3SVF A;  3O35 A;  3SVG A;  3UV2 A;  4N4H A;  5CUG A;  4IR4 A;  1X0J A;  4QR5 A;  4LRG A;  4UYF A;  4TQN A;  4CUT A;  5E0R A;  5H1T A;  5LUU A;  5FE5 A;  5HLS A;  3UVX A;  4Z1Q A;  4IOO A;  4HBV A;  2DVV A;  5FFW A;  2NXB A;  4NYV A;  3U5M A;  4NR9 A;  4YYM A;  5F63 A;  5I7X A;  5FDZ A;  5EV9 A;  4QC3 A;  5FB1 A;  3UVW A;  4QB3 A;  4UIT A;  5CZG A;  4QC1 A;  3LQH A;  4QYD A;  2MJV B;  4YK0 A;  4TZ2 A;  5A7C A;  3AAD A;  5JI8 A;  5ENE A;  2R10 A;  4NR4 A;  4ALG A;  5D3R A;  5IGM A;  3LJW A;  5IBN A;  5C85 A;  5FG6 A;  5CQ5 A;  3SVH A;  3QZT A;  4TZ8 A;  4NS5 A;  5D7X A;  5H1V A;  5CUD A;  4HXP A;  4YYJ A;  4Z1S A;  5D26 A;  2YDW A;  2DVS A;  4YYI A;  4AKI A;  2E7O A;  4MR3 A;  4QYL A;  4IR6 A;  2OUO A;  3AQA A;  4UYE A;  4O7B A;  5FE0 A;  4O70 A; 
#chains in the Genus database with same CATH homology
 4RVR A;  5EIC A;  4YH4 A;  3TLP A;  4DON A;  4N3W A;  3O34 A;  5F3A A;  5C7N A;  4MR6 A;  4UIW A;  4NR7 A;  3IU5 A;  3QZV A;  5DFD A;  5FE2 A;  4O7C A;  4CUR A;  3IU6 A;  2OSS A;  5J0D A;  5CGP A;  4QEW A;  5FE3 A;  5HM0 A;  4HXR A;  5EI4 A;  3K2J A;  4J0R A;  4NQN A;  5EP7 A;  5AMF A;  1ZS5 A;  4BW2 A;  5CQ6 A;  5G4R A;  5H85 A;  5DW1 A;  5L99 A;  4HBY A;  5A5N A;  4CFK A;  3MUK A;  5A5Q A;  4MEO A;  2LSP B;  5FE6 A;  5A82 A;  5HFR A;  2YEM A;  4NUD A;  4XUA A;  5DFB A;  2GRC A;  3LQJ A;  5KTU A;  5E7D A;  2FSA A;  4O74 A;  4TT6 A;  2RNY A;  5FH7 A;  4A9K A;  4C66 A;  4XY8 A;  5CPE A;  5ENJ A;  4QSX A;  4QNS A;  3LXJ A;  4YAT A;  5KTW A;  5CU8 A;  5DY7 A;  3UV4 A;  3MUL A;  3NXB A;  3JVL A;  5LKZ A;  5BT5 A;  4QEU A;  4O71 A;  2RS9 B;  4Q0O A;  4TYL A;  5A5R A;  4UYF B;  3O37 A;  5EIS A;  5L97 A;  5HQ5 A;  4NUC A;  2E7N A;  4YY6 A;  4F3I A;  4A9I A;  1N72 A;  5E9I A;  5E9Y A;  5LVQ A;  5CQ7 A;  5KHM A;  4QST A;  4YC9 A;  3O36 A;  4CUP A;  5D3P A;  5I80 A;  2YYN A;  5H1U A;  3FKM X;  5CRM A;  5FH8 A;  4N4I A;  4YBM A;  3P1D A;  4QBM A;  2RI7 A;  2YEK A;  4YAB A;  4YYG A;  5BT4 A;  3HMH A;  5F36 A;  4NXJ A;  5LJ2 A;  4LZ2 A;  5K29 A;  4UYD A;  4J0S A;  2WP2 A;  5DYU A;  5CS8 A;  5II1 