5HRWA

Crystal structure of the fifth bromodomain of human pb1 in complex with 1-propylisochromeno[3,4-c]pyrazol-5(2h)-one) compound
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
110
structure length
110
Chain Sequence
YMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein polybromo-1
publication title Discovery and Optimization of a Selective Ligand for the Switch/Sucrose Nonfermenting-Related Bromodomains of Polybromo Protein-1 by the Use of Virtual Screening and Hydration Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 35
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5hrwA00
3IU5A 3I3JA 4NS5A 5CUDA 4CUSA 3JVJA 5I88A 4HXNA 5FE3A 5I7XA 4ZC9A 5E9KA 2F6JA 5ETDA 2DATA 4QBMA 2R0VA 2YQDA 5CQTA 4HXKA 3P5OA 5CGPA 4TU6A 5EWCA 5FFWA 3S92A 4YYIA 5HRXA 4TU4A 5DKDA 5FB0A 1JM4B 5C8GA 4YATA 5E9MA 2GRCA 5I29A 4MR3A 3UW9A 4HBVA 5DYUA 5CQAA 3K2JA 4BW4A 5I83A 5A5OA 4IORA 5HQ5A 1WUMA 4XUAA 4OGIA 5LVQA 5CUGA 4HBWA 5H1TA 3JVLA 4HXMA 4TT6A 4NRAA 4J0SA 4PY6A 5ENEA 4PCEA 3HMHA 4IOOA 4IR4A 4NRCA 4YH3A 5F63A 4TZ2A 4LDFA 4HXOA 5EU1A 5FG4A 5IGLA 4QY4A 5EVAA 4NRBA 5EICA 5AD2A 4CUQA 4IR3A 4QUTA 4RVRA 5DYAA 2E7OA 5HEMA 4YYDA 5FE4A 4MR4A 3UV5A 4A9NA 4NR7A 4WIVA 2RO1A 3O35A 4NR8A 5H1VA 5D3RA 4YK0A 4KV4A 2N9GA 3O36A 5LJ1A 2D9EA 5IIDA 4UIZA 5E9IA 4QSWA 3MUKA 5CS8A 4A9MA 4BHWA 2G4AA 4A9HA 4A9KA 5ENGA 3LQHA 5FE5A 4QUUA 3SVGA 5I1QA 3Q2EA 3UVWA 5C4QA 2R0SA 5DBMA 4A9EA 2RFJA 4QYLA 5HQ7A 5H1UA 3U5PA 4TQNA 5EPSA 4AKNA 4YYKA 5I89A 5A82A 2WP2A 2YDWA 4MENA 3MB3A 4QNSA 4NXJA 1JSPB 5FG6A 4Q0OA 5DFBA 4BW1A 4CUUA 4CURA 4Q0NA 5LKZA 5FE2A 4TS8A 5IGKA 4A9IA 3FKMX 2RNYA 5DFDA 5TCMA 2R10A 5E9VA 4NYWA 4UITA 5E73A 4QSXA 4XY8A 3U5MA 4A9OA 4OUFA 5DW2A 5IGNA 4IR5A 5A7CA 4OGJA 3P1FA 5EM3A 3TLPA 5LJ2A 5D3HA 4HXPA 4O77A 5EK9A 5DKHA 3ZYUA 5EV9A 5LKUA 4NQMA 5HCLA 5D26A 4QR4A 5CUEA 5CTLA 2OSSA 5FFVA 4Z6IA 4YBTA 5ENIA 5FE1A 2I8NA 5HFRA 2RS9B 5EWHA 4N4HA 2YEMA 3UV2A 5A5RA 5COIA 4YBSA 5F62A 2DWWA 5CP5A 1ZS5A 5EI4A 4LYIA 4UYHA 4O7AA 5DW1A 3LQIA 5FE9A 4O7EA 2RI7A 5AMFA 4IR6A 4BW2A 4O75A 5G4SA 4O78A 5FE7A 5I7YA 4CUPA 3D7CA 5A5QA 5A5PA 3Q2FA 5FB1A 4GPJA 5H85A 5CQ7A 4X2IA 4N4FA 4LC2A 4CLBA 4QSUA 3SVHA 4NR5A 4QR5A 5AD3A 3G0JA 4QSRA 5DLZA 5E0RA 3U5JA 4YY4A 2LSPB 5CQ5A 4ZQLA 4O70A 4CL9A 5C87A 3MB4A 4O76A 5KTUA 2DKWA 3SVFA 3UV4A 5HRWA 5CFWA 3P1DA 5D3TA 5F1LA 4HXLA 4YYHA 5FE0A 4LYSA 4ALHA 3IU6A 1WUGA 5BT5A 5CZGA 4QSQA 4NUDA 5F5ZA 2KTBB 3QZVA 2DVQA 4LRGA 4YYGA 2E3KA 5EISA 5C7NA 5D25A 5CRMA 4C66A 5FG5A 4UYFB 5L97A 3O34A 4NR4A 3MQMA 4BW3A 5F1HA 4MR5A 3U5KA 3P1CA 5FBXA 5JWMA 5A81A 4TTEA 5D3LA 4J3IA 3LQJA 5D0CA 5EP7A 5EPRA 2FSAA 4QSPA 4CFKA 4MEQA 5EWWA 1EQFA 4LZRA 3P1EA 5A85A 5DYXA 4YABA 5ENBA 5E3GA 3O33A 5DX4A 2DVVA 2MJVB 5CQ4A 5L8UA 5F61A 5IBNA 4UIYA 4BJXA 4HXRA 2NXBA 4NR9A 3GG3A 3QZTA 5G4RA 5ENJA 5FE6A 2DVRA 5CUAA 4QYDA 4UIXA 5EQ1A 4DONA 5KHMA 4PCIA 4ZW1A 5JI8A 4F3IA 5FH6A 4N4IA 5D3SA 5L96A 5ENCA 3LJWA 5EGUA 3AADA 3DAIA 3DWYA 5EA1A 5HFQA 2D82A 4LYWA 3JVKA 4N3WA 4Z1SA 3O37A 1X0JA 4CFLA 5DY7A 4NR6A 2L85A 5KO4A 5J0DA 5CQ8A 4HBYA 5A83A 5ACYA 4WHWA 5L8TA 4J0RA 5L98A 5HELA 2WP1A 2YEKA 4CUTA 5EWVA 4YADA 4UIWA 5C89A 3S91A 5KTWA 2OUOA 5A5NA 4A9LA 4LZSA 4QEUA 4YBMA 4IOQA 5E7DA 5F25A 4QC1A 5HJCA 4Z93A 4J1PA 4UYFA 5CQ6A 4YYMA 1N72A 2YW5A 2H60A 3MXFA 3HMEA 3MULA 5F36A 3U5OA 5E74A 4NYXA 4XUBA 3HMFA 2YELA 5HLSA 5ETBA 4UIVA 5CUCA 4KV1A 2DVSA 4QSVA 5E3DA 5II2A 2I7KA 4TT2A 4NQNA 4FLPA 5LKTA 1F68A 4LR6A 5CQ3A 4C67A 4Z1QA 5D3JA 4O7FA 4XY9A 5KTXA 4QB3A 5HQ6A 4QZSA 5LVRA 5IGMA 5FH7A 4QSSA 