2H60A

Solution structure of human brg1 bromodomain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
KMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Probable global transcription activator SNF2L4
publication title Solution structure of human Brg1 bromodomain and its specific binding to acetylated histone tails
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 105
sequence length 105
ec nomenclature ec 3.6.1.-:
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2h60A00
3U5PA 4QSSA 4QSVA 4PKLA 4YC9A 5DKHA 4LR6A 3UVDA 5CUEA 4QR3A 2RNWA 3HMHA 5F63A 5EPBA 5DFDA 5CUCA 4QSXA 2OO1A 4QY4A 2G4AA 2L5EA 3JVJA 5I86A 5ENFA 5LKUA 4YYGA 4WHUA 4Z6IA 2DWWA 5E74A 4YATA 5D25A 5L8UA 5F25A 4YBTA 2WP1A 4XY8A 5FE0A 4YYDA 2F6NA 4LZRA 5HCLA 5ACYA 1ZS5A 4QR5A 2YEKA 4QSRA 4NS5A 5FE1A 4CUQA 4FLPA 4NR8A 5FE4A 5G4RA 3UW9A 5HQ7A 5FBXA 4WIVA 5EP7A 4UYFA 4YYIA 4NRBA 4Z6HA 5D3NA 4NQMA 5CFWA 5A82A 4KV4A 3HMEA 4A9EA 4YY6A 3DAIA 1F68A 3MXFA 4UIZA 4YYHA 4Z1SA 4A9JA 2R0VA 4Y03A 2YQDA 5DYCA 4HXLA 5H85A 4O7FA 2WP2A 5I7XA 5IBNA 3U5LA 4TT2A 4DONA 4N4HA 3RCWA 4HXMA 5CQ3A 5HQ5A 5KHMA 5F60A 5ENGA 3O34A 4LZ2A 4CLBA 3UVXA 5EQ1A 4J0SA 5AD2A 5I83A 2L84A 3S91A 2DVQA 4MR5A 3JVMA 2H60A 4O75A 5ETDA 4CUPA 5HM0A 4O72A 4YYKA 5FFVA 2RNXA 4NR6A 1E6IA 4TYLA 5EISA 4HXPA 4X2IA 4CUSA 3U5OA 2YDWA 3LQHA 3LJWA 4IR4A 4XUAA 5LKTA 5FE8A 5E9YA 3MB3A 5DYXA 5I29A 2DVVA 4MENA 4NR4A 5E9IA 3LXJA 4YBMA 4ALHA 3JVKA 5D3PA 3ONIA 5ENHA 4LC2A 3I3JA 5I1QA 4HBYA 5FDZA 3MB4A 5HRXA 2YW5A 5A5RA 4TZ8A 5FG4A 4BW1A 3FKMX 4QSWA 5IG6A 3P1FA 5EPRA 3UV5A 4NUCA 4O7AA 5CTLA 4CURA 5IGLA 4J3IA 4OUFA 4IR3A 5D26A 5H1VA 3IU6A 5D3HA 5A5PA 4O70A 5HFQA 5IIDA 5AMFA 4TTEA 4CFLA 5A5SA 4MR6A 5LUUA 3UV2A 4QSQA 5A5NA 5LJ1A 5CQ5A 2RNYA 5C85A 5LKZA 4QNSA 5F1HA 5EU1A 5F36A 5A5OA 4C66A 4PY6A 3G0JA 5F1LA 4QSUA 5ETBA 5FE2A 2D9EA 4IOOA 4GPJA 4Q0NA 4A9FA 5LKXA 3Q2FA 4HBWA 4NUDA 5DYUA 1WUGA 2I8NA 5JI8A 5EK9A 5FG5A 4UYGA 2R10A 4CL9A 5KO4A 4QYDA 3SVHA 4NR7A 4NRCA 4UIYA 4YYJA 4UYFB 2D82A 2E7NA 5DFCA 5FE7A 5E3GA 4OGJA 4ZW1A 5EA1A 3K2JA 3P5OA 4Z93A 5EGUA 5ENIA 5FE3A 3S92A 2F6JA 5FH8A 5FH7A 5II2A 5FE5A 3TLPA 4PS5A 1X0JA 5CUGA 5C89A 5D24A 5ENCA 4YABA 5I89A 5LVRA 5HJCA 3P1EA 4YADA 4MEOA 5FFYA 4NUEA 4WHWA 5TB6A 2N9GA 1JSPB 5FE6A 5I80A 4BW4A 4PCEA 5H1TA 5E9VA 3U5JA 1EQFA 3JVLA 2LSPB 5A7CA 5FG6A 4A9OA 4TQNA 4TU6A 5CQ8A 4IOQA 4AKNA 5L8TA 5E9KA 3ZYUA 5D3JA 4QSPA 2RO1A 5DYAA 5L96A 5HFRA 5CQ6A 5DFBA 5EWCA 3UVWA 4TT6A 5L97A 2I7KA 4C67A 5LVQA 5C87A 5HRWA 5ENEA 4QEVA 4HXOA 5HEMA 4CUTA 3O36A 5CUDA 4O71A 2DKWA 5CY9A 5J0DA 2RI7A 5FFWA 4UYDA 5EICA 5E7DA 5KTWA 3G0LA 4LRGA 4O7CA 2FSAA 4O7EA 4CFKA 4YH3A 5H1UA 5F3AA 3QZTA 4UIXA 4QEUA 4A9HA 5E0RA 4ZQLA 4QZSA 5CGPA 4QUUA 4UIWA 5EPSA 5BT3A 5CZGA 4QSTA 3LQIA 5EWVA 4HXNA 4O76A 4YYNA 4NR5A 5DW2A 5EWDA 5FB1A 5LJ0A 4TU4A 4N4GA 5I88A 5K29A 4TT4A 1JM4B 3MUKA 5FH6A 4YYMA 4O74A 2OUOA 4A9KA 5E73A 4HXSA 5EI4A 5FB0A 2E7OA 5A85A 5C7NA 5IGNA 5JWMA 4MEPA 4OGIA 5CUBA 5F62A 3MQMA 5EVAA 4J0RA 4A9LA 2R0YA 4BJXA 5D3SA 4MEQA 5CRZA 2GRCA 4A9NA 5CQTA 5EWWA 4NYVA 4N4IA 5EV9A 5A81A 2YELA 5BT4A 5A5QA 5I40A 5II1A 4BHWA 5AMEA 3UV4A 4A9MA 1WUMA 5BT5A 4HBVA 4QEWA 4RVRA 5LJ2A 5DLZA 5D7XA 5DY7A 4O78A 4LZSA 4TZ2A 4PCIA 4XUBA 5AD3A 4LYIA 3MULA 5EM3A 4F3IA 5D3LA 5ENJA 4MR4A 4IR5A 5C8GA 5E9MA 5HENA 4NYWA 4E96A 3D7CA 4ALGA 4UIVA 4NYXA 5F5ZA 4UYEA 4O77A 4O7BA 5COIA 3AQAA 4NXJA 5I7YA 5IGMA 4LDFA 5KTUA 4UITA 4IORA 4QC1A 5DBMA 5F2PA 5CP5A 3SVGA 2DVSA 3U5NA 5DKDA 4PTBA 5DX4A 4HXRA 4CUUA 5D0CA 5A83A 5CQ7A 5TCMA 5HRVA 