5HRWA

Crystal structure of the fifth bromodomain of human pb1 in complex with 1-propylisochromeno[3,4-c]pyrazol-5(2h)-one) compound
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
110
structure length
110
Chain Sequence
YMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein polybromo-1
publication title Discovery and Optimization of a Selective Ligand for the Switch/Sucrose Nonfermenting-Related Bromodomains of Polybromo Protein-1 by the Use of Virtual Screening and Hydration Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5hrwA00
3AQAA 4PS5A 5HQ5A 3O35A 4O7FA 4PY6A 4NR6A 5DKHA 3QZSA 5HENA 5C8GA 5LJ0A 3P5OA 2I7KA 4O74A 4CUQA 3UVDA 5FE2A 5CGPA 5EV9A 4MEQA 3IU6A 4UIZA 4TT4A 3IU5A 5ENGA 4YYHA 5A5QA 5DLXA 4NR5A 5D3PA 5FE1A 5CUCA 5D7XA 4ZQLA 3S91A 2DATA 4QC3A 4A9OA 5E73A 2LSPB 2D82A 5FE4A 5EWWA 4UYDA 5FDZA 4BHWA 4YYKA 5F63A 4O7BA 2DVQA 5HELA 4NR7A 1X0JA 4KCXA 4NUCA 5LKXA 4MR6A 4YBTA 2WP2A 5HRVA 5EGUA 5COIA 4N4IA 2R0YA 4ZW1A 4QSWA 4KV4A 5L99A 5G4RA 4NUDA 4YY4A 3U5NA 4NYXA 4QZSA 5LJ1A 4HBXA 4TS8A 2YQDA 4QSSA 5FE5A 4N4GA 3O37A 5CU8A 5A5PA 4YY6A 2F6JA 5HRXA 5CQTA 4PCIA 4UITA 5E7DA 3QZTA 5F36A 5CZGA 5A5NA 5TB6A 4LYIA 4RVRA 5F25A 5CQ4A 4QBMA 4QSRA 5ENEA 4YBSA 4CUPA 3P1DA 5D3RA 5KTXA 4XY9A 1F68A 2E7OA 5A85A 4X2IA 5ENCA 2KTBB 5EPBA 5EWDA 4BW3A 4Z1QA 4PTBA 4KV1A 5I86A 4FLPA 5IGNA 4HXPA 5F2PA 4YADA 4MEOA 3U5MA 4UYHA 5F1LA 3SVFA 4YYDA 4TTEA 5E0RA 4J0SA 5HQ6A 5L8TA 4C67A 4XUBA 4LYWA 4YYNA 5H1TA 3U5LA 5CRMA 4TU4A 5DYCA 5AMFA 1E6IA 4NRBA 4A9MA 5CS8A 4IR6A 5EP7A 5TCMA 3G0JA 4C66A 3JVMA 3HMHA 3Q2FA 4QYDA 4NUEA 5FE9A 4O77A 5L98A 5I83A 5DW2A 4N4FA 5BT5A 5FB0A 4QYLA 4Z93A 5EPRA 2OUOA 5AD2A 5C85A 2OO1A 5KHMA 5DFCA 4NYWA 5CP5A 5HJCA 5I40A 4O70A 4ZC9A 4LRGA 4UYGA 5K29A 4HBVA 4LZ2A 4IORA 4UIUA 4IR5A 4A9KA 5HRWA 3U5KA 4HBYA 2RI7A 5IGMA 5FFVA 4CLBA 3MUKA 5FH7A 4TQNA 2RFJA 3O33A 5LVQA 3MULA 5EQ1A 4QUTA 4QY4A 5CPEA 3AADA 4O7EA 5LJ2A 4TT2A 4MR3A 1ZS5A 5FH6A 4NR4A 4MENA 4Q0OA 5CY9A 1JSPB 3UV2A 5A5RA 1JM4B 4QEUA 4O78A 4LYSA 4UIVA 5FE7A 5D3SA 3JVKA 5DFBA 4YK0A 