2L5EA 5DFCA 5I86A 4YAXA 4QC3A 4QEVA 4UIUA 5DYCA 5DKCA 5CY9A 5FFYA 4YH4A 4TYLA 3U5NA 4UYEA 5TB6A 5EWDA 2RNWA 5LUUA 2F6NA 4YY6A 4KCXA 5FDZA 4PTBA 3AQAA 5A5SA 5D24A 5FH8A 4WHUA 5EPBA 5BT4A 5F3AA 4YYNA 3NXBA 4QR3A 3JVMA 4MEOA 4YC9A 5E9YA 1E6IA 4O71A 4Y03A 4NUCA 3G0LA 4TT4A 4NYVA 5D7XA 4UYGA 5IG6A 5LKXA 4NUEA 4ALGA 4A9FA 2YYNA 5KU3A 4MEPA 4TZ8A 5HENA 5CPEA 4HBXA 5ENFA 4QSTA 4UYDA 3RCWA 5D3NA 4LZ2A 3UVYA 5FE8A 4E96A 5HM0A 4O7CA 3UVXA 5F2PA 5II1A 5L99A 5D3PA 4QEWA 5LJ0A 5DLXA 5HRVA 2OO1A 2L84A 3U5LA 5E9LA 4PS5A 4O7BA 4N4GA 3LXJA 4O74A 4XYAA 5K29A 5AMEA 2E7NA 4YYJA 5I40A 5BT3A 3UVDA 5CRZA 4O72A 5CU8A 5F60A 5C85A 5I80A 5ENHA 4PKLA 4Z6HA 4A9JA 3QZSA 4HXSA 2R0YA 3ONIA 5CUBA 2RNXA 4MR6A
chains in the Genus database with same CATH superfamily
3IU5A 3I3JA 4NS5A 5CUDA 4CUSA 3JVJA 5I88A 4HXNA 5FE3A 5I7XA 4ZC9A 5E9KA 2F6JA 5ETDA 2DATA 4QBMA 2R0VA 2YQDA 5CQTA 4HXKA 3P5OA 5CGPA 4TU6A 5EWCA 5FFWA 3S92A 4YYIA 5HRXA 4TU4A 5DKDA 5FB0A 1JM4B 5C8GA 4YATA 5E9MA 2GRCA 5I29A 4MR3A 3UW9A 4HBVA 5DYUA 5CQAA 3K2JA 4BW4A 5I83A 5A5OA 2EJNA 4IORA 5HQ5A 1WUMA 4XUAA 4OGIA 5LVQA 5CUGA 4HBWA 5H1TA 3JVLA 4HXMA 4TT6A 4NRAA 4J0SA 4PY6A 5ENEA 4PCEA 3HMHA 4IOOA 4IR4A 4NRCA 4YH3A 5F63A 4TZ2A 4LDFA 4HXOA 5EU1A 5FG4A 5IGLA 4QY4A 5EVAA 4NRBA 5EICA 5AD2A 4CUQA 4IR3A 4QUTA 4RVRA 5DYAA 2E7OA 5HEMA 4YYDA 5FE4A 4MR4A 3UV5A 4A9NA 4NR7A 4WIVA 2RO1A 3O35A 4NR8A 5H1VA 5D3RA 4YK0A 4KV4A 2N9GA 3O36A 5LJ1A 2D9EA 5IIDA 4UIZA 5E9IA 4QSWA 3MUKA 5CS8A 4A9MA 4BHWA 2G4AA 4A9HA 4A9KA 5ENGA 3LQHA 5FE5A 4QUUA 3SVGA 5I1QA 3Q2EA 3UVWA 5C4QA 2R0SA 5DBMA 4A9EA 2RFJA 4QYLA 5HQ7A 5H1UA 3U5PA 4TQNA 5EPSA 4AKNA 4YYKA 4AKIA 5I89A 5A82A 2WP2A 2YDWA 4MENA 3MB3A 4QNSA 4NXJA 1JSPB 5FG6A 4Q0OA 5DFBA 4BW1A 4CUUA 4CURA 4Q0NA 5LKZA 5FE2A 4TS8A 5IGKA 4A9IA 3FKMX 2RNYA 5DFDA 5TCMA 2R10A 5E9VA 4NYWA 4UITA 5E73A 4QSXA 4XY8A 3U5MA 4A9OA 4OUFA 5DW2A 5IGNA 4IR5A 5A7CA 4OGJA 3P1FA 5EM3A 3TLPA 5LJ2A 5D3HA 4HXPA 4O77A 3ERRA 5EK9A 5DKHA 3ZYUA 5EV9A 5LKUA 4NQMA 5HCLA 5D26A 4QR4A 5CUEA 5CTLA 2OSSA 3D1DA 5FFVA 4Z6IA 4YBTA 5ENIA 5FE1A 2I8NA 5HFRA 2RS9B 5EWHA 4AKGA 4N4HA 2YEMA 3UV2A 5A5RA 5COIA 4YBSA 5F62A 2DWWA 5CP5A 1ZS5A 5EI4A 4LYIA 4UYHA 4O7AA 5DW1A 3LQIA 5FE9A 4O7EA 2RI7A 5AMFA 4IR6A 4BW2A 4O75A 5G4SA 4O78A 5FE7A 5I7YA 4CUPA 3D7CA 5A5QA 5A5PA 3Q2FA 5FB1A 4GPJA 5H85A 5CQ7A 4X2IA 4N4FA 4LC2A 4CLBA 4QSUA 3SVHA 4NR5A 4QR5A 5AD3A 3G0JA 4QSRA 5DLZA 5E0RA 3U5JA 4YY4A 2LSPB 5CQ5A 4ZQLA 4O70A 4CL9A 5C87A 3MB4A 4O76A 5KTUA 4AI6A 2DKWA 3SVFA 3UV4A 5HRWA 5CFWA 1ZKRA 3P1DA 5D3TA 5F1LA 4HXLA 4YYHA 5FE0A 4LYSA 4ALHA 3VKHA 3IU6A 1WUGA 5BT5A 5CZGA 4QSQA 4NUDA 5F5ZA 2KTBB 3QZVA 2DVQA 4LRGA 4YYGA 2E3KA 5EISA 5C7NA 5D25A 5CRMA 4C66A 5FG5A 4UYFB 5L97A 3O34A 4NR4A 3MQMA 4BW3A 5F1HA 4MR5A 3U5KA 3P1CA 5FBXA 5JWMA 5A81A 4TTEA 5D3LA 4J3IA 3LQJA 5D0CA 5EP7A 5EPRA 2FSAA 4QSPA 4CFKA 4MEQA 5EWWA 1EQFA 4LZRA 3P1EA 5A85A 5DYXA 4YABA 5ENBA 5E3GA 3O33A 5DX4A 2DVVA 2MJVB 5CQ4A 5L8UA 5F61A 5IBNA 4UIYA 4BJXA 4HXRA 2NXBA 4NR9A 3GG3A 3QZTA 5G4RA 5ENJA 5FE6A 2DVRA 5CUAA 4QYDA 4UIXA 5EQ1A 4DONA 1PUOA 5KHMA 4PCIA 4ZW1A 5JI8A 4F3IA 5FH6A 4N4IA 5D3SA 5L96A 5ENCA 3LJWA 5EGUA 3AADA 3DAIA 3DWYA 5EA1A 5HFQA 2D82A 4LYWA 3JVKA 4N3WA 4Z1SA 3O37A 1X0JA 4CFLA 5DY7A 4NR6A 2L85A 5KO4A 5J0DA 5CQ8A 4HBYA 5A83A 5ACYA 4WHWA 5L8TA 4J0RA 5L98A 5HELA 2WP1A 2YEKA 4CUTA 5EWVA 4YADA 4UIWA 5C89A 3S91A 5KTWA 2OUOA 5A5NA 4A9LA 4LZSA 4QEUA 4YBMA 4IOQA 5E7DA 5F25A 4QC1A 5HJCA 4Z93A 4J1PA 4UYFA 5CQ6A 4YYMA 1N72A 2YW5A 2H60A 3MXFA 3HMEA 3MULA 5F36A 3U5OA 5E74A 4NYXA 4XUBA 