3O33A 5CQAA 4MR3A 5G4SA 2L85A 5CRMA 2DATA 3UVYA 4N3WA 5CPEA 3GG3A 4XY9A 2MJVB 2KTBB 5CS8A 4Z1QA 3AADA 3HMFA 2DVRA 4XYAA 3QZVA 5HLSA 3LQJA 4QB3A 4N4FA 4QR4A 5D3TA 4UYHA 4A9IA 5L99A 3SVFA 3QZSA 4YH4A 5HQ6A 3P1CA 4LYSA 4ZC9A 4QC3A 4UIUA 2R0SA 5FE9A 4YK0A 5E3DA 5DKCA 3O35A 3Q2EA 1N72A 3IU5A 5KTXA 4NR9A 5IGKA 4HXKA 3U5MA 2RS9B 4J1PA 5E9LA 5DLXA 4QBMA 2NXBA 2RFJA 5D3RA 5F61A 2YEMA 4QYLA 4TS8A 5CQ4A 4YAXA 5ENBA 4YBSA 4KCXA 4BW2A 5CU8A 4YY4A 4NRAA 5KU3A 4KV1A 2E3KA 4Q0OA 5HELA 5C4QA 2OSSA 5DW1A 3P1DA 4IR6A 3O37A 3U5KA 4HBXA 4QUTA 2YYNA 3DWYA 3NXBA 4LYWA 4NQNA 5EWHA 5L98A 4BW3A 5CUAA
chains in the Genus database with same CATH superfamily
3U5PA 4QSSA 4QSVA 4PKLA 4YC9A 5DKHA 4LR6A 3UVDA 5CUEA 4QR3A 2RNWA 3HMHA 5F63A 5EPBA 5DFDA 5CUCA 4QSXA 2OO1A 4QY4A 2G4AA 2L5EA 3JVJA 5I86A 5ENFA 5LKUA 4YYGA 4WHUA 4Z6IA 2DWWA 5E74A 4YATA 5D25A 5L8UA 5F25A 4YBTA 2WP1A 4XY8A 5FE0A 4YYDA 2F6NA 4LZRA 5HCLA 5ACYA 1ZS5A 4QR5A 2YEKA 4QSRA 4NS5A 5FE1A 4CUQA 4FLPA 4NR8A 5FE4A 5G4RA 3UW9A 5HQ7A 5FBXA 4WIVA 5EP7A 4UYFA 4YYIA 4NRBA 4Z6HA 5D3NA 4NQMA 5CFWA 5A82A 4KV4A 3HMEA 4A9EA 4YY6A 3DAIA 1F68A 3MXFA 4UIZA 4YYHA 4Z1SA 4A9JA 2R0VA 4Y03A 2YQDA 5DYCA 4HXLA 5H85A 4O7FA 2WP2A 5I7XA 5IBNA 3U5LA 4TT2A 4DONA 4N4HA 3RCWA 4HXMA 5CQ3A 5HQ5A 5KHMA 5F60A 5ENGA 3O34A 4LZ2A 4CLBA 3UVXA 5EQ1A 4J0SA 5AD2A 5I83A 2L84A 3S91A 2DVQA 4MR5A 3JVMA 2H60A 4O75A 5ETDA 4CUPA 5HM0A 4O72A 4YYKA 5FFVA 2RNXA 4NR6A 1E6IA 4TYLA 5EISA 4HXPA 4X2IA 4CUSA 3U5OA 2YDWA 3LQHA 3LJWA 4IR4A 4XUAA 5LKTA 5FE8A 5E9YA 3MB3A 2EJNA 5DYXA 5I29A 2DVVA 4MENA 4NR4A 5E9IA 3LXJA 4YBMA 4ALHA 3JVKA 5D3PA 3ONIA 5ENHA 4LC2A 3I3JA 5I1QA 4HBYA 5FDZA 3MB4A 5HRXA 2YW5A 5A5RA 4TZ8A 5FG4A 4BW1A 3FKMX 4QSWA 5IG6A 3P1FA 5EPRA 3UV5A 4NUCA 4O7AA 5CTLA 4CURA 5IGLA 4J3IA 4OUFA 4IR3A 5D26A 5H1VA 3IU6A 5D3HA 5A5PA 4O70A 5HFQA 5IIDA 5AMFA 4TTEA 4CFLA 5A5SA 4MR6A 5LUUA 3UV2A 4QSQA 5A5NA 5LJ1A 5CQ5A 2RNYA 5C85A 5LKZA 4QNSA 5F1HA 5EU1A 5F36A 5A5OA 4C66A 4PY6A 3VKHA 3G0JA 4AI6A 5F1LA 4QSUA 5ETBA 5FE2A 1ZKRA 2D9EA 4GPJA 4IOOA 4Q0NA 4A9FA 5LKXA 3Q2FA 4HBWA 4NUDA 5DYUA 1WUGA 2I8NA 5JI8A 5EK9A 5FG5A 4UYGA 2R10A 4CL9A 5KO4A 4QYDA 3SVHA 4NR7A 4NRCA 4UIYA 4YYJA 4UYFB 2D82A 2E7NA 5DFCA 5FE7A 5E3GA 4OGJA 4ZW1A 5EA1A 3K2JA 3P5OA 4Z93A 5EGUA 5ENIA 5FE3A 3S92A 2F6JA 5FH8A 5FH7A 5II2A 5FE5A 4AKGA 3TLPA 4PS5A 1X0JA 5CUGA 5C89A 5D24A 5ENCA 4YABA 3D1DA 5I89A 5LVRA 5HJCA 3P1EA 4YADA 4MEOA 5FFYA 4NUEA 4WHWA 5TB6A 2N9GA 1JSPB 5FE6A 5I80A 4BW4A 4PCEA 5H1TA 5E9VA 3U5JA 1EQFA 3JVLA 2LSPB 5A7CA 5FG6A 4A9OA 4TQNA 4TU6A 5CQ8A 4IOQA 4AKNA 5L8TA 5E9KA 3ZYUA 5D3JA 4QSPA 2RO1A 5DYAA 5L96A 5HFRA 5CQ6A 5DFBA 5EWCA 3UVWA 4TT6A 5L97A 2I7KA 4C67A 5LVQA 5C87A 5HRWA 5ENEA 4QEVA 4HXOA 5HEMA 4CUTA 3O36A 5CUDA 4AKHA 4O71A 2DKWA 5CY9A 5J0DA 2RI7A 5FFWA 4UYDA 5EICA 5E7DA 5KTWA 3G0LA 4LRGA 4O7CA 2FSAA 4O7EA 4CFKA 4YH3A 5H1UA 5F3AA 3QZTA 4UIXA 4QEUA 4A9HA 5E0RA 4ZQLA 4QZSA 5CGPA 4QUUA 4UIWA 5EPSA 5BT3A 5CZGA 4QSTA 3LQIA 5EWVA 4HXNA 4O76A 4YYNA 4NR5A 5DW2A 5EWDA 5FB1A 5LJ0A 4TU4A 4N4GA 5I88A 5K29A 4TT4A 1JM4B 3MUKA 5FH6A 4YYMA 4O74A 2OUOA 4A9KA 5E73A 4HXSA 5EI4A 4AKIA 5FB0A 2E7OA 5A85A 5C7NA 5IGNA 5JWMA 4MEPA 4OGIA 5CUBA 5F62A 3MQMA 5EVAA 4J0RA 4A9LA 2R0YA 4BJXA 5D3SA 4MEQA 5CRZA 2GRCA 4A9NA 5CQTA 5EWWA 4NYVA 4N4IA 5EV9A 5A81A 2YELA 5BT4A 5A5QA 5I40A 5II1A 4BHWA 5AMEA 3UV4A 4A9MA 1WUMA 5BT5A 4HBVA 4QEWA 4RVRA 5LJ2A 5DLZA 5D7XA 5DY7A 4O78A 4LZSA 4TZ2A 4PCIA 4XUBA 5AD3A 4LYIA 3MULA 5EM3A 4F3IA 5D3LA 5ENJA 4MR4A 4IR5A 5C8GA 5E9MA 5HENA 4NYWA 4E96A 3D7CA 