A;  4X2I A;  5E9M A;  4XY9 A;  5CQT A;  3MB4 A;  4YBS A;  2E3K A;  5FFV A;  4UIU A;  4NYW A;  4OGJ A;  5HFQ A;  4UIZ A;  4HXL A;  4BHW A;  3ZYU A;  2L85 A;  4N4F A;  4CLB A;  5KO4 A;  2I8N A;  3MXF A;  2WP1 A;  4NRA A;  4HXO A;  5IGK A;  3G0J A;  5EPB A;  4WIV A;  5II2 A;  4QR4 A;  4TT2 A;  5CUA A;  5CQA A;  5EPR A;  5A5O A;  5L96 A;  4Q0N A;  2YQD A;  4QY4 A;  1E6I A;  5DLZ A;  2F6J A;  4QSV A;  4WHU A;  4UIX A;  4MEP A;  4Z6H A;  5HRX A;  4YH3 A;  5EQ1 A;  4OGI A;  5IGN A;  4CFL A;  1EQF A;  4YAD A;  5FB0 A;  5FE9 A;  5D25 A;  5I1Q A;  4ZC9 A;  4TT4 A;  5CRZ A;  4MR5 A;  3UW9 A;  5FG5 A;  5LKT A;  4NR5 A;  5IGL A;  3HME A;  4MR4 A;  5A5S A;  4QUT A;  5ACY A;  4NR8 A;  5F1H A;  4NUE A;  5I89 A;  3Q2F A;  4NRC A;  4QUU A;  4TTE A;  4ZQL A;  4N4G A;  5FFY A;  5EM3 A;  5AME A;  5I29 A;  4IR5 A;  5LJ0 A;  5F62 A;  5HRW A;  4CL9 A;  5I86 A;  5EWV A;  4PTB A;  2F6N A;  4BW1 A;  2G4A A;  4UIY A;  5F1L A;  3P5O A;  5COI A;  3U5P A;  1F68 A;  4PKL A;  5HEM A;  5I88 A;  4NYX A;  5A81 A;  4BW4 A;  4NR6 A;  5KTX A;  5ENH A;  1JSP B;  3HMF A;  3JVJ A;  5CQ3 A;  3MB3 A;  3U5L A;  5AD3 A;  5HEL A;  4OUF A;  2DWW A;  5DYC A;  5LKX A;  5FE4 A;  4A9H A;  5EPS A;  4LYW A;  5EWD A;  4HBX A;  5ETD A;  3P1E A;  5FG4 A;  5IID A;  2H60 A;  2DVQ A;  5TB6 A;  4A9E A;  4NQM A;  4QSP A;  4NRB A;  4A9N A;  5D3T A;  5KU3 A;  5EWH A;  5DX4 A;  4A9M A;  5CUE A;  4GPJ A;  2RNX A;  4Y03 A;  4J3I A;  4UYH A;  5IG6 A;  5HEN A;  5E3G A;  4QR3 A;  4O77 A;  4PCE A;  4YYD A;  2RFJ A;  4E96 A;  3UVY A;  4A9O A;  4IOQ A;  4HBW A;  5HQ6 A;  4KCX A;  5HQ7 A;  5DKD A;  2YEL A;  5A5P A;  5D0C A;  5DYA A;  4QSW A;  5A83 A;  3DAI A;  3Q2E A;  5ENF A;  5FE7 A;  4O7A A;  3D7C A;  5I83 A;  5ENB A;  5CP5 A;  4O7E A;  5HCL A;  5D3N A;  4ALH A;  5F60 A;  3S92 A;  2DAT A;  5E74 A;  2YW5 A;  3U5O A;  4TU4 A;  4QSU A;  5HJC A;  4IOR A;  4XUB A;  5HRV A;  5LVR A;  2R0Y A;  4QZS A;  5G4S A;  3UVD A;  2RNW A;  4LZS A;  4MEQ A;  4LYS A;  5BT3 A;  5CFW A;  4HXM A;  3QZS A;  2KTB B;  4YAX A;  5CQ8 A;  2N9G A;  4Z6I A;  5I7Y A;  4ZW1 A;  