3HMFA 2YELA 5HLSA 5ETBA 4UIVA 5CUCA 4KV1A 2DVSA 4QSVA 5E3DA 5II2A 2I7KA 4TT2A 4NQNA 4FLPA 5LKTA 1F68A 4LR6A 5CQ3A 4C67A 4Z1QA 5D3JA 4O7FA 4XY9A 5KTXA 4QB3A 5HQ6A 4QZSA 5LVRA 5IGMA 5FH7A 4QSSA 2L5EA 5DFCA 5I86A 4YAXA 4QC3A 4QEVA 4UIUA 5DYCA 5DKCA 5CY9A 3VKGA 5FFYA 4YH4A 4TYLA 3U5NA 4UYEA 5TB6A 5EWDA 2RNWA 5LUUA 2F6NA 4YY6A 4KCXA 5FDZA 4PTBA 3AQAA 5A5SA 5D24A 5FH8A 4WHUA 5EPBA 5BT4A 5F3AA 4YYNA 3NXBA 4QR3A 4YC9A 3JVMA 4MEOA 5E9YA 1E6IA 4O71A 4Y03A 4NUCA 3G0LA 4TT4A 4NYVA 5D7XA 4UYGA 5IG6A 5LKXA 4NUEA 4ALGA 4A9FA 2YYNA 5KU3A 4MEPA 4TZ8A 5HENA 4AKHA 5CPEA 4HBXA 5ENFA 4QSTA 4UYDA 3RCWA 5D3NA 4LZ2A 3UVYA 5FE8A 4E96A 5HM0A 4O7CA 3UVXA 5F2PA 5II1A 5L99A 5D3PA 4QEWA 5LJ0A 5DLXA 5HRVA 2OO1A 2L84A 3U5LA 5E9LA 4PS5A 4O7BA 4N4GA 3LXJA 4O74A 4XYAA 5K29A 5AMEA 2E7NA 4YYJA 5I40A 5BT3A 3UVDA 5CRZA 4O72A 5CU8A 5F60A 5C85A 5I80A 5ENHA 4PKLA 4Z6HA 4A9JA 3D1BA 3QZSA 4HXSA 2R0YA 3ONIA 5CUBA 2RNXA 4MR6A
chains in the Genus database with same CATH topology
3IU5A 3I3JA 4NS5A 5CUDA 4CUSA 3JVJA 5I88A 4HXNA 5FE3A 5I7XA 4ZC9A 5E9KA 2F6JA 5ETDA 2DATA 4QBMA 2R0VA 2YQDA 5CQTA 4HXKA 3P5OA 5CGPA 4TU6A 5EWCA 5FFWA 3S92A 4YYIA 5HRXA 4TU4A 5DKDA 5FB0A 1JM4B 5C8GA 4YATA 5E9MA 2GRCA 5I29A 4MR3A 3UW9A 4HBVA 5DYUA 5CQAA 3K2JA 4BW4A 5I83A 5A5OA 4IORA 5HQ5A 1WUMA 4XUAA 4OGIA 5LVQA 5CUGA 4HBWA 5H1TA 3JVLA 4HXMA 4TT6A 4NRAA 4J0SA 4PY6A 5ENEA 4PCEA 3HMHA 4IOOA 4IR4A 4NRCA 4YH3A 5F63A 4TZ2A 4LDFA 4HXOA 5EU1A 5FG4A 5IGLA 4QY4A 5EVAA 4NRBA 5EICA 5AD2A 4CUQA 4IR3A 4QUTA 4RVRA 5DYAA 2E7OA 5HEMA 4YYDA 5FE4A 4MR4A 3UV5A 4A9NA 4NR7A 4WIVA 2RO1A 3O35A 4NR8A 5H1VA 5D3RA 4YK0A 4KV4A 2N9GA 3O36A 5LJ1A 2D9EA 5IIDA 4UIZA 5E9IA 4QSWA 3MUKA 5CS8A 4A9MA 4BHWA 2G4AA 4A9HA 4A9KA 5ENGA 3LQHA 5FE5A 4QUUA 3SVGA 5I1QA 3Q2EA 3UVWA 5C4QA 2R0SA 5DBMA 4A9EA 2RFJA 4QYLA 5HQ7A 5H1UA 3U5PA 4TQNA 5EPSA 4AKNA 4YYKA 5I89A 5A82A 2WP2A 2YDWA 4MENA 3MB3A 4QNSA 4NXJA 1JSPB 5FG6A 4Q0OA 5DFBA 4BW1A 4CUUA 4CURA 4Q0NA 5LKZA 5FE2A 4TS8A 5IGKA 4A9IA 3FKMX 2RNYA 5DFDA 5TCMA 2R10A 5E9VA 4NYWA 4UITA 5E73A 4QSXA 4XY8A 3U5MA 4A9OA 4OUFA 5DW2A 5IGNA 4IR5A 5A7CA 4OGJA 3P1FA 5EM3A 3TLPA 5LJ2A 5D3HA 4HXPA 4O77A 5EK9A 5DKHA 3ZYUA 5EV9A 5LKUA 4NQMA 5HCLA 5D26A 4QR4A 5CUEA 5CTLA 2OSSA 5FFVA 4Z6IA 4YBTA 5ENIA 5FE1A 2I8NA 5HFRA 2RS9B 5EWHA 4N4HA 2YEMA 3UV2A 5A5RA 5COIA 4YBSA 5F62A 2DWWA 5CP5A 1ZS5A 5EI4A 4LYIA 4UYHA 4O7AA 5DW1A 3LQIA 5FE9A 4O7EA 2RI7A 5AMFA 4IR6A 4BW2A 4O75A 5G4SA 4O78A 5FE7A 5I7YA 4CUPA 3D7CA 5A5QA 5A5PA 3Q2FA 5FB1A 4GPJA 5H85A 5CQ7A 4X2IA 4N4FA 4LC2A 4CLBA 4QSUA 3SVHA 4NR5A 4QR5A 5AD3A 3G0JA 4QSRA 5DLZA 5E0RA 3U5JA 4YY4A 2LSPB 5CQ5A 4ZQLA 4O70A 4CL9A 5C87A 3MB4A 4O76A 5KTUA 2DKWA 3SVFA 3UV4A 5HRWA 5CFWA 3P1DA 5D3TA 5F1LA 4HXLA 4YYHA 5FE0A 4LYSA 4ALHA 3IU6A 1WUGA 5BT5A 5CZGA 4QSQA 4NUDA 5F5ZA 2KTBB 3QZVA 2DVQA 4LRGA 4YYGA 2E3KA 5EISA 5C7NA 5D25A 5CRMA 4C66A 5FG5A 4UYFB 5L97A 3O34A 4NR4A 3MQMA 4BW3A 5F1HA 4MR5A 3U5KA 3P1CA 5FBXA 5JWMA 5A81A 4TTEA 5D3LA 4J3IA 3LQJA 5D0CA 5EP7A 5EPRA 2FSAA 4QSPA 4CFKA 4MEQA 5EWWA 1EQFA 4LZRA 3P1EA 5A85A 5DYXA 4YABA 5ENBA 5E3GA 3O33A 5DX4A 2DVVA 2MJVB 5CQ4A 5L8UA 5F61A 5IBNA 4UIYA 4BJXA 4HXRA 2NXBA 4NR9A 3GG3A 3QZTA 5G4RA 5ENJA 5FE6A 2DVRA 5CUAA 4QYDA 4UIXA 5EQ1A 4DONA 5KHMA 4PCIA 4ZW1A 5JI8A 4F3IA 5FH6A 4N4IA 5D3SA 5L96A 5ENCA 3LJWA 5EGUA 3AADA 3DAIA 3DWYA 5EA1A 5HFQA 2D82A 4LYWA 3JVKA 4N3WA 4Z1SA 3O37A 1X0JA 4CFLA 5DY7A 4NR6A 2L85A 5KO4A 5J0DA 5CQ8A 4HBYA 5A83A 5ACYA 4WHWA 5L8TA 4J0RA 5L98A 5HELA 2WP1A 2YEKA 4CUTA 5EWVA 4YADA 4UIWA 5C89A 3S91A 5KTWA 2OUOA 5A5NA 4A9LA 