4ALGA 4UIVA 4NYXA 5F5ZA 4UYEA 4O77A 4O7BA 5COIA 3AQAA 4NXJA 5I7YA 5IGMA 4LDFA 5KTUA 4UITA 4IORA 4QC1A 5DBMA 5F2PA 3ERRA 5CP5A 3SVGA 2DVSA 3U5NA 3D1BA 5DKDA 1PUOA 4PTBA 5DX4A 4HXRA 4CUUA 5D0CA 5A83A 5CQ7A 5TCMA 5HRVA 3O33A 5CQAA 4MR3A 5G4SA 2L85A 5CRMA 2DATA 3UVYA 4N3WA 5CPEA 3GG3A 4XY9A 2MJVB 2KTBB 5CS8A 4Z1QA 3AADA 3HMFA 2DVRA 4XYAA 3QZVA 5HLSA 3LQJA 4QB3A 4N4FA 4QR4A 5D3TA 4UYHA 4A9IA 5L99A 3SVFA 3QZSA 4YH4A 5HQ6A 3P1CA 4LYSA 4ZC9A 4QC3A 4UIUA 2R0SA 5FE9A 4YK0A 5E3DA 5DKCA 3O35A 3Q2EA 1N72A 3IU5A 5KTXA 4NR9A 5IGKA 4HXKA 3U5MA 2RS9B 4J1PA 5E9LA 5DLXA 4QBMA 2NXBA 2RFJA 5D3RA 5F61A 2YEMA 4QYLA 4TS8A 5CQ4A 4YAXA 5ENBA 4YBSA 4KCXA 3VKGA 4BW2A 5CU8A 4YY4A 4NRAA 5KU3A 4KV1A 2E3KA 4Q0OA 5HELA 5C4QA 2OSSA 5DW1A 3P1DA 4IR6A 3O37A 3U5KA 4HBXA 4QUTA 2YYNA 3DWYA 3NXBA 4LYWA 4NQNA 5EWHA 5L98A 4BW3A 5CUAA
chains in the Genus database with same CATH topology
3U5PA 4QSSA 4QSVA 4PKLA 4YC9A 5DKHA 4LR6A 3UVDA 5CUEA 4QR3A 2RNWA 3HMHA 5F63A 5EPBA 5DFDA 5CUCA 4QSXA 2OO1A 4QY4A 2G4AA 2L5EA 3JVJA 5I86A 5ENFA 5LKUA 4YYGA 4WHUA 4Z6IA 2DWWA 5E74A 4YATA 5D25A 5L8UA 5F25A 4YBTA 2WP1A 4XY8A 5FE0A 4YYDA 2F6NA 4LZRA 5HCLA 5ACYA 1ZS5A 4QR5A 2YEKA 4QSRA 4NS5A 5FE1A 4CUQA 4FLPA 4NR8A 5FE4A 5G4RA 3UW9A 5HQ7A 5FBXA 4WIVA 5EP7A 4UYFA 4YYIA 4NRBA 4Z6HA 5D3NA 4NQMA 5CFWA 5A82A 4KV4A 3HMEA 4A9EA 4YY6A 3DAIA 1F68A 3MXFA 4UIZA 4YYHA 4Z1SA 4A9JA 2R0VA 4Y03A 2YQDA 5DYCA 4HXLA 5H85A 4O7FA 2WP2A 5I7XA 5IBNA 3U5LA 4TT2A 4DONA 4N4HA 3RCWA 4HXMA 5CQ3A 5HQ5A 5KHMA 5F60A 5ENGA 3O34A 4LZ2A 4CLBA 3UVXA 5EQ1A 4J0SA 5AD2A 5I83A 2L84A 3S91A 2DVQA 4MR5A 3JVMA 2H60A 4O75A 5ETDA 4CUPA 5HM0A 4O72A 4YYKA 5FFVA 2RNXA 4NR6A 1E6IA 4TYLA 5EISA 4HXPA 4X2IA 4CUSA 3U5OA 2YDWA 3LQHA 3LJWA 4IR4A 4XUAA 5LKTA 5FE8A 5E9YA 3MB3A 5DYXA 5I29A 2DVVA 4MENA 4NR4A 5E9IA 3LXJA 4YBMA 4ALHA 3JVKA 5D3PA 3ONIA 5ENHA 4LC2A 3I3JA 5I1QA 4HBYA 5FDZA 3MB4A 5HRXA 2YW5A 5A5RA 4TZ8A 5FG4A 4BW1A 3FKMX 4QSWA 5IG6A 3P1FA 5EPRA 3UV5A 4NUCA 4O7AA 5CTLA 4CURA 5IGLA 4J3IA 4OUFA 4IR3A 5D26A 5H1VA 3IU6A 5D3HA 5A5PA 4O70A 5HFQA 5IIDA 5AMFA 4TTEA 4CFLA 5A5SA 4MR6A 5LUUA 3UV2A 4QSQA 5A5NA 5LJ1A 5CQ5A 2RNYA 5C85A 5LKZA 4QNSA 5F1HA 5EU1A 5F36A 5A5OA 4C66A 4PY6A 3G0JA 5F1LA 4QSUA 5ETBA 5FE2A 2D9EA 4IOOA 4GPJA 4Q0NA 4A9FA 5LKXA 3Q2FA 4HBWA 4NUDA 5DYUA 1WUGA 2I8NA 5JI8A 5EK9A 5FG5A 4UYGA 2R10A 4CL9A 5KO4A 4QYDA 3SVHA 4NR7A 4NRCA 4UIYA 4YYJA 4UYFB 2D82A 2E7NA 5DFCA 5FE7A 5E3GA 4OGJA 4ZW1A 5EA1A 3K2JA 3P5OA 4Z93A 5EGUA 5ENIA 5FE3A 3S92A 2F6JA 5FH8A 5FH7A 5II2A 5FE5A 3TLPA 4PS5A 1X0JA 5CUGA 5C89A 5D24A 5ENCA 4YABA 5I89A 5LVRA 5HJCA 3P1EA 4YADA 4MEOA 5FFYA 4NUEA 4WHWA 5TB6A 2N9GA 1JSPB 5FE6A 5I80A 4BW4A 4PCEA 5H1TA 5E9VA 3U5JA 1EQFA 3JVLA 2LSPB 5A7CA 5FG6A 4A9OA 4TQNA 4TU6A 5CQ8A 4IOQA 4AKNA 5L8TA 5E9KA 3ZYUA 5D3JA 4QSPA 2RO1A 5DYAA 5L96A 5HFRA 5CQ6A 5DFBA 5EWCA 3UVWA 4TT6A 5L97A 2I7KA 4C67A 5LVQA 5C87A 5HRWA 5ENEA 4QEVA 4HXOA 5HEMA 4CUTA 3O36A 5CUDA 4O71A 2DKWA 5CY9A 5J0DA 2RI7A 5FFWA 4UYDA 5EICA 5E7DA 5KTWA 3G0LA 4LRGA 4O7CA 2FSAA 4O7EA 4CFKA 4YH3A 5H1UA 5F3AA 3QZTA 4UIXA 4QEUA 4A9HA 5E0RA 4ZQLA 4QZSA 5CGPA 4QUUA 4UIWA 5EPSA 5BT3A 5CZGA 4QSTA 3LQIA 5EWVA 4HXNA 4O76A 4YYNA 4NR5A 5DW2A 5EWDA 5FB1A 5LJ0A 4TU4A 4N4GA 5I88A 5K29A 4TT4A 1JM4B 3MUKA 5FH6A 4YYMA 4O74A 2OUOA 4A9KA 5E73A 4HXSA 5EI4A 5FB0A 2E7OA 5A85A 5C7NA 5IGNA 5JWMA 4MEPA 4OGIA 5CUBA 5F62A 3MQMA 5EVAA 4J0RA 4A9LA 2R0YA 4BJXA 5D3SA 4MEQA 5CRZA 2GRCA 4A9NA 5CQTA 5EWWA 4NYVA 4N4IA 5EV9A 5A81A 2YELA 5BT4A 5A5QA 5I40A 5II1A 4BHWA 5AMEA 3UV4A 4A9MA 1WUMA 