2YYNA 5II2A 5CQ3A 4CUUA 3P1EA 5EWCA 4QUUA 5D25A 4XYAA 3UVWA 5EPSA 5CQ6A 4MR5A 2RNXA 3S92A 4HXKA 2E7NA 2N9GA 3UV5A 5HLSA 5EM3A 4A9FA 5IGLA 4UIYA 5ENJA 5I7XA 4O72A 5FE6A 5H1UA 5FE3A 5A82A 4WHUA 5F3AA 4YYIA 3RCWA 5FE0A 4HXMA 3UVYA 5A83A 5C7NA 3JVJA 5FG5A 5CUEA 2R0SA 5H85A 4AKNA 4QEWA 4CUSA 4Z1SA 4QSXA 4NYVA 2I8NA 2YW5A 3G0LA 4BJXA 5D3HA 2DWWA 5CQ8A 5G4SA 5IIDA 4LC2A 4QSUA 5DYUA 4OGIA 5EICA 2RS9B 4QSTA 4QSQA 4O75A 4WIVA 1WUMA 5II1A 3MQMA 4UYFB 4BW2A 5CUGA 4MEPA 4DONA 5DX4A 5LKZA 5DFDA 5HQ7A 4QNSA 4YYJA 4J3IA 5IG6A 3MB3A 5E9LA 2FSAA 4MR4A 5DKDA 5C4QA 3GG3A 5HFRA 4YC9A 4HXNA 3U5OA 4QB3A 5I89A 5DBMA 4O71A 4A9HA 2YELA 4BW4A 5CQ5A 4YH3A 2NXBA 5ETDA 5JI8A 4J0RA 5ENBA 5EWVA 4Y03A 5FE8A 5BT3A 5CTLA 2RO1A 2GRCA 5A7CA 5E9VA 5IBNA 5CUBA 5ENIA 5EK9A 3NXBA 4HXSA 2YEMA 4N3WA 4LR6A 4QR4A 5E74A 5DLZA 4YBMA 5CRZA 4GPJA 5CUDA 3DWYA 5DYXA 4IOQA 5LKUA 5F62A 3D7CA 2DKWA 5DKCA 3I3JA 5FG4A 5I29A 2OSSA 3LJWA 3HMEA 5A81A 5F1HA 5I7YA 4OGJA 3MB4A 5AD3A 3O34A 5I80A 5D3LA 5ENFA 5DYAA 3UW9A 5EI4A 4TU6A 4LZSA 4NQMA 5HM0A 5LVRA 5A5SA 5J0DA 5FG6A 2RNYA 4UIWA 5D3JA 5ACYA 2L84A 4QEVA 2D9EA 2H60A 5HEMA 4YYGA 5E3DA 4WHWA 5EWHA 2DVVA 4F3IA 3P1FA 5KTUA 4UYEA 3FKMX 4A9IA 2YEKA 4YH4A 5KU3A 4XY8A 3LXJA 5FFWA 4CUTA 4CURA 5C87A 5I88A 5LUUA 5F60A 5JWMA 5D3TA 5EA1A 4LZRA 4HXLA 3P1CA 2DVSA 5I1QA 4A9JA 4TT6A 3TLPA 4NS5A 4QC1A 5L96A 2E3KA 2MJVB 5FH8A 4HBWA 3QZVA 2RNWA 5L97A 3UV4A 5CFWA 5FFYA 2WP1A 5KO4A 3HMFA 3O36A 4NRAA 5KTWA 1EQFA 3DAIA 3LQHA 4O76A 4A9EA 4ALHA 4OUFA 4QR5A 5C89A 5ETBA 5DY7A 4UIXA 4O7CA 4E96A 2L5EA 5H1VA 4TZ8A 4CL9A 2G4AA 5E9MA 2L85A 4NQNA 5EU1A 4HXOA 3U5JA 5F5ZA 4XUAA 5D0CA 5FB1A 5CUAA 4BW1A 3LQJA 3Q2EA 5F61A 5ENHA 4PCEA 4TZ2A 5BT4A 3SVGA 4CFLA 3MXFA 5LKTA 3UVXA 5A5OA 2R0VA 5HFQA 4Z6IA 4HXRA 4NRCA 3JVLA 4QSPA 5E3GA 4A9NA 3LQIA 4LDFA 4UYFA 3ZYUA 4IOOA 4TYLA 4YAXA 4IR4A 2F6NA 2YDWA 4Z6HA 4NXJA 1N72A 5L8UA 3K2JA 4YYMA 4NR9A 4ALGA 3U5PA 4YATA 5AMEA 1WUGA 5D24A 5E9KA 5IGKA 4CFKA 4IR3A 5EVAA 5E9IA 5D3NA 5CQ7A 5DW1A 2DVRA 3SVHA 4Q0NA 5FBXA 3ONIA 5HCLA 5D26A 4J1PA 4O7AA 4QSVA 4A9LA 5E9YA 4PKLA 5CQAA 4NR8A 5EISA 4N4HA 4YABA 4QR3A 2R10A