4LZSA 4QEUA 4YBMA 4IOQA 5E7DA 5F25A 4QC1A 5HJCA 4Z93A 4J1PA 4UYFA 5CQ6A 4YYMA 1N72A 2YW5A 2H60A 3MXFA 3HMEA 3MULA 5F36A 3U5OA 5E74A 4NYXA 4XUBA 3HMFA 2YELA 5HLSA 5ETBA 4UIVA 5CUCA 4KV1A 2DVSA 4QSVA 5E3DA 5II2A 2I7KA 4TT2A 4NQNA 4FLPA 5LKTA 1F68A 4LR6A 5CQ3A 4C67A 4Z1QA 5D3JA 4O7FA 4XY9A 5KTXA 4QB3A 5HQ6A 4QZSA 5LVRA 5IGMA 5FH7A 4QSSA 2L5EA 5DFCA 5I86A 4YAXA 4QC3A 4QEVA 4UIUA 5DYCA 5DKCA 5CY9A 5FFYA 4YH4A 4TYLA 3U5NA 4UYEA 5TB6A 5EWDA 2RNWA 5LUUA 2F6NA 4YY6A 4KCXA 5FDZA 4PTBA 3AQAA 5A5SA 5D24A 5FH8A 4WHUA 5EPBA 5BT4A 5F3AA 4YYNA 3NXBA 4QR3A 3JVMA 4MEOA 4YC9A 5E9YA 1E6IA 4O71A 4Y03A 4NUCA 3G0LA 4TT4A 4NYVA 5D7XA 4UYGA 5IG6A 5LKXA 4NUEA 4ALGA 4A9FA 2YYNA 5KU3A 4MEPA 4TZ8A 5HENA 5CPEA 4HBXA 5ENFA 4QSTA 4UYDA 3RCWA 5D3NA 4LZ2A 3UVYA 5FE8A 4E96A 5HM0A 4O7CA 3UVXA 5F2PA 5II1A 5L99A 5D3PA 4QEWA 5LJ0A 5DLXA 5HRVA 2OO1A 2L84A 3U5LA 5E9LA 4PS5A 4O7BA 4N4GA 3LXJA 4O74A 4XYAA 5K29A 5AMEA 2E7NA 4YYJA 5I40A 5BT3A 3UVDA 5CRZA 4O72A 5CU8A 5F60A 5C85A 5I80A 5ENHA 4PKLA 4Z6HA 4A9JA 3QZSA 4HXSA 2R0YA 3ONIA 5CUBA 2RNXA 4MR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU5 A;  3I3J A;  4NS5 A;  5CUD A;  4CUS A;  3JVJ A;  5I88 A;  4HXN A;  5FE3 A;  5I7X A;  4ZC9 A;  5E9K A;  2F6J A;  5ETD A;  2DAT A;  4QBM A;  2R0V A;  2YQD A;  5CQT A;  4HXK A;  3P5O A;  5CGP A;  4TU6 A;  5EWC A;  5FFW A;  3S92 A;  4YYI A;  5HRX A;  4TU4 A;  5DKD A;  5FB0 A;  1JM4 B;  5C8G A;  4YAT A;  5E9M A;  2GRC A;  5I29 A;  4MR3 A;  3UW9 A;  4HBV A;  5DYU A;  5CQA A;  3K2J A;  4BW4 A;  5I83 A;  5A5O A;  4IOR A;  5HQ5 A;  1WUM A;  4XUA A;  4OGI A;  5LVQ A;  5CUG A;  4HBW A;  5H1T A;  3JVL A;  4HXM A;  4TT6 A;  4NRA A;  4J0S A;  4PY6 A;  5ENE A;  4PCE A;  3HMH A;  4IOO A;  4IR4 A;  4NRC A;  4YH3 A;  5F63 A;  4TZ2 A;  4LDF A;  4HXO A;  5EU1 A;  5FG4 A;  5IGL A;  4QY4 A;  5EVA A;  4NRB A;  5EIC A;  5AD2 A;  4CUQ A;  4IR3 A;  4QUT A;  4RVR A;  5DYA A;  2E7O A;  5HEM A;  4YYD A;  5FE4 A;  4MR4 A;  3UV5 A;  4A9N A;  4NR7 A;  4WIV A;  2RO1 A;  3O35 A;  4NR8 A;  5H1V A;  5D3R A;  4YK0 A;  4KV4 A;  2N9G A;  3O36 A;  5LJ1 A;  2D9E A;  5IID A;  4UIZ A;  5E9I A;  4QSW A;  3MUK A;  5CS8 A;  4A9M A;  4BHW A;  2G4A A;  4A9H A;  4A9K A;  5ENG A;  3LQH A;  5FE5 A;  4QUU A;  3SVG A;  5I1Q A;  3Q2E A;  3UVW A;  5C4Q A;  2R0S A;  5DBM A;  4A9E A;  2RFJ A;  4QYL A;  5HQ7 A;  5H1U A;  3U5P A;  4TQN A;  5EPS A;  4AKN A;  4YYK A;  5I89 A;  5A82 A;  2WP2 A;  2YDW A;  4MEN A;  3MB3 A;  4QNS A;  4NXJ A;  1JSP B;  5FG6 A;  4Q0O A;  5DFB A;  4BW1 A;  4CUU A;  4CUR A;  4Q0N A;  5LKZ A;  5FE2 A;  4TS8 A;  5IGK A;  4A9I A;  3FKM X;  2RNY A;  5DFD A;  5TCM A;  2R10 A;  5E9V A;  4NYW A;  4UIT A;  5E73 A;  4QSX A;  4XY8 A;  3U5M A;  4A9O A;  4OUF A;  5DW2 A;  5IGN A;  4IR5 A;  5A7C A;  4OGJ A;  3P1F A;  5EM3 A;  3TLP A;  5LJ2 A;  5D3H A;  4HXP A;  4O77 A;  5EK9 A;  5DKH A;  3ZYU A;  5EV9 A;  5LKU A;  4NQM A;  5HCL A;  5D26 A;  4QR4 A;  5CUE A;  5CTL A;  2OSS A;  5FFV A;  4Z6I A;  4YBT A;  5ENI A;  5FE1 A;  2I8N A;  5HFR A;  2RS9 B;  5EWH A;  4N4H A;  2YEM A;  3UV2 A;  5A5R A;  5COI A;  4YBS A;  5F62 A;  2DWW A;  5CP5 A;  1ZS5 A;  5EI4 A;  4LYI A;  4UYH A;  4O7A A;  5DW1 A;  3LQI A;  5FE9 A;  4O7E A;  2RI7 A;  5AMF A;  4IR6 A;  4BW2 A;  4O75 A;  5G4S A;  4O78 A;  5FE7 A;  5I7Y A;  4CUP A;  3D7C A;  5A5Q A;  5A5P A;  3Q2F A;  5FB1 A;  4GPJ A;  5H85 A;  5CQ7 A;  4X2I A;  4N4F A;  4LC2 A;  4CLB A;  4QSU A;  3SVH A;  4NR5 A;  4QR5 A;  5AD3 A;  3G0J A;  4QSR A;  5DLZ A;  5E0R A;  3U5J A;  4YY4 A;  