2L5E A;  4O76 A;  2DKW A;  4HXS A;  5D3L A;  5FE8 A;  5E9V A;  4XYA A;  3G0L A;  4C67 A;  4J1P A;  5AD2 A;  5DLX A;  5FBX A;  4MEN A;  5F2P A;  3RCW A;  5C89 A;  3U5K A;  5EGU A;  3I3J A;  5CQ4 A;  5D24 A;  3P1C A;  4CUQ A;  5C87 A;  2RO1 A;  4YYK A;  5EVA A;  4WHW A;  4PS5 A;  5EU1 A;  3DWY A;  4A9J A;  4KV1 A;  5E9K A;  4YBT A;  2R0V A;  4UYG A;  2D82 A;  3U5J A;  4IR3 A;  4TS8 A;  4CUS A;  4UIV A;  4A9L A;  4PCI A;  3S91 A;  5TCM A;  4O75 A;  3ONI A;  5JWM A;  4BJX A;  5EWW A;  3UV5 A;  4O72 A;  3LQI A;  4Z93 A;  4QSR A;  5L98 A;  5LKU A;  5DKH A;  3O33 A;  4LC2 A;  5ENG A;  5CUB A;  1WUG A;  2OO1 A;  4LDF A;  5D3S A;  2R0S A;  5DKC A;  2DVR A;  4YYH A;  4YYN A;  5E73 A;  5EA1 A;  2L84 A;  4KV4 A;  5FH6 A;  4LZR A;  3GG3 A;  2D9E A;  4HXK A;  2I7K A;  4FLP A;  5I40 A;  5C4Q A;  4QSS A;  5DW2 A;  4TU6 A;  5LJ1 A;  5ETB A;  5F61 A;  1JM4 B;  5FE1 A;  4HXN A;  4YY4 A;  4PY6 A;  5DFC A;  5DYX A;  5ENI A;  4QEV A;  3JVM A;  5D3H A;  3P1F A;  5A85 A;  3MQM A;  5L8T A;  5CTL A;  4LYI A;  4QSQ A;  4O78 A;  5C8G A;  4BW3 A;  5E3D A;  5L8U A;  5DBM A;  4A9F A;  5F5Z A;  5CUC A;  5D3J A;  5F25 A;  4AKN A;  4LR6 A;  5CY9 A;  5EWC A;  3JVK A;  1WUM A;  5E9L A;  3U5N A;  5ENC A;  5EK9 A;  4O7F A;  4CUU A;  3SVF A;  3O35 A;  3SVG A;  3UV2 A;  4N4H A;  5CUG A;  4IR4 A;  1X0J A;  4QR5 A;  4LRG A;  4UYF A;  4TQN A;  4CUT A;  5E0R A;  5H1T A;  5LUU A;  5FE5 A;  5HLS A;  3UVX A;  4Z1Q A;  4IOO A;  4HBV A;  2DVV A;  5FFW A;  2NXB A;  4NYV A;  3U5M A;  4NR9 A;  4YYM A;  5F63 A;  5I7X A;  5FDZ A;  5EV9 A;  4QC3 A;  5FB1 A;  3UVW A;  4QB3 A;  4UIT A;  5CZG A;  4QC1 A;  3LQH A;  4QYD A;  2MJV B;  4YK0 A;  4TZ2 A;  5A7C A;  3AAD A;  5JI8 A;  5ENE A;  2R10 A;  4NR4 A;  4ALG A;  5D3R A;  5IGM A;  3LJW A;  5IBN A;  5C85 A;  5FG6 A;  5CQ5 A;  3SVH A;  3QZT A;  4TZ8 A;  4NS5 A;  5D7X A;  5H1V A;  5CUD A;  4HXP A;  4YYJ A;  4Z1S A;  5D26 A;  2YDW A;  2DVS A;  4YYI A;  2E7O A;  4MR3 A;  4QYL A;  4IR6 A;  2OUO A;  3AQA A;  4UYE A;  4O7B A;  5FE0 A;  4O70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...