chains in the Genus database with same CATH superfamily
3AQAA 4PS5A 5HQ5A 3O35A 4O7FA 4PY6A 4NR6A 5DKHA 3QZSA 5HENA 5C8GA 5LJ0A 3P5OA 2I7KA 4O74A 4CUQA 3UVDA 5FE2A 5CGPA 5EV9A 4MEQA 3IU6A 4UIZA 4TT4A 3IU5A 5ENGA 4YYHA 5A5QA 5DLXA 4NR5A 5D3PA 5FE1A 5CUCA 5D7XA 4ZQLA 3S91A 2DATA 4QC3A 4A9OA 5E73A 2LSPB 2D82A 5FE4A 5EWWA 4UYDA 5FDZA 4BHWA 4YYKA 5F63A 4O7BA 2DVQA 5HELA 4NR7A 1X0JA 4KCXA 4NUCA 5LKXA 4MR6A 4YBTA 2WP2A 5HRVA 5EGUA 5COIA 4N4IA 2R0YA 4ZW1A 4QSWA 4KV4A 5L99A 5G4RA 4NUDA 4YY4A 3U5NA 4NYXA 4QZSA 5LJ1A 4HBXA 4TS8A 2YQDA 4QSSA 5FE5A 4N4GA 3O37A 5CU8A 5A5PA 4YY6A 2F6JA 5HRXA 5CQTA 4PCIA 4UITA 5E7DA 3QZTA 5F36A 3VKHA 5CZGA 5A5NA 5TB6A 4LYIA 4RVRA 5F25A 5CQ4A 4QBMA 4QSRA 5ENEA 4AI6A 4YBSA 4CUPA 3P1DA 5D3RA 5KTXA 4XY9A 1F68A 2E7OA 3D1BA 5A85A 4X2IA 5ENCA 2KTBB 5EPBA 5EWDA 4BW3A 4Z1QA 4PTBA 4KV1A 5I86A 4FLPA 5IGNA 4HXPA 5F2PA 4YADA 4MEOA 3U5MA 4UYHA 5F1LA 3SVFA 4YYDA 4TTEA 5E0RA 4J0SA 5HQ6A 5L8TA 4C67A 4XUBA 4LYWA 4YYNA 5H1TA 3U5LA 5CRMA 4TU4A 5DYCA 5AMFA 1E6IA 4NRBA 4A9MA 5CS8A 4IR6A 4AKGA 5EP7A 5TCMA 3G0JA 4C66A 3JVMA 3HMHA 3Q2FA 4QYDA 4NUEA 5FE9A 4AKHA 4O77A 5L98A 5I83A 5DW2A 4N4FA 5BT5A 5FB0A 4QYLA 4Z93A 5EPRA 2OUOA 5AD2A 5C85A 2OO1A 5KHMA 5DFCA 4NYWA 5CP5A 5HJCA 5I40A 4O70A 4ZC9A 4LRGA 4UYGA 5K29A 4HBVA 4LZ2A 4IORA 4UIUA 4IR5A 4A9KA 5HRWA 3U5KA 4HBYA 2RI7A 5IGMA 5FFVA 4CLBA 3MUKA 5FH7A 4TQNA 2RFJA 3O33A 5LVQA 3MULA 5EQ1A 1ZKRA 4QUTA 4QY4A 5CPEA 3AADA 4O7EA 5LJ2A 4TT2A 4MR3A 1ZS5A 5FH6A 4NR4A 4MENA 4Q0OA 5CY9A 1JSPB 3UV2A 5A5RA 1JM4B 4QEUA 4O78A 4LYSA 4UIVA 5FE7A 5D3SA 3JVKA 5DFBA 4YK0A 2YYNA 5II2A 5CQ3A 4CUUA 3P1EA 5EWCA 4QUUA 5D25A 4XYAA 3UVWA 5EPSA 5CQ6A 4MR5A 2RNXA 3S92A 4HXKA 2E7NA 2N9GA 3UV5A 5HLSA 5EM3A 4A9FA 5IGLA 4UIYA 5ENJA 5I7XA 4O72A 5FE6A 5H1UA 5FE3A 5A82A 4WHUA 5F3AA 4YYIA 3RCWA 5FE0A 4HXMA 3UVYA 5A83A 5C7NA 3JVJA 5FG5A 5CUEA 2R0SA 5H85A 4AKNA 4QEWA 4CUSA 4Z1SA 4QSXA 4NYVA 2I8NA 2YW5A 3G0LA 4BJXA 5D3HA 2DWWA 5CQ8A 5G4SA 5IIDA 4LC2A 4QSUA 5DYUA 4OGIA 5EICA 2RS9B 