2LSP B;  5CQ5 A;  4ZQL A;  4O70 A;  4CL9 A;  5C87 A;  3MB4 A;  4O76 A;  5KTU A;  2DKW A;  3SVF A;  3UV4 A;  5HRW A;  5CFW A;  3P1D A;  5D3T A;  5F1L A;  4HXL A;  4YYH A;  5FE0 A;  4LYS A;  4ALH A;  3IU6 A;  1WUG A;  5BT5 A;  5CZG A;  4QSQ A;  4NUD A;  5F5Z A;  2KTB B;  3QZV A;  2DVQ A;  4LRG A;  4YYG A;  2E3K A;  5EIS A;  5C7N A;  5D25 A;  5CRM A;  4C66 A;  5FG5 A;  4UYF B;  5L97 A;  3O34 A;  4NR4 A;  3MQM A;  4BW3 A;  5F1H A;  4MR5 A;  3U5K A;  3P1C A;  5FBX A;  5JWM A;  5A81 A;  4TTE A;  5D3L A;  4J3I A;  3LQJ A;  5D0C A;  5EP7 A;  5EPR A;  2FSA A;  4QSP A;  4CFK A;  4MEQ A;  5EWW A;  1EQF A;  4LZR A;  3P1E A;  5A85 A;  5DYX A;  4YAB A;  5ENB A;  5E3G A;  3O33 A;  5DX4 A;  2DVV A;  2MJV B;  5CQ4 A;  5L8U A;  5F61 A;  5IBN A;  4UIY A;  4BJX A;  4HXR A;  2NXB A;  4NR9 A;  3GG3 A;  3QZT A;  5G4R A;  5ENJ A;  5FE6 A;  2DVR A;  5CUA A;  4QYD A;  4UIX A;  5EQ1 A;  4DON A;  5KHM A;  4PCI A;  4ZW1 A;  5JI8 A;  4F3I A;  5FH6 A;  4N4I A;  5D3S A;  5L96 A;  5ENC A;  3LJW A;  5EGU A;  3AAD A;  3DAI A;  3DWY A;  5EA1 A;  5HFQ A;  2D82 A;  4LYW A;  3JVK A;  4N3W A;  4Z1S A;  3O37 A;  1X0J A;  4CFL A;  5DY7 A;  4NR6 A;  2L85 A;  5KO4 A;  5J0D A;  5CQ8 A;  4HBY A;  5A83 A;  5ACY A;  4WHW A;  5L8T A;  4J0R A;  5L98 A;  5HEL A;  2WP1 A;  2YEK A;  4CUT A;  5EWV A;  4YAD A;  4UIW A;  5C89 A;  3S91 A;  5KTW A;  2OUO A;  5A5N A;  4A9L A;  4LZS A;  4QEU A;  4YBM A;  4IOQ A;  5E7D A;  5F25 A;  4QC1 A;  5HJC A;  4Z93 A;  4J1P A;  4UYF A;  5CQ6 A;  4YYM A;  1N72 A;  2YW5 A;  2H60 A;  3MXF A;  3HME A;  3MUL A;  5F36 A;  3U5O A;  5E74 A;  4NYX A;  4XUB A;  3HMF A;  2YEL A;  5HLS A;  5ETB A;  4UIV A;  5CUC A;  4KV1 A;  2DVS A;  4QSV A;  5E3D A;  5II2 A;  2I7K A;  4TT2 A;  4NQN A;  4FLP A;  5LKT A;  1F68 A;  4LR6 A;  5CQ3 A;  4C67 A;  4Z1Q A;  5D3J A;  4O7F A;  4XY9 A;  5KTX A;  4QB3 A;  5HQ6 A;  4QZS A;  5LVR A;  5IGM A;  5FH7 A;  4QSS A;  2L5E A;  5DFC A;  5I86 A;  4YAX A;  4QC3 A;  4QEV A;  4UIU A;  5DYC A;  5DKC A;  5CY9 A;  5FFY A;  4YH4 A;  4TYL A;  3U5N A;  4UYE A;  5TB6 A;  5EWD A;  2RNW A;  5LUU A;  2F6N A;  4YY6 A;  4KCX A;  5FDZ A;  4PTB A;  3AQA A;  5A5S A;  5D24 A;  5FH8 A;  4WHU A;  5EPB A;  5BT4 A;  5F3A A;  4YYN A;  3NXB A;  4QR3 A;  3JVM A;  4MEO A;  4YC9 A;  5E9Y A;  1E6I A;  4O71 A;  4Y03 A;  4NUC A;  3G0L A;  4TT4 A;  4NYV A;  5D7X A;  4UYG A;  5IG6 A;  5LKX A;  4NUE A;  4ALG A;  4A9F A;  2YYN A;  5KU3 A;  4MEP A;  4TZ8 A;  5HEN A;  5CPE A;  4HBX A;  5ENF A;  4QST A;  4UYD A;  3RCW A;  5D3N A;  4LZ2 A;  3UVY A;  5FE8 A;  4E96 A;  5HM0 A;  4O7C A;  3UVX A;  5F2P A;  5II1 A;  5L99 A;  5D3P A;  4QEW A;  5LJ0 A;  5DLX A;  5HRV A;  2OO1 A;  2L84 A;  3U5L A;  5E9L A;  4PS5 A;  4O7B A;  4N4G A;  3LXJ A;  4O74 A;  4XYA A;  5K29 A;  5AME A;  2E7N A;  4YYJ A;  5I40 A;  5BT3 A;  3UVD A;  5CRZ A;  4O72 A;  5CU8 A;  5F60 A;  5C85 A;  5I80 A;  5ENH A;  4PKL A;  4Z6H A;  4A9J A;  3QZS A;  4HXS A;  2R0Y A;  3ONI A;  5CUB A;  2RNX A;  4MR6 A; 
#chains in the Genus database with same CATH topology