5BT5A 4HBVA 4QEWA 4RVRA 5LJ2A 5DLZA 5D7XA 5DY7A 4O78A 4LZSA 4TZ2A 4PCIA 4XUBA 5AD3A 4LYIA 3MULA 5EM3A 4F3IA 5D3LA 5ENJA 4MR4A 4IR5A 5C8GA 5E9MA 5HENA 4NYWA 4E96A 3D7CA 4ALGA 4UIVA 4NYXA 5F5ZA 4UYEA 4O77A 4O7BA 5COIA 3AQAA 4NXJA 5I7YA 5IGMA 4LDFA 5KTUA 4UITA 4IORA 4QC1A 5DBMA 5F2PA 5CP5A 3SVGA 2DVSA 3U5NA 5DKDA 4PTBA 5DX4A 4HXRA 4CUUA 5D0CA 5A83A 5CQ7A 5TCMA 5HRVA 3O33A 5CQAA 4MR3A 5G4SA 2L85A 5CRMA 2DATA 3UVYA 4N3WA 5CPEA 3GG3A 4XY9A 2MJVB 2KTBB 5CS8A 4Z1QA 3AADA 3HMFA 2DVRA 4XYAA 3QZVA 5HLSA 3LQJA 4QB3A 4N4FA 4QR4A 5D3TA 4UYHA 4A9IA 5L99A 3SVFA 3QZSA 4YH4A 5HQ6A 3P1CA 4LYSA 4ZC9A 4QC3A 4UIUA 2R0SA 5FE9A 4YK0A 5E3DA 5DKCA 3O35A 3Q2EA 1N72A 3IU5A 5KTXA 4NR9A 5IGKA 4HXKA 3U5MA 2RS9B 4J1PA 5E9LA 5DLXA 4QBMA 2NXBA 2RFJA 5D3RA 5F61A 2YEMA 4QYLA 4TS8A 5CQ4A 4YAXA 5ENBA 4YBSA 4KCXA 4BW2A 5CU8A 4YY4A 4NRAA 5KU3A 4KV1A 2E3KA 4Q0OA 5HELA 5C4QA 2OSSA 5DW1A 3P1DA 4IR6A 3O37A 3U5KA 4HBXA 4QUTA 2YYNA 3DWYA 3NXBA 4LYWA 4NQNA 5EWHA 5L98A 4BW3A 5CUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5P A;  4QSS A;  4QSV A;  4PKL A;  4YC9 A;  5DKH A;  4LR6 A;  3UVD A;  5CUE A;  4QR3 A;  2RNW A;  3HMH A;  5F63 A;  5EPB A;  5DFD A;  5CUC A;  4QSX A;  2OO1 A;  4QY4 A;  2G4A A;  2L5E A;  3JVJ A;  5I86 A;  5ENF A;  5LKU A;  4YYG A;  4WHU A;  4Z6I A;  2DWW A;  5E74 A;  4YAT A;  5D25 A;  5L8U A;  5F25 A;  4YBT A;  2WP1 A;  4XY8 A;  5FE0 A;  4YYD A;  2F6N A;  4LZR A;  5HCL A;  5ACY A;  1ZS5 A;  4QR5 A;  2YEK A;  4QSR A;  4NS5 A;  5FE1 A;  4CUQ A;  4FLP A;  4NR8 A;  5FE4 A;  5G4R A;  3UW9 A;  5HQ7 A;  5FBX A;  4WIV A;  5EP7 A;  4UYF A;  4YYI A;  4NRB A;  4Z6H A;  5D3N A;  4NQM A;  5CFW A;  5A82 A;  4KV4 A;  3HME A;  4A9E A;  4YY6 A;  3DAI A;  1F68 A;  3MXF A;  4UIZ A;  4YYH A;  4Z1S A;  4A9J A;  2R0V A;  4Y03 A;  2YQD A;  5DYC A;  4HXL A;  5H85 A;  4O7F A;  2WP2 A;  5I7X A;  5IBN A;  3U5L A;  4TT2 A;  4DON A;  4N4H A;  3RCW A;  4HXM A;  5CQ3 A;  5HQ5 A;  5KHM A;  5F60 A;  5ENG A;  3O34 A;  4LZ2 A;  4CLB A;  3UVX A;  5EQ1 A;  4J0S A;  5AD2 A;  5I83 A;  2L84 A;  3S91 A;  2DVQ A;  4MR5 A;  3JVM A;  2H60 A;  4O75 A;  5ETD A;  4CUP A;  5HM0 A;  4O72 A;  4YYK A;  5FFV A;  2RNX A;  4NR6 A;  1E6I A;  4TYL A;  5EIS A;  4HXP A;  4X2I A;  4CUS A;  3U5O A;  2YDW A;  3LQH A;  3LJW A;  4IR4 A;  4XUA A;  5LKT A;  5FE8 A;  5E9Y A;  3MB3 A;  5DYX A;  5I29 A;  2DVV A;  4MEN A;  4NR4 A;  5E9I A;  3LXJ A;  4YBM A;  4ALH A;  3JVK A;  5D3P A;  3ONI A;  5ENH A;  4LC2 A;  3I3J A;  5I1Q A;  4HBY A;  5FDZ A;  3MB4 A;  5HRX A;  2YW5 A;  5A5R A;  4TZ8 A;  5FG4 A;  4BW1 A;  3FKM X;  4QSW A;  5IG6 A;  3P1F A;  5EPR A;  3UV5 A;  4NUC A;  4O7A A;  5CTL A;  4CUR A;  5IGL A;  4J3I A;  4OUF A;  4IR3 A;  5D26 A;  5H1V A;  3IU6 A;  5D3H A;  5A5P A;  4O70 A;  5HFQ A;  5IID A;  5AMF A;  4TTE A;  4CFL A;  5A5S A;  4MR6 A;  5LUU A;  3UV2 A;  4QSQ A;  5A5N A;  5LJ1 A;  5CQ5 A;  2RNY A;  5C85 A;  5LKZ A;  4QNS A;  5F1H A;  5EU1 A;  5F36 A;  5A5O A;  4C66 A;  4PY6 A;  3G0J A;  5F1L A;  4QSU A;  5ETB A;  5FE2 A;  2D9E A;  4IOO A;  4GPJ A;  4Q0N A;  4A9F A;  5LKX A;  3Q2F A;  4HBW A;  4NUD A;  5DYU A;  1WUG A;  2I8N A;  5JI8 A;  5EK9 A;  5FG5 A;  4UYG A;  2R10 A;  4CL9 A;  5KO4 A;  4QYD A;  3SVH A;  4NR7 A;  4NRC A;  4UIY A;  4YYJ A;  4UYF B;  2D82 A;  2E7N A;  5DFC A;  5FE7 A;  5E3G A;  4OGJ A;  4ZW1 A;  5EA1 A;  3K2J A;  3P5O A;  4Z93 A;  5EGU A;  5ENI A;  5FE3 A;  3S92 A;  2F6J A;  5FH8 A;  5FH7 A;  5II2 A;  5FE5 A;  3TLP A;  4PS5 A;  1X0J A;  5CUG A;  5C89 A;  5D24 