4QSTA 4QSQA 4O75A 4WIVA 1WUMA 5II1A 3MQMA 4UYFB 4BW2A 5CUGA 4MEPA 4DONA 5DX4A 5LKZA 5DFDA 5HQ7A 4QNSA 4YYJA 4J3IA 5IG6A 3MB3A 5E9LA 2FSAA 4MR4A 5DKDA 5C4QA 3GG3A 5HFRA 4YC9A 4HXNA 3U5OA 4QB3A 3ERRA 5I89A 5DBMA 4O71A 4A9HA 2YELA 4BW4A 5CQ5A 4YH3A 2NXBA 5ETDA 5JI8A 4J0RA 5ENBA 5EWVA 4Y03A 5FE8A 5BT3A 5CTLA 2RO1A 2GRCA 5A7CA 5E9VA 5IBNA 5CUBA 5ENIA 5EK9A 3NXBA 4HXSA 2YEMA 4N3WA 4LR6A 4QR4A 5E74A 5DLZA 4YBMA 5CRZA 4GPJA 5CUDA 3DWYA 5DYXA 4IOQA 3D1DA 5LKUA 5F62A 3D7CA 2DKWA 5DKCA 3I3JA 5FG4A 5I29A 2OSSA 3LJWA 3HMEA 5A81A 4AKIA 5F1HA 5I7YA 4OGJA 3MB4A 5AD3A 3O34A 5I80A 5D3LA 5ENFA 5DYAA 3UW9A 5EI4A 4TU6A 4LZSA 4NQMA 5HM0A 5LVRA 5A5SA 5J0DA 5FG6A 2RNYA 4UIWA 5D3JA 5ACYA 2L84A 4QEVA 2D9EA 2H60A 5HEMA 4YYGA 5E3DA 4WHWA 5EWHA 2DVVA 4F3IA 3P1FA 5KTUA 4UYEA 3FKMX 4A9IA 2YEKA 4YH4A 5KU3A 4XY8A 3LXJA 5FFWA 4CUTA 4CURA 5C87A 5I88A 5LUUA 5F60A 5JWMA 5D3TA 5EA1A 4LZRA 4HXLA 3P1CA 2DVSA 5I1QA 4A9JA 4TT6A 3TLPA 4NS5A 4QC1A 5L96A 2E3KA 2MJVB 5FH8A 4HBWA 3QZVA 2RNWA 5L97A 3UV4A 5CFWA 5FFYA 2WP1A 5KO4A 3HMFA 3O36A 4NRAA 5KTWA 1EQFA 3DAIA 3LQHA 4O76A 4A9EA 4ALHA 4OUFA 4QR5A 5C89A 5ETBA 5DY7A 2EJNA 4UIXA 4O7CA 4E96A 2L5EA 5H1VA 4TZ8A 4CL9A 2G4AA 5E9MA 2L85A 4NQNA 5EU1A 4HXOA 3U5JA 5F5ZA 4XUAA 5D0CA 5FB1A 5CUAA 4BW1A 3LQJA 3Q2EA 5F61A 5ENHA 4PCEA 4TZ2A 5BT4A 3SVGA 4CFLA 3MXFA 5LKTA 3UVXA 5A5OA 2R0VA 5HFQA 4Z6IA 4HXRA 4NRCA 3JVLA 4QSPA 5E3GA 4A9NA 3LQIA 4LDFA 4UYFA 3ZYUA 4IOOA 4TYLA 4YAXA 1PUOA 4IR4A 2F6NA 2YDWA 4Z6HA 4NXJA 1N72A 5L8UA 3K2JA 4YYMA 4NR9A 4ALGA 3VKGA 3U5PA 4YATA 5AMEA 1WUGA 5D24A 5E9KA 5IGKA 4CFKA 4IR3A 5EVAA 5E9IA 5D3NA 5CQ7A 5DW1A 2DVRA 3SVHA 4Q0NA 5FBXA 3ONIA 5HCLA 5D26A 4J1PA 4O7AA 4QSVA 4A9LA 5E9YA 4PKLA 5CQAA 4NR8A 5EISA 4N4HA 4YABA 4QR3A 2R10A
chains in the Genus database with same CATH topology