 3IU5 A;  3I3J A;  4NS5 A;  5CUD A;  4CUS A;  3JVJ A;  5I88 A;  4HXN A;  5FE3 A;  5I7X A;  4ZC9 A;  5E9K A;  2F6J A;  5ETD A;  2DAT A;  4QBM A;  2R0V A;  2YQD A;  5CQT A;  4HXK A;  3P5O A;  5CGP A;  4TU6 A;  5EWC A;  5FFW A;  3S92 A;  4YYI A;  5HRX A;  4TU4 A;  5DKD A;  5FB0 A;  1JM4 B;  5C8G A;  4YAT A;  5E9M A;  2GRC A;  5I29 A;  4MR3 A;  3UW9 A;  4HBV A;  5DYU A;  5CQA A;  3K2J A;  4BW4 A;  5I83 A;  5A5O A;  2EJN A;  4IOR A;  5HQ5 A;  1WUM A;  4XUA A;  4OGI A;  5LVQ A;  5CUG A;  4HBW A;  5H1T A;  3JVL A;  4HXM A;  4TT6 A;  4NRA A;  4J0S A;  4PY6 A;  5ENE A;  4PCE A;  3HMH A;  4IOO A;  4IR4 A;  4NRC A;  4YH3 A;  5F63 A;  4TZ2 A;  4LDF A;  4HXO A;  5EU1 A;  5FG4 A;  5IGL A;  4QY4 A;  5EVA A;  4NRB A;  5EIC A;  5AD2 A;  4CUQ A;  4IR3 A;  4QUT A;  4RVR A;  5DYA A;  2E7O A;  5HEM A;  4YYD A;  5FE4 A;  4MR4 A;  3UV5 A;  4A9N A;  4NR7 A;  4WIV A;  2RO1 A;  3O35 A;  4NR8 A;  5H1V A;  5D3R A;  4YK0 A;  4KV4 A;  2N9G A;  3O36 A;  5LJ1 A;  2D9E A;  5IID A;  4UIZ A;  5E9I A;  4QSW A;  3MUK A;  5CS8 A;  4A9M A;  4BHW A;  2G4A A;  4A9H A;  4A9K A;  5ENG A;  3LQH A;  5FE5 A;  4QUU A;  3SVG A;  5I1Q A;  3Q2E A;  3UVW A;  5C4Q A;  2R0S A;  5DBM A;  4A9E A;  2RFJ A;  4QYL A;  5HQ7 A;  5H1U A;  3U5P A;  4TQN A;  5EPS A;  4AKN A;  4YYK A;  4AKI A;  5I89 A;  5A82 A;  2WP2 A;  2YDW A;  4MEN A;  3MB3 A;  4QNS A;  4NXJ A;  1JSP B;  5FG6 A;  4Q0O A;  5DFB A;  4BW1 A;  4CUU A;  4CUR A;  4Q0N A;  5LKZ A;  5FE2 A;  4TS8 A;  5IGK A;  4A9I A;  3FKM X;  2RNY A;  5DFD A;  5TCM A;  2R10 A;  5E9V A;  4NYW A;  4UIT A;  5E73 A;  4QSX A;  4XY8 A;  3U5M A;  4A9O A;  4OUF A;  5DW2 A;  5IGN A;  4IR5 A;  5A7C A;  4OGJ A;  3P1F A;  5EM3 A;  3TLP A;  5LJ2 A;  5D3H A;  4HXP A;  4O77 A;  3ERR A;  5EK9 A;  5DKH A;  3ZYU A;  5EV9 A;  5LKU A;  4NQM A;  5HCL A;  5D26 A;  4QR4 A;  5CUE A;  5CTL A;  2OSS A;  3D1D A;  5FFV A;  4Z6I A;  4YBT A;  5ENI A;  5FE1 A;  2I8N A;  5HFR A;  2RS9 B;  5EWH A;  4AKG A;  4N4H A;  2YEM A;  3UV2 A;  5A5R A;  5COI A;  4YBS A;  5F62 A;  2DWW A;  5CP5 A;  1ZS5 A;  5EI4 A;  4LYI A;  4UYH A;  4O7A A;  5DW1 A;  3LQI A;  5FE9 A;  4O7E A;  2RI7 A;  5AMF A;  4IR6 A;  4BW2 A;  4O75 A;  5G4S A;  4O78 A;  5FE7 A;  5I7Y A;  4CUP A;  3D7C A;  5A5Q A;  5A5P A;  3Q2F A;  5FB1 A;  4GPJ A;  5H85 A;  5CQ7 A;  4X2I A;  4N4F A;  4LC2 A;  4CLB A;  4QSU A;  3SVH A;  4NR5 A;  4QR5 A;  5AD3 A;  3G0J A;  4QSR A;  5DLZ A;  5E0R A;  3U5J A;  4YY4 A;  2LSP B;  5CQ5 A;  4ZQL A;  4O70 A;  4CL9 A;  5C87 A;  3MB4 A;  4O76 A;  5KTU A;  4AI6 A;  2DKW A;  3SVF A;  3UV4 A;  5HRW A;  5CFW A;  1ZKR A;  3P1D A;  5D3T A;  5F1L A;  4HXL A;  4YYH A;  5FE0 A;  4LYS A;  4ALH A;  3VKH A;  3IU6 A;  1WUG A;  5BT5 A;  5CZG A;  4QSQ A;  4NUD A;  5F5Z A;  2KTB B;  3QZV A;  2DVQ A;  4LRG A;  4YYG A;  2E3K A;  5EIS A;  5C7N A;  5D25 A;  5CRM A;  4C66 A;  5FG5 A;  4UYF B;  5L97 A;  3O34 A;  4NR4 A;  3MQM A;  4BW3 A;  5F1H A;  4MR5 A;  3U5K A;  3P1C A;  5FBX A;  5JWM A;  5A81 A;  4TTE A;  5D3L A;  4J3I A;  3LQJ A;  5D0C A;  5EP7 A;  5EPR A;  2FSA A;  4QSP A;  4CFK A;  4MEQ A;  5EWW A;  1EQF A;  4LZR A;  3P1E A;  5A85 A;  5DYX A;  4YAB A;  5ENB A;  5E3G A;  3O33 A;  5DX4 A;  2DVV A;  2MJV B;  5CQ4 A;  5L8U A;  5F61 A;  5IBN A;  4UIY A;  4BJX A;  4HXR A;  2NXB A;  4NR9 A;  3GG3 A;  3QZT A;  5G4R A;  5ENJ A;  5FE6 A;  2DVR A;  5CUA A;  4QYD A;  4UIX A;  5EQ1 A;  4DON A;  1PUO A;  5KHM A;  4PCI A;  4ZW1 A;  5JI8 A;  4F3I A;  5FH6 A;  4N4I A;  5D3S A;  5L96 A;  5ENC A;  3LJW A;  5EGU A;  3AAD A;  3DAI A;  3DWY A;  5EA1 A;  5HFQ A;  2D82 A;  4LYW A;  3JVK A;  4N3W A;  4Z1S A;  3O37 A;  1X0J A;  4CFL A;  5DY7 A;  4NR6 A;  2L85 A;  5KO4 A;  5J0D A;  5CQ8 A;  4HBY A;  5A83 A;  5ACY A;  4WHW A;  5L8T A;  4J0R A;  5L98 A;  5HEL A;  2WP1 A;  2YEK A;  4CUT A;  5EWV A;  4YAD A;  4UIW A;  5C89 A;  3S91 A;  5KTW A;  2OUO A;  5A5N A;  4A9L A;  4LZS A;  4QEU A;  4YBM A;  4IOQ A;  5E7D A;  5F25 A;  4QC1 A;  5HJC A;  4Z93 A;  4J1P A;  