A;  5ENC A;  4YAB A;  5I89 A;  5LVR A;  5HJC A;  3P1E A;  4YAD A;  4MEO A;  5FFY A;  4NUE A;  4WHW A;  5TB6 A;  2N9G A;  1JSP B;  5FE6 A;  5I80 A;  4BW4 A;  4PCE A;  5H1T A;  5E9V A;  3U5J A;  1EQF A;  3JVL A;  2LSP B;  5A7C A;  5FG6 A;  4A9O A;  4TQN A;  4TU6 A;  5CQ8 A;  4IOQ A;  4AKN A;  5L8T A;  5E9K A;  3ZYU A;  5D3J A;  4QSP A;  2RO1 A;  5DYA A;  5L96 A;  5HFR A;  5CQ6 A;  5DFB A;  5EWC A;  3UVW A;  4TT6 A;  5L97 A;  2I7K A;  4C67 A;  5LVQ A;  5C87 A;  5HRW A;  5ENE A;  4QEV A;  4HXO A;  5HEM A;  4CUT A;  3O36 A;  5CUD A;  4O71 A;  2DKW A;  5CY9 A;  5J0D A;  2RI7 A;  5FFW A;  4UYD A;  5EIC A;  5E7D A;  5KTW A;  3G0L A;  4LRG A;  4O7C A;  2FSA A;  4O7E A;  4CFK A;  4YH3 A;  5H1U A;  5F3A A;  3QZT A;  4UIX A;  4QEU A;  4A9H A;  5E0R A;  4ZQL A;  4QZS A;  5CGP A;  4QUU A;  4UIW A;  5EPS A;  5BT3 A;  5CZG A;  4QST A;  3LQI A;  5EWV A;  4HXN A;  4O76 A;  4YYN A;  4NR5 A;  5DW2 A;  5EWD A;  5FB1 A;  5LJ0 A;  4TU4 A;  4N4G A;  5I88 A;  5K29 A;  4TT4 A;  1JM4 B;  3MUK A;  5FH6 A;  4YYM A;  4O74 A;  2OUO A;  4A9K A;  5E73 A;  4HXS A;  5EI4 A;  5FB0 A;  2E7O A;  5A85 A;  5C7N A;  5IGN A;  5JWM A;  4MEP A;  4OGI A;  5CUB A;  5F62 A;  3MQM A;  5EVA A;  4J0R A;  4A9L A;  2R0Y A;  4BJX A;  5D3S A;  4MEQ A;  5CRZ A;  2GRC A;  4A9N A;  5CQT A;  5EWW A;  4NYV A;  4N4I A;  5EV9 A;  5A81 A;  2YEL A;  5BT4 A;  5A5Q A;  5I40 A;  5II1 A;  4BHW A;  5AME A;  3UV4 A;  4A9M A;  1WUM A;  5BT5 A;  4HBV A;  4QEW A;  4RVR A;  5LJ2 A;  5DLZ A;  5D7X A;  5DY7 A;  4O78 A;  4LZS A;  4TZ2 A;  4PCI A;  4XUB A;  5AD3 A;  4LYI A;  3MUL A;  5EM3 A;  4F3I A;  5D3L A;  5ENJ A;  4MR4 A;  4IR5 A;  5C8G A;  5E9M A;  5HEN A;  4NYW A;  4E96 A;  3D7C A;  4ALG A;  4UIV A;  4NYX A;  5F5Z A;  4UYE A;  4O77 A;  4O7B A;  5COI A;  3AQA A;  4NXJ A;  5I7Y A;  5IGM A;  4LDF A;  5KTU A;  4UIT A;  4IOR A;  4QC1 A;  5DBM A;  5F2P A;  5CP5 A;  3SVG A;  2DVS A;  3U5N A;  5DKD A;  4PTB A;  5DX4 A;  4HXR A;  4CUU A;  5D0C A;  5A83 A;  5CQ7 A;  5TCM A;  5HRV A;  3O33 A;  5CQA A;  4MR3 A;  5G4S A;  2L85 A;  5CRM A;  2DAT A;  3UVY A;  4N3W A;  5CPE A;  3GG3 A;  4XY9 A;  2MJV B;  2KTB B;  5CS8 A;  4Z1Q A;  3AAD A;  3HMF A;  2DVR A;  4XYA A;  3QZV A;  5HLS A;  3LQJ A;  4QB3 A;  4N4F A;  4QR4 A;  5D3T A;  4UYH A;  4A9I A;  5L99 A;  3SVF A;  3QZS A;  4YH4 A;  5HQ6 A;  3P1C A;  4LYS A;  4ZC9 A;  4QC3 A;  4UIU A;  2R0S A;  5FE9 A;  4YK0 A;  5E3D A;  5DKC A;  3O35 A;  3Q2E A;  1N72 A;  3IU5 A;  5KTX A;  4NR9 A;  5IGK A;  4HXK A;  3U5M A;  2RS9 B;  4J1P A;  5E9L A;  5DLX A;  4QBM A;  2NXB A;  2RFJ A;  5D3R A;  5F61 A;  2YEM A;  4QYL A;  4TS8 A;  5CQ4 A;  4YAX A;  5ENB A;  4YBS A;  4KCX A;  4BW2 A;  5CU8 A;  4YY4 A;  4NRA A;  5KU3 A;  4KV1 A;  2E3K A;  4Q0O A;  5HEL A;  5C4Q A;  2OSS A;  5DW1 A;  3P1D A;  4IR6 A;  3O37 A;  3U5K A;  4HBX A;  4QUT A;  2YYN A;  3DWY A;  3NXB A;  4LYW A;  4NQN A;  5EWH A;  5L98 A;  4BW3 A;  5CUA A; 
#chains in the Genus database with same CATH topology