3AQAA 4PS5A 5HQ5A 3O35A 4O7FA 4PY6A 4NR6A 5DKHA 3QZSA 5HENA 5C8GA 5LJ0A 3P5OA 2I7KA 4O74A 4CUQA 3UVDA 5FE2A 5CGPA 5EV9A 4MEQA 3IU6A 4UIZA 4TT4A 3IU5A 5ENGA 4YYHA 5A5QA 5DLXA 4NR5A 5D3PA 5FE1A 5CUCA 5D7XA 4ZQLA 3S91A 2DATA 4QC3A 4A9OA 5E73A 2LSPB 2D82A 5FE4A 5EWWA 4UYDA 5FDZA 4BHWA 4YYKA 5F63A 4O7BA 2DVQA 5HELA 4NR7A 1X0JA 4KCXA 4NUCA 5LKXA 4MR6A 4YBTA 2WP2A 5HRVA 5EGUA 5COIA 4N4IA 2R0YA 4ZW1A 4QSWA 4KV4A 5L99A 5G4RA 4NUDA 4YY4A 3U5NA 4NYXA 4QZSA 5LJ1A 4HBXA 4TS8A 2YQDA 4QSSA 5FE5A 4N4GA 3O37A 5CU8A 5A5PA 4YY6A 2F6JA 5HRXA 5CQTA 4PCIA 4UITA 5E7DA 3QZTA 5F36A 5CZGA 5A5NA 5TB6A 4LYIA 4RVRA 5F25A 5CQ4A 4QBMA 4QSRA 5ENEA 4YBSA 4CUPA 3P1DA 5D3RA 5KTXA 4XY9A 1F68A 2E7OA 5A85A 4X2IA 5ENCA 2KTBB 5EPBA 5EWDA 4BW3A 4Z1QA 4PTBA 4KV1A 5I86A 4FLPA 5IGNA 4HXPA 5F2PA 4YADA 4MEOA 3U5MA 4UYHA 5F1LA 3SVFA 4YYDA 4TTEA 5E0RA 4J0SA 5HQ6A 5L8TA 4C67A 4XUBA 4LYWA 4YYNA 5H1TA 3U5LA 5CRMA 4TU4A 5DYCA 5AMFA 1E6IA 4NRBA 4A9MA 5CS8A 4IR6A 5EP7A 5TCMA 3G0JA 4C66A 3JVMA 3HMHA 3Q2FA 4QYDA 4NUEA 5FE9A 4O77A 5L98A 5I83A 5DW2A 4N4FA 5BT5A 5FB0A 4QYLA 4Z93A 5EPRA 2OUOA 5AD2A 5C85A 2OO1A 5KHMA 5DFCA 4NYWA 5CP5A 5HJCA 5I40A 4O70A 4ZC9A 4LRGA 4UYGA 5K29A 4HBVA 4LZ2A 4IORA 4UIUA 4IR5A 4A9KA 5HRWA 3U5KA 4HBYA 2RI7A 5IGMA 5FFVA 4CLBA 3MUKA 5FH7A 4TQNA 2RFJA 3O33A 5LVQA 3MULA 5EQ1A 4QUTA 4QY4A 5CPEA 3AADA 4O7EA 5LJ2A 4TT2A 4MR3A 1ZS5A 5FH6A 4NR4A 4MENA 4Q0OA 5CY9A 1JSPB 3UV2A 5A5RA 1JM4B 4QEUA 4O78A 4LYSA 4UIVA 5FE7A 5D3SA 3JVKA 5DFBA 4YK0A 2YYNA 5II2A 5CQ3A 4CUUA 3P1EA 5EWCA 4QUUA 5D25A 4XYAA 3UVWA 5EPSA 5CQ6A 4MR5A 2RNXA 3S92A 4HXKA 2E7NA 2N9GA 3UV5A 5HLSA 5EM3A 4A9FA 5IGLA 4UIYA 5ENJA 5I7XA 4O72A 5FE6A 5H1UA 5FE3A 5A82A 4WHUA 5F3AA 4YYIA 3RCWA 5FE0A 4HXMA 3UVYA 5A83A 5C7NA 3JVJA 5FG5A 5CUEA 2R0SA 5H85A 4AKNA 4QEWA 4CUSA 4Z1SA 4QSXA 4NYVA 2I8NA 2YW5A 3G0LA 4BJXA 5D3HA 2DWWA 5CQ8A 5G4SA 5IIDA 4LC2A 4QSUA 5DYUA 4OGIA 5EICA 2RS9B 4QSTA 4QSQA 4O75A 4WIVA 1WUMA 5II1A 3MQMA 4UYFB 4BW2A 5CUGA 4MEPA 4DONA 5DX4A 5LKZA 5DFDA 5HQ7A 4QNSA 4YYJA 4J3IA 5IG6A 3MB3A 5E9LA 2FSAA 4MR4A 5DKDA 5C4QA 3GG3A 5HFRA 4YC9A 4HXNA 3U5OA 4QB3A 5I89A 5DBMA 4O71A 4A9HA 2YELA 4BW4A 5CQ5A 4YH3A 2NXBA 5ETDA 5JI8A 4J0RA 5ENBA 5EWVA 4Y03A 5FE8A 5BT3A 5CTLA 2RO1A 2GRCA 5A7CA 5E9VA 5IBNA 5CUBA 5ENIA 5EK9A 3NXBA 4HXSA 2YEMA 4N3WA 4LR6A 4QR4A 5E74A 5DLZA 4YBMA 5CRZA 