4UYF A;  5CQ6 A;  4YYM A;  1N72 A;  2YW5 A;  2H60 A;  3MXF A;  3HME A;  3MUL A;  5F36 A;  3U5O A;  5E74 A;  4NYX A;  4XUB A;  3HMF A;  2YEL A;  5HLS A;  5ETB A;  4UIV A;  5CUC A;  4KV1 A;  2DVS A;  4QSV A;  5E3D A;  5II2 A;  2I7K A;  4TT2 A;  4NQN A;  4FLP A;  5LKT A;  1F68 A;  4LR6 A;  5CQ3 A;  4C67 A;  4Z1Q A;  5D3J A;  4O7F A;  4XY9 A;  5KTX A;  4QB3 A;  5HQ6 A;  4QZS A;  5LVR A;  5IGM A;  5FH7 A;  4QSS A;  2L5E A;  5DFC A;  5I86 A;  4YAX A;  4QC3 A;  4QEV A;  4UIU A;  5DYC A;  5DKC A;  5CY9 A;  3VKG A;  5FFY A;  4YH4 A;  4TYL A;  3U5N A;  4UYE A;  5TB6 A;  5EWD A;  2RNW A;  5LUU A;  2F6N A;  4YY6 A;  4KCX A;  5FDZ A;  4PTB A;  3AQA A;  5A5S A;  5D24 A;  5FH8 A;  4WHU A;  5EPB A;  5BT4 A;  5F3A A;  4YYN A;  3NXB A;  4QR3 A;  4YC9 A;  3JVM A;  4MEO A;  5E9Y A;  1E6I A;  4O71 A;  4Y03 A;  4NUC A;  3G0L A;  4TT4 A;  4NYV A;  5D7X A;  4UYG A;  5IG6 A;  5LKX A;  4NUE A;  4ALG A;  4A9F A;  2YYN A;  5KU3 A;  4MEP A;  4TZ8 A;  5HEN A;  4AKH A;  5CPE A;  4HBX A;  5ENF A;  4QST A;  4UYD A;  3RCW A;  5D3N A;  4LZ2 A;  3UVY A;  5FE8 A;  4E96 A;  5HM0 A;  4O7C A;  3UVX A;  5F2P A;  5II1 A;  5L99 A;  5D3P A;  4QEW A;  5LJ0 A;  5DLX A;  5HRV A;  2OO1 A;  2L84 A;  3U5L A;  5E9L A;  4PS5 A;  4O7B A;  4N4G A;  3LXJ A;  4O74 A;  4XYA A;  5K29 A;  5AME A;  2E7N A;  4YYJ A;  5I40 A;  5BT3 A;  3UVD A;  5CRZ A;  4O72 A;  5CU8 A;  5F60 A;  5C85 A;  5I80 A;  5ENH A;  4PKL A;  4Z6H A;  4A9J A;  3D1B A;  3QZS A;  4HXS A;  2R0Y A;  3ONI A;  5CUB A;  2RNX A;  4MR6 A; 
#chains in the Genus database with same CATH homology
 3IU5 A;  3I3J A;  4NS5 A;  5CUD A;  4CUS A;  3JVJ A;  5I88 A;  4HXN A;  5FE3 A;  5I7X A;  4ZC9 A;  5E9K A;  2F6J A;  5ETD A;  2DAT A;  4QBM A;  2R0V A;  2YQD A;  5CQT A;  4HXK A;  3P5O A;  5CGP A;  4TU6 A;  5EWC A;  5FFW A;  3S92 A;  4YYI A;  5HRX A;  4TU4 A;  5DKD A;  5FB0 A;  1JM4 B;  5C8G A;  4YAT A;  5E9M A;  2GRC A;  5I29 A;  4MR3 A;  3UW9 A;  4HBV A;  5DYU A;  5CQA A;  3K2J A;  4BW4 A;  5I83 A;  5A5O A;  4IOR A;  5HQ5 A;  1WUM A;  4XUA A;  4OGI A;  5LVQ A;  5CUG A;  4HBW A;  5H1T A;  3JVL A;  4HXM A;  4TT6 A;  4NRA A;  4J0S A;  4PY6 A;  5ENE A;  4PCE A;  3HMH A;  4IOO A;  4IR4 A;  4NRC A;  4YH3 A;  5F63 A;  4TZ2 A;  4LDF A;  4HXO A;  5EU1 A;  5FG4 A;  5IGL A;  4QY4 A;  5EVA A;  4NRB A;  5EIC A;  5AD2 A;  4CUQ A;  4IR3 A;  4QUT A;  4RVR A;  5DYA A;  2E7O A;  5HEM A;  4YYD A;  5FE4 A;  4MR4 A;  3UV5 A;  4A9N A;  4NR7 A;  4WIV A;  2RO1 A;  3O35 A;  4NR8 A;  5H1V A;  5D3R A;  4YK0 A;  4KV4 A;  2N9G A;  3O36 A;  5LJ1 A;  2D9E A;  5IID A;  4UIZ A;  5E9I A;  4QSW A;  3MUK A;  5CS8 A;  4A9M A;  4BHW A;  2G4A A;  4A9H A;  4A9K A;  5ENG A;  3LQH A;  5FE5 A;  4QUU A;  3SVG A;  5I1Q A;  3Q2E A;  3UVW A;  5C4Q A;  2R0S A;  5DBM A;  4A9E A;  2RFJ A;  4QYL A;  5HQ7 A;  5H1U A;  3U5P A;  4TQN A;  5EPS A;  4AKN A;  4YYK A;  5I89 A;  5A82 A;  2WP2 A;  2YDW A;  4MEN A;  3MB3 A;  4QNS A;  4NXJ A;  1JSP B;  5FG6 A;  4Q0O A;  5DFB A;  4BW1 A;  4CUU A;  4CUR A;  4Q0N A;  5LKZ A;  5FE2 A;  4TS8 A;  5IGK A;  4A9I A;  3FKM X;  2RNY A;  5DFD A;  5TCM A;  2R10 A;  5E9V A;  4NYW A;  4UIT A;  5E73 A;  4QSX A;  4XY8 A;  3U5M A;  4A9O A;  4OUF A;  5DW2 A;  5IGN A;  4IR5 A;  5A7C A;  4OGJ A;  3P1F A;  5EM3 A;  3TLP A;  5LJ2 A;  5D3H A;  4HXP A;  4O77 A;  5EK9 A;  5DKH A;  3ZYU A;  5EV9 A;  5LKU A;  4NQM A;  5HCL A;  5D26 A;  4QR4 A;  5CUE A;  5CTL A;  2OSS A;  5FFV A;  4Z6I A;  4YBT A;  5ENI A;  5FE1 A;  2I8N A;  5HFR A;  2RS9 B;  5EWH A;  4N4H A;  