 3U5P A;  4QSS A;  4QSV A;  4PKL A;  4YC9 A;  5DKH A;  4LR6 A;  3UVD A;  5CUE A;  4QR3 A;  2RNW A;  3HMH A;  5F63 A;  5EPB A;  5DFD A;  5CUC A;  4QSX A;  2OO1 A;  4QY4 A;  2G4A A;  2L5E A;  3JVJ A;  5I86 A;  5ENF A;  5LKU A;  4YYG A;  4WHU A;  4Z6I A;  2DWW A;  5E74 A;  4YAT A;  5D25 A;  5L8U A;  5F25 A;  4YBT A;  2WP1 A;  4XY8 A;  5FE0 A;  4YYD A;  2F6N A;  4LZR A;  5HCL A;  5ACY A;  1ZS5 A;  4QR5 A;  2YEK A;  4QSR A;  4NS5 A;  5FE1 A;  4CUQ A;  4FLP A;  4NR8 A;  5FE4 A;  5G4R A;  3UW9 A;  5HQ7 A;  5FBX A;  4WIV A;  5EP7 A;  4UYF A;  4YYI A;  4NRB A;  4Z6H A;  5D3N A;  4NQM A;  5CFW A;  5A82 A;  4KV4 A;  3HME A;  4A9E A;  4YY6 A;  3DAI A;  1F68 A;  3MXF A;  4UIZ A;  4YYH A;  4Z1S A;  4A9J A;  2R0V A;  4Y03 A;  2YQD A;  5DYC A;  4HXL A;  5H85 A;  4O7F A;  2WP2 A;  5I7X A;  5IBN A;  3U5L A;  4TT2 A;  4DON A;  4N4H A;  3RCW A;  4HXM A;  5CQ3 A;  5HQ5 A;  5KHM A;  5F60 A;  5ENG A;  3O34 A;  4LZ2 A;  4CLB A;  3UVX A;  5EQ1 A;  4J0S A;  5AD2 A;  5I83 A;  2L84 A;  3S91 A;  2DVQ A;  4MR5 A;  3JVM A;  2H60 A;  4O75 A;  5ETD A;  4CUP A;  5HM0 A;  4O72 A;  4YYK A;  5FFV A;  2RNX A;  4NR6 A;  1E6I A;  4TYL A;  5EIS A;  4HXP A;  4X2I A;  4CUS A;  3U5O A;  2YDW A;  3LQH A;  3LJW A;  4IR4 A;  4XUA A;  5LKT A;  5FE8 A;  5E9Y A;  3MB3 A;  2EJN A;  5DYX A;  5I29 A;  2DVV A;  4MEN A;  4NR4 A;  5E9I A;  3LXJ A;  4YBM A;  4ALH A;  3JVK A;  5D3P A;  3ONI A;  5ENH A;  4LC2 A;  3I3J A;  5I1Q A;  4HBY A;  5FDZ A;  3MB4 A;  5HRX A;  2YW5 A;  5A5R A;  4TZ8 A;  5FG4 A;  4BW1 A;  3FKM X;  4QSW A;  5IG6 A;  3P1F A;  5EPR A;  3UV5 A;  4NUC A;  4O7A A;  5CTL A;  4CUR A;  5IGL A;  4J3I A;  4OUF A;  4IR3 A;  5D26 A;  5H1V A;  3IU6 A;  5D3H A;  5A5P A;  4O70 A;  5HFQ A;  5IID A;  5AMF A;  4TTE A;  4CFL A;  5A5S A;  4MR6 A;  5LUU A;  3UV2 A;  4QSQ A;  5A5N A;  5LJ1 A;  5CQ5 A;  2RNY A;  5C85 A;  5LKZ A;  4QNS A;  5F1H A;  5EU1 A;  5F36 A;  5A5O A;  4C66 A;  4PY6 A;  3VKH A;  3G0J A;  4AI6 A;  5F1L A;  4QSU A;  5ETB A;  5FE2 A;  1ZKR A;  2D9E A;  4GPJ A;  4IOO A;  4Q0N A;  4A9F A;  5LKX A;  3Q2F A;  4HBW A;  4NUD A;  5DYU A;  1WUG A;  2I8N A;  5JI8 A;  5EK9 A;  5FG5 A;  4UYG A;  2R10 A;  4CL9 A;  5KO4 A;  4QYD A;  3SVH A;  4NR7 A;  4NRC A;  4UIY A;  4YYJ A;  4UYF B;  2D82 A;  2E7N A;  5DFC A;  5FE7 A;  5E3G A;  4OGJ A;  4ZW1 A;  5EA1 A;  3K2J A;  3P5O A;  4Z93 A;  5EGU A;  5ENI A;  5FE3 A;  3S92 A;  2F6J A;  5FH8 A;  5FH7 A;  5II2 A;  5FE5 A;  4AKG A;  3TLP A;  4PS5 A;  1X0J A;  5CUG A;  5C89 A;  5D24 A;  5ENC A;  4YAB A;  3D1D A;  5I89 A;  5LVR A;  5HJC A;  3P1E A;  4YAD A;  4MEO A;  5FFY A;  4NUE A;  4WHW A;  5TB6 A;  2N9G A;  1JSP B;  5FE6 A;  5I80 A;  4BW4 A;  4PCE A;  5H1T A;  5E9V A;  3U5J A;  1EQF A;  3JVL A;  2LSP B;  5A7C A;  5FG6 A;  4A9O A;  4TQN A;  4TU6 A;  5CQ8 A;  4IOQ A;  4AKN A;  5L8T A;  5E9K A;  3ZYU A;  5D3J A;  4QSP A;  2RO1 A;  5DYA A;  5L96 A;  5HFR A;  5CQ6 A;  5DFB A;  5EWC A;  3UVW A;  4TT6 A;  5L97 A;  2I7K A;  4C67 A;  5LVQ A;  5C87 A;  5HRW A;  5ENE A;  4QEV A;  4HXO A;  5HEM A;  4CUT A;  3O36 A;  5CUD A;  4AKH A;  4O71 A;  2DKW A;  5CY9 A;  5J0D A;  2RI7 A;  5FFW A;  4UYD A;  5EIC A;  5E7D A;  5KTW A;  3G0L A;  4LRG A;  4O7C A;  2FSA A;  4O7E A;  4CFK A;  4YH3 A;  5H1U A;  5F3A A;  3QZT A;  4UIX A;  4QEU A;  4A9H A;  5E0R A;  4ZQL A;  4QZS A;  5CGP A;  4QUU A;  4UIW A;  5EPS A;  5BT3 A;  5CZG A;  4QST A;  3LQI A;  5EWV A;  4HXN A;  4O76 A;  4YYN A;  4NR5 A;  5DW2 A;  5EWD A;  5FB1 A;  5LJ0 A;  4TU4 A;  4N4G A;  5I88 A;  5K29 A;  4TT4 A;  1JM4 B;  3MUK A;  5FH6 A;  4YYM A;  4O74 A;  2OUO A;  4A9K A;  5E73 A;  4HXS A;  5EI4 A;  4AKI A;  5FB0 A;  2E7O A;  5A85 A;  5C7N A;  5IGN A;  5JWM A;  4MEP A;  4OGI A;  5CUB A;  5F62 A;  3MQM A;  5EVA A;  4J0R A;  4A9L A;  2R0Y A;  4BJX A;  5D3S A;  4MEQ A;  5CRZ A;  2GRC A;  4A9N A;  5CQT A;  5EWW A;  4NYV A;  4N4I A;  5EV9 A;  5A81 A;  2YEL A;  5BT4 A;  5A5Q A;  5I40 A;  5II1 A;  4BHW A;  5AME A;  3UV4 A;  4A9M A;  1WUM A;  5BT5 A;  4HBV A;  4QEW