4GPJA 5CUDA 3DWYA 5DYXA 4IOQA 5LKUA 5F62A 3D7CA 2DKWA 5DKCA 3I3JA 5FG4A 5I29A 2OSSA 3LJWA 3HMEA 5A81A 5F1HA 5I7YA 4OGJA 3MB4A 5AD3A 3O34A 5I80A 5D3LA 5ENFA 5DYAA 3UW9A 5EI4A 4TU6A 4LZSA 4NQMA 5HM0A 5LVRA 5A5SA 5J0DA 5FG6A 2RNYA 4UIWA 5D3JA 5ACYA 2L84A 4QEVA 2D9EA 2H60A 5HEMA 4YYGA 5E3DA 4WHWA 5EWHA 2DVVA 4F3IA 3P1FA 5KTUA 4UYEA 3FKMX 4A9IA 2YEKA 4YH4A 5KU3A 4XY8A 3LXJA 5FFWA 4CUTA 4CURA 5C87A 5I88A 5LUUA 5F60A 5JWMA 5D3TA 5EA1A 4LZRA 4HXLA 3P1CA 2DVSA 5I1QA 4A9JA 4TT6A 3TLPA 4NS5A 4QC1A 5L96A 2E3KA 2MJVB 5FH8A 4HBWA 3QZVA 2RNWA 5L97A 3UV4A 5CFWA 5FFYA 2WP1A 5KO4A 3HMFA 3O36A 4NRAA 5KTWA 1EQFA 3DAIA 3LQHA 4O76A 4A9EA 4ALHA 4OUFA 4QR5A 5C89A 5ETBA 5DY7A 4UIXA 4O7CA 4E96A 2L5EA 5H1VA 4TZ8A 4CL9A 2G4AA 5E9MA 2L85A 4NQNA 5EU1A 4HXOA 3U5JA 5F5ZA 4XUAA 5D0CA 5FB1A 5CUAA 4BW1A 3LQJA 3Q2EA 5F61A 5ENHA 4PCEA 4TZ2A 5BT4A 3SVGA 4CFLA 3MXFA 5LKTA 3UVXA 5A5OA 2R0VA 5HFQA 4Z6IA 4HXRA 4NRCA 3JVLA 4QSPA 5E3GA 4A9NA 3LQIA 4LDFA 4UYFA 3ZYUA 4IOOA 4TYLA 4YAXA 4IR4A 2F6NA 2YDWA 4Z6HA 4NXJA 1N72A 5L8UA 3K2JA 4YYMA 4NR9A 4ALGA 3U5PA 4YATA 5AMEA 1WUGA 5D24A 5E9KA 5IGKA 4CFKA 4IR3A 5EVAA 5E9IA 5D3NA 5CQ7A 5DW1A 2DVRA 3SVHA 4Q0NA 5FBXA 3ONIA 5HCLA 5D26A 4J1PA 4O7AA 4QSVA 4A9LA 5E9YA 4PKLA 5CQAA 4NR8A 5EISA 4N4HA 4YABA 4QR3A 2R10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQA A;  4PS5 A;  5HQ5 A;  3O35 A;  4O7F A;  4PY6 A;  4NR6 A;  5DKH A;  3QZS A;  5HEN A;  5C8G A;  5LJ0 A;  3P5O A;  2I7K A;  4O74 A;  4CUQ A;  3UVD A;  5FE2 A;  5CGP A;  5EV9 A;  4MEQ A;  3IU6 A;  4UIZ A;  4TT4 A;  3IU5 A;  5ENG A;  4YYH A;  5A5Q A;  5DLX A;  4NR5 A;  5D3P A;  5FE1 A;  5CUC A;  5D7X A;  4ZQL A;  3S91 A;  2DAT A;  4QC3 A;  4A9O A;  5E73 A;  2LSP B;  2D82 A;  5FE4 A;  5EWW A;  4UYD A;  5FDZ A;  4BHW A;  4YYK A;  5F63 A;  4O7B A;  2DVQ A;  5HEL A;  4NR7 A;  1X0J A;  4KCX A;  4NUC A;  5LKX A;  4MR6 A;  4YBT A;  2WP2 A;  5HRV A;  5EGU A;  5COI A;  4N4I A;  2R0Y A;  4ZW1 A;  4QSW A;  4KV4 A;  5L99 A;  5G4R A;  4NUD A;  4YY4 A;  3U5N A;  4NYX A;  4QZS A;  5LJ1 A;  4HBX A;  4TS8 