2YEM A;  3UV2 A;  5A5R A;  5COI A;  4YBS A;  5F62 A;  2DWW A;  5CP5 A;  1ZS5 A;  5EI4 A;  4LYI A;  4UYH A;  4O7A A;  5DW1 A;  3LQI A;  5FE9 A;  4O7E A;  2RI7 A;  5AMF A;  4IR6 A;  4BW2 A;  4O75 A;  5G4S A;  4O78 A;  5FE7 A;  5I7Y A;  4CUP A;  3D7C A;  5A5Q A;  5A5P A;  3Q2F A;  5FB1 A;  4GPJ A;  5H85 A;  5CQ7 A;  4X2I A;  4N4F A;  4LC2 A;  4CLB A;  4QSU A;  3SVH A;  4NR5 A;  4QR5 A;  5AD3 A;  3G0J A;  4QSR A;  5DLZ A;  5E0R A;  3U5J A;  4YY4 A;  2LSP B;  5CQ5 A;  4ZQL A;  4O70 A;  4CL9 A;  5C87 A;  3MB4 A;  4O76 A;  5KTU A;  2DKW A;  3SVF A;  3UV4 A;  5HRW A;  5CFW A;  3P1D A;  5D3T A;  5F1L A;  4HXL A;  4YYH A;  5FE0 A;  4LYS A;  4ALH A;  3IU6 A;  1WUG A;  5BT5 A;  5CZG A;  4QSQ A;  4NUD A;  5F5Z A;  2KTB B;  3QZV A;  2DVQ A;  4LRG A;  4YYG A;  2E3K A;  5EIS A;  5C7N A;  5D25 A;  5CRM A;  4C66 A;  5FG5 A;  4UYF B;  5L97 A;  3O34 A;  4NR4 A;  3MQM A;  4BW3 A;  5F1H A;  4MR5 A;  3U5K A;  3P1C A;  5FBX A;  5JWM A;  5A81 A;  4TTE A;  5D3L A;  4J3I A;  3LQJ A;  5D0C A;  5EP7 A;  5EPR A;  2FSA A;  4QSP A;  4CFK A;  4MEQ A;  5EWW A;  1EQF A;  4LZR A;  3P1E A;  5A85 A;  5DYX A;  4YAB A;  5ENB A;  5E3G A;  3O33 A;  5DX4 A;  2DVV A;  2MJV B;  5CQ4 A;  5L8U A;  5F61 A;  5IBN A;  4UIY A;  4BJX A;  4HXR A;  2NXB A;  4NR9 A;  3GG3 A;  3QZT A;  5G4R A;  5ENJ A;  5FE6 A;  2DVR A;  5CUA A;  4QYD A;  4UIX A;  5EQ1 A;  4DON A;  5KHM A;  4PCI A;  4ZW1 A;  5JI8 A;  4F3I A;  5FH6 A;  4N4I A;  5D3S A;  5L96 A;  5ENC A;  3LJW A;  5EGU A;  3AAD A;  3DAI A;  3DWY A;  5EA1 A;  5HFQ A;  2D82 A;  4LYW A;  3JVK A;  4N3W A;  4Z1S A;  3O37 A;  1X0J A;  4CFL A;  5DY7 A;  4NR6 A;  2L85 A;  5KO4 A;  5J0D A;  5CQ8 A;  4HBY A;  5A83 A;  5ACY A;  4WHW A;  5L8T A;  4J0R A;  5L98 A;  5HEL A;  2WP1 A;  2YEK A;  4CUT A;  5EWV A;  4YAD A;  4UIW A;  5C89 A;  3S91 A;  5KTW A;  2OUO A;  5A5N A;  4A9L A;  4LZS A;  4QEU A;  4YBM A;  4IOQ A;  5E7D A;  5F25 A;  4QC1 A;  5HJC A;  4Z93 A;  4J1P A;  4UYF A;  5CQ6 A;  4YYM A;  1N72 A;  2YW5 A;  2H60 A;  3MXF A;  3HME A;  3MUL A;  5F36 A;  3U5O A;  5E74 A;  4NYX A;  4XUB A;  3HMF A;  2YEL A;  5HLS A;  5ETB A;  4UIV A;  5CUC A;  4KV1 A;  2DVS A;  4QSV A;  5E3D A;  5II2 A;  2I7K A;  4TT2 A;  4NQN A;  4FLP A;  5LKT A;  1F68 A;  4LR6 A;  5CQ3 A;  4C67 A;  4Z1Q A;  5D3J A;  4O7F A;  4XY9 A;  5KTX A;  4QB3 A;  5HQ6 A;  4QZS A;  5LVR A;  5IGM A;  5FH7 A;  4QSS A;  2L5E A;  5DFC A;  5I86 A;  4YAX A;  4QC3 A;  4QEV A;  4UIU A;  5DYC A;  5DKC A;  5CY9 A;  5FFY A;  4YH4 A;  4TYL A;  3U5N A;  4UYE A;  5TB6 A;  5EWD A;  2RNW A;  5LUU A;  2F6N A;  4YY6 A;  4KCX A;  5FDZ A;  4PTB A;  3AQA A;  5A5S A;  5D24 A;  5FH8 A;  4WHU A;  5EPB A;  5BT4 A;  5F3A A;  4YYN A;  3NXB A;  4QR3 A;  3JVM A;  4MEO A;  4YC9 A;  5E9Y A;  1E6I A;  4O71 A;  4Y03 A;  4NUC A;  3G0L A;  4TT4 A;  4NYV A;  5D7X A;  4UYG A;  5IG6 A;  5LKX A;  4NUE A;  4ALG A;  4A9F A;  2YYN A;  5KU3 A;  4MEP A;  4TZ8 A;  5HEN A;  5CPE A;  4HBX A;  5ENF A;  4QST A;  4UYD A;  3RCW A;  5D3N A;  4LZ2 A;  3UVY A;  5FE8 A;  4E96 A;  5HM0 A;  4O7C A;  3UVX A;  5F2P A;  5II1 A;  5L99 A;  5D3P A;  4QEW A;  5LJ0 A;  5DLX A;  5HRV A;  2OO1 A;  2L84 A;  3U5L A;  5E9L A;  4PS5 A;  4O7B A;  4N4G A;  3LXJ A;  4O74 A;  4XYA A;  5K29 A;  5AME A;  2E7N A;  4YYJ A;  5I40 A;  5BT3 A;  3UVD A;  5CRZ A;  4O72 A;  5CU8 A;  5F60 A;  5C85 A;  5I80 A;  5ENH A;  4PKL A;  4Z6H A;  4A9J A;  3QZS A;  4HXS A;  2R0Y A;  3ONI A;  5CUB A;  2RNX A;  4MR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...