A;  4RVR A;  5LJ2 A;  5DLZ A;  5D7X A;  5DY7 A;  4O78 A;  4LZS A;  4TZ2 A;  4PCI A;  4XUB A;  5AD3 A;  4LYI A;  3MUL A;  5EM3 A;  4F3I A;  5D3L A;  5ENJ A;  4MR4 A;  4IR5 A;  5C8G A;  5E9M A;  5HEN A;  4NYW A;  4E96 A;  3D7C A;  4ALG A;  4UIV A;  4NYX A;  5F5Z A;  4UYE A;  4O77 A;  4O7B A;  5COI A;  3AQA A;  4NXJ A;  5I7Y A;  5IGM A;  4LDF A;  5KTU A;  4UIT A;  4IOR A;  4QC1 A;  5DBM A;  5F2P A;  3ERR A;  5CP5 A;  3SVG A;  2DVS A;  3U5N A;  3D1B A;  5DKD A;  1PUO A;  4PTB A;  5DX4 A;  4HXR A;  4CUU A;  5D0C A;  5A83 A;  5CQ7 A;  5TCM A;  5HRV A;  3O33 A;  5CQA A;  4MR3 A;  5G4S A;  2L85 A;  5CRM A;  2DAT A;  3UVY A;  4N3W A;  5CPE A;  3GG3 A;  4XY9 A;  2MJV B;  2KTB B;  5CS8 A;  4Z1Q A;  3AAD A;  3HMF A;  2DVR A;  4XYA A;  3QZV A;  5HLS A;  3LQJ A;  4QB3 A;  4N4F A;  4QR4 A;  5D3T A;  4UYH A;  4A9I A;  5L99 A;  3SVF A;  3QZS A;  4YH4 A;  5HQ6 A;  3P1C A;  4LYS A;  4ZC9 A;  4QC3 A;  4UIU A;  2R0S A;  5FE9 A;  4YK0 A;  5E3D A;  5DKC A;  3O35 A;  3Q2E A;  1N72 A;  3IU5 A;  5KTX A;  4NR9 A;  5IGK A;  4HXK A;  3U5M A;  2RS9 B;  4J1P A;  5E9L A;  5DLX A;  4QBM A;  2NXB A;  2RFJ A;  5D3R A;  5F61 A;  2YEM A;  4QYL A;  4TS8 A;  5CQ4 A;  4YAX A;  5ENB A;  4YBS A;  4KCX A;  3VKG A;  4BW2 A;  5CU8 A;  4YY4 A;  4NRA A;  5KU3 A;  4KV1 A;  2E3K A;  4Q0O A;  5HEL A;  5C4Q A;  2OSS A;  5DW1 A;  3P1D A;  4IR6 A;  3O37 A;  3U5K A;  4HBX A;  4QUT A;  2YYN A;  3DWY A;  3NXB A;  4LYW A;  4NQN A;  5EWH A;  5L98 A;  4BW3 A;  5CUA A; 
#chains in the Genus database with same CATH homology
 3U5P A;  4QSS A;  4QSV A;  4PKL A;  4YC9 A;  5DKH A;  4LR6 A;  3UVD A;  5CUE A;  4QR3 A;  2RNW A;  3HMH A;  5F63 A;  5EPB A;  5DFD A;  5CUC A;  4QSX A;  2OO1 A;  4QY4 A;  2G4A A;  2L5E A;  3JVJ A;  5I86 A;  5ENF A;  5LKU A;  4YYG A;  4WHU A;  4Z6I A;  2DWW A;  5E74 A;  4YAT A;  5D25 A;  5L8U A;  5F25 A;  4YBT A;  2WP1 A;  4XY8 A;  5FE0 A;  4YYD A;  2F6N A;  4LZR A;  5HCL A;  5ACY A;  1ZS5 A;  4QR5 A;  2YEK A;  4QSR A;  4NS5 A;  5FE1 A;  4CUQ A;  4FLP A;  4NR8 A;  5FE4 A;  5G4R A;  3UW9 A;  5HQ7 A;  5FBX A;  4WIV A;  5EP7 A;  4UYF A;  4YYI A;  4NRB A;  4Z6H A;  5D3N A;  4NQM A;  5CFW A;  5A82 A;  4KV4 A;  3HME A;  4A9E A;  4YY6 A;  3DAI A;  1F68 A;  3MXF A;  4UIZ A;  4YYH A;  4Z1S A;  4A9J A;  2R0V A;  4Y03 A;  2YQD A;  5DYC A;  4HXL A;  5H85 A;  4O7F A;  2WP2 A;  5I7X A;  5IBN A;  3U5L A;  4TT2 A;  4DON A;  4N4H A;  3RCW A;  4HXM A;  5CQ3 A;  5HQ5 A;  5KHM A;  5F60 A;  5ENG A;  3O34 A;  4LZ2 A;  4CLB A;  3UVX A;  5EQ1 A;  4J0S A;  5AD2 A;  5I83 A;  2L84 A;  3S91 A;  2DVQ A;  4MR5 A;  3JVM A;  2H60 A;  4O75 A;  5ETD A;  4CUP A;  5HM0 A;  4O72 A;  4YYK A;  5FFV A;  2RNX A;  4NR6 A;  1E6I A;  4TYL A;  5EIS A;  4HXP A;  4X2I A;  4CUS A;  3U5O A;  2YDW A;  3LQH A;  3LJW A;  4IR4 A;  4XUA A;  5LKT A;  5FE8 A;  5E9Y A;  3MB3 A;  5DYX A;  5I29 A;  2DVV A;  4MEN A;  4NR4 A;  5E9I A;  3LXJ A;  4YBM A;  4ALH A;  3JVK A;  5D3P A;  3ONI A;  5ENH A;  4LC2 A;  3I3J A;  5I1Q A;  4HBY A;  5FDZ A;  3MB4 A;  5HRX A;  2YW5 A;  5A5R A;  4TZ8 A;  5FG4 A;  4BW1 A;  3FKM X;  4QSW A;  5IG6 A;  3P1F A;  5EPR A;  3UV5 A;  4NUC A;  4O7A A;  5CTL A;  4CUR A;  5IGL A;  4J3I A;  4OUF A;  4IR3 A;  5D26 A;  5H1V A;  3IU6 A;  5D3H A;  5A5P A;  4O70 A;  5HFQ A;  5IID A;  5AMF A;  4TTE A;  4CFL A;  5A5S A;  4MR6 A;  5LUU A;  3UV2 A;  4QSQ A;  5A5N A;  5LJ1 A;  5CQ5 A;  2RNY A;  5C85 A;  5LKZ A;  4QNS A;  5F1H A;  5EU1 A;  5F36 A;  5A5O A;  4C66 A;  4PY6 A;  3G0J A;  5F1L