A;  2YQD A;  4QSS A;  5FE5 A;  4N4G A;  3O37 A;  5CU8 A;  5A5P A;  4YY6 A;  2F6J A;  5HRX A;  5CQT A;  4PCI A;  4UIT A;  5E7D A;  3QZT A;  5F36 A;  5CZG A;  5A5N A;  5TB6 A;  4LYI A;  4RVR A;  5F25 A;  5CQ4 A;  4QBM A;  4QSR A;  5ENE A;  4YBS A;  4CUP A;  3P1D A;  5D3R A;  5KTX A;  4XY9 A;  1F68 A;  2E7O A;  5A85 A;  4X2I A;  5ENC A;  2KTB B;  5EPB A;  5EWD A;  4BW3 A;  4Z1Q A;  4PTB A;  4KV1 A;  5I86 A;  4FLP A;  5IGN A;  4HXP A;  5F2P A;  4YAD A;  4MEO A;  3U5M A;  4UYH A;  5F1L A;  3SVF A;  4YYD A;  4TTE A;  5E0R A;  4J0S A;  5HQ6 A;  5L8T A;  4C67 A;  4XUB A;  4LYW A;  4YYN A;  5H1T A;  3U5L A;  5CRM A;  4TU4 A;  5DYC A;  5AMF A;  1E6I A;  4NRB A;  4A9M A;  5CS8 A;  4IR6 A;  5EP7 A;  5TCM A;  3G0J A;  4C66 A;  3JVM A;  3HMH A;  3Q2F A;  4QYD A;  4NUE A;  5FE9 A;  4O77 A;  5L98 A;  5I83 A;  5DW2 A;  4N4F A;  5BT5 A;  5FB0 A;  4QYL A;  4Z93 A;  5EPR A;  2OUO A;  5AD2 A;  5C85 A;  2OO1 A;  5KHM A;  5DFC A;  4NYW A;  5CP5 A;  5HJC A;  5I40 A;  4O70 A;  4ZC9 A;  4LRG A;  4UYG A;  5K29 A;  4HBV A;  4LZ2 A;  4IOR A;  4UIU A;  4IR5 A;  4A9K A;  5HRW A;  3U5K A;  4HBY A;  2RI7 A;  5IGM A;  5FFV A;  4CLB A;  3MUK A;  5FH7 A;  4TQN A;  2RFJ A;  3O33 A;  5LVQ A;  3MUL A;  5EQ1 A;  4QUT A;  4QY4 A;  5CPE A;  3AAD A;  4O7E A;  5LJ2 A;  4TT2 A;  4MR3 A;  1ZS5 A;  5FH6 A;  4NR4 A;  4MEN A;  4Q0O A;  5CY9 A;  1JSP B;  3UV2 A;  5A5R A;  1JM4 B;  4QEU A;  4O78 A;  4LYS A;  4UIV A;  5FE7 A;  5D3S A;  3JVK A;  5DFB A;  4YK0 A;  2YYN A;  5II2 A;  5CQ3 A;  4CUU A;  3P1E A;  5EWC A;  4QUU A;  5D25 A;  4XYA A;  3UVW A;  5EPS A;  5CQ6 A;  4MR5 A;  2RNX A;  3S92 A;  4HXK A;  2E7N A;  2N9G A;  3UV5 A;  5HLS A;  5EM3 A;  4A9F A;  5IGL A;  4UIY A;  5ENJ A;  5I7X A;  4O72 A;  5FE6 A;  5H1U A;  5FE3 A;  5A82 A;  4WHU A;  5F3A A;  4YYI A;  3RCW A;  5FE0 A;  4HXM A;  3UVY A;  5A83 A;  5C7N A;  3JVJ A;  5FG5 A;  5CUE A;  2R0S A;  5H85 A;  4AKN A;  4QEW A;  4CUS A;  4Z1S A;  4QSX A;  4NYV A;  2I8N A;  2YW5 A;  3G0L A;  4BJX A;  5D3H A;  2DWW A;  5CQ8 A;  5G4S A;  5IID