A;  4QSU A;  5ETB A;  5FE2 A;  2D9E A;  4IOO A;  4GPJ A;  4Q0N A;  4A9F A;  5LKX A;  3Q2F A;  4HBW A;  4NUD A;  5DYU A;  1WUG A;  2I8N A;  5JI8 A;  5EK9 A;  5FG5 A;  4UYG A;  2R10 A;  4CL9 A;  5KO4 A;  4QYD A;  3SVH A;  4NR7 A;  4NRC A;  4UIY A;  4YYJ A;  4UYF B;  2D82 A;  2E7N A;  5DFC A;  5FE7 A;  5E3G A;  4OGJ A;  4ZW1 A;  5EA1 A;  3K2J A;  3P5O A;  4Z93 A;  5EGU A;  5ENI A;  5FE3 A;  3S92 A;  2F6J A;  5FH8 A;  5FH7 A;  5II2 A;  5FE5 A;  3TLP A;  4PS5 A;  1X0J A;  5CUG A;  5C89 A;  5D24 A;  5ENC A;  4YAB A;  5I89 A;  5LVR A;  5HJC A;  3P1E A;  4YAD A;  4MEO A;  5FFY A;  4NUE A;  4WHW A;  5TB6 A;  2N9G A;  1JSP B;  5FE6 A;  5I80 A;  4BW4 A;  4PCE A;  5H1T A;  5E9V A;  3U5J A;  1EQF A;  3JVL A;  2LSP B;  5A7C A;  5FG6 A;  4A9O A;  4TQN A;  4TU6 A;  5CQ8 A;  4IOQ A;  4AKN A;  5L8T A;  5E9K A;  3ZYU A;  5D3J A;  4QSP A;  2RO1 A;  5DYA A;  5L96 A;  5HFR A;  5CQ6 A;  5DFB A;  5EWC A;  3UVW A;  4TT6 A;  5L97 A;  2I7K A;  4C67 A;  5LVQ A;  5C87 A;  5HRW A;  5ENE A;  4QEV A;  4HXO A;  5HEM A;  4CUT A;  3O36 A;  5CUD A;  4O71 A;  2DKW A;  5CY9 A;  5J0D A;  2RI7 A;  5FFW A;  4UYD A;  5EIC A;  5E7D A;  5KTW A;  3G0L A;  4LRG A;  4O7C A;  2FSA A;  4O7E A;  4CFK A;  4YH3 A;  5H1U A;  5F3A A;  3QZT A;  4UIX A;  4QEU A;  4A9H A;  5E0R A;  4ZQL A;  4QZS A;  5CGP A;  4QUU A;  4UIW A;  5EPS A;  5BT3 A;  5CZG A;  4QST A;  3LQI A;  5EWV A;  4HXN A;  4O76 A;  4YYN A;  4NR5 A;  5DW2 A;  5EWD A;  5FB1 A;  5LJ0 A;  4TU4 A;  4N4G A;  5I88 A;  5K29 A;  4TT4 A;  1JM4 B;  3MUK A;  5FH6 A;  4YYM A;  4O74 A;  2OUO A;  4A9K A;  5E73 A;  4HXS A;  5EI4 A;  5FB0 A;  2E7O A;  5A85 A;  5C7N A;  5IGN A;  5JWM A;  4MEP A;  4OGI A;  5CUB A;  5F62 A;  3MQM A;  5EVA A;  4J0R A;  4A9L A;  2R0Y A;  4BJX A;  5D3S A;  4MEQ A;  5CRZ A;  2GRC A;  4A9N A;  5CQT A;  5EWW A;  4NYV A;  4N4I A;  5EV9 A;  5A81 A;  2YEL A;  5BT4 A;  5A5Q A;  5I40 A;  5II1 A;  4BHW A;  5AME A;  3UV4 A;  4A9M A;  1WUM A;  5BT5 A;  4HBV A;  4QEW A;  4RVR A;  5LJ2 A;  5DLZ A;  5D7X A;  5DY7 A;  4O78 A;  4LZS A;  4TZ2 A;  4PCI A;  4XUB A;  5AD3 A;  4LYI A;  3MUL A;  5EM3 A;  4F3I A;  5D3L A;  5ENJ A;  4MR4 A;  4IR5 A;  5C8G A;  5E9M A;  5HEN A;  4NYW A;  4E96 A;  3D7C A;  4ALG A;  4UIV A;  4NYX A;  5F5Z A;  4UYE A;  4O77 A;  4O7B A;  5COI A;  3AQA A;  4NXJ A;  5I7Y A;  5IGM A;  4LDF A;  5KTU A;  4UIT A;  4IOR A;  4QC1 A;  5DBM A;  5F2P A;  5CP5 A;  3SVG A;  2DVS A;  3U5N A;  5DKD A;  4PTB A;  5DX4 A;  4HXR A;  4CUU A;  5D0C A;  5A83 A;  5CQ7 A;  5TCM A;  5HRV A;  3O33 A;  5CQA A;  4MR3 A;  5G4S A;  2L85 A;  5CRM A;  2DAT A;  3UVY A;  4N3W A;  5CPE A;  3GG3 A;  4XY9 A;  2MJV B;  2KTB B;  5CS8 A;  4Z1Q A;  3AAD A;  3HMF A;  2DVR A;  4XYA A;  3QZV A;  5HLS A;  3LQJ A;  4QB3 A;  4N4F A;  4QR4 A;  5D3T A;  4UYH A;  4A9I A;  5L99 A;  3SVF A;  3QZS A;  4YH4 A;  5HQ6 A;  3P1C A;  4LYS A;  4ZC9 A;  4QC3 A;  4UIU A;  2R0S A;  5FE9 A;  4YK0 A;  5E3D A;  5DKC A;  3O35 A;  3Q2E A;  1N72 A;  3IU5 A;  5KTX A;  4NR9 A;  5IGK A;  4HXK A;  3U5M A;  2RS9 B;  4J1P A;  5E9L A;  5DLX A;  4QBM A;  2NXB A;  2RFJ A;  5D3R A;  5F61 A;  2YEM A;  4QYL A;  4TS8 A;  5CQ4 A;  4YAX A;  5ENB A;  4YBS A;  4KCX A;  4BW2 A;  5CU8 A;  4YY4 A;  4NRA A;  5KU3 A;  4KV1 A;  2E3K A;  4Q0O A;  5HEL A;  5C4Q A;  2OSS A;  5DW1 A;  3P1D A;  4IR6 A;  3O37 A;  3U5K A;  4HBX A;  4QUT A;  2YYN A;  3DWY A;  3NXB A;  4LYW A;  4NQN A;  5EWH A;  5L98 A;  4BW3 A;  5CUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...