A;  4LC2 A;  4QSU A;  5DYU A;  4OGI A;  5EIC A;  2RS9 B;  4QST A;  4QSQ A;  4O75 A;  4WIV A;  1WUM A;  5II1 A;  3MQM A;  4UYF B;  4BW2 A;  5CUG A;  4MEP A;  4DON A;  5DX4 A;  5LKZ A;  5DFD A;  5HQ7 A;  4QNS A;  4YYJ A;  4J3I A;  5IG6 A;  3MB3 A;  5E9L A;  2FSA A;  4MR4 A;  5DKD A;  5C4Q A;  3GG3 A;  5HFR A;  4YC9 A;  4HXN A;  3U5O A;  4QB3 A;  5I89 A;  5DBM A;  4O71 A;  4A9H A;  2YEL A;  4BW4 A;  5CQ5 A;  4YH3 A;  2NXB A;  5ETD A;  5JI8 A;  4J0R A;  5ENB A;  5EWV A;  4Y03 A;  5FE8 A;  5BT3 A;  5CTL A;  2RO1 A;  2GRC A;  5A7C A;  5E9V A;  5IBN A;  5CUB A;  5ENI A;  5EK9 A;  3NXB A;  4HXS A;  2YEM A;  4N3W A;  4LR6 A;  4QR4 A;  5E74 A;  5DLZ A;  4YBM A;  5CRZ A;  4GPJ A;  5CUD A;  3DWY A;  5DYX A;  4IOQ A;  5LKU A;  5F62 A;  3D7C A;  2DKW A;  5DKC A;  3I3J A;  5FG4 A;  5I29 A;  2OSS A;  3LJW A;  3HME A;  5A81 A;  5F1H A;  5I7Y A;  4OGJ A;  3MB4 A;  5AD3 A;  3O34 A;  5I80 A;  5D3L A;  5ENF A;  5DYA A;  3UW9 A;  5EI4 A;  4TU6 A;  4LZS A;  4NQM A;  5HM0 A;  5LVR A;  5A5S A;  5J0D A;  5FG6 A;  2RNY A;  4UIW A;  5D3J A;  5ACY A;  2L84 A;  4QEV A;  2D9E A;  2H60 A;  5HEM A;  4YYG A;  5E3D A;  4WHW A;  5EWH A;  2DVV A;  4F3I A;  3P1F A;  5KTU A;  4UYE A;  3FKM X;  4A9I A;  2YEK A;  4YH4 A;  5KU3 A;  4XY8 A;  3LXJ A;  5FFW A;  4CUT A;  4CUR A;  5C87 A;  5I88 A;  5LUU A;  5F60 A;  5JWM A;  5D3T A;  5EA1 A;  4LZR A;  4HXL A;  3P1C A;  2DVS A;  5I1Q A;  4A9J A;  4TT6 A;  3TLP A;  4NS5 A;  4QC1 A;  5L96 A;  2E3K A;  2MJV B;  5FH8 A;  4HBW A;  3QZV A;  2RNW A;  5L97 A;  3UV4 A;  5CFW A;  5FFY A;  2WP1 A;  5KO4 A;  3HMF A;  3O36 A;  4NRA A;  5KTW A;  1EQF A;  3DAI A;  3LQH A;  4O76 A;  4A9E A;  4ALH A;  4OUF A;  4QR5 A;  5C89 A;  5ETB A;  5DY7 A;  4UIX A;  4O7C A;  4E96 A;  2L5E A;  5H1V A;  4TZ8 A;  4CL9 A;  2G4A A;  5E9M A;  2L85 A;  4NQN A;  5EU1 A;  4HXO A;  3U5J A;  5F5Z A;  4XUA A;  5D0C A;  5FB1 A;  5CUA A;  4BW1 A;  3LQJ A;  3Q2E A;  5F61 A;  5ENH A;  4PCE A;  4TZ2 A;  5BT4 A;  3SVG A;  4CFL A;  3MXF A;  5LKT A;  3UVX A;  5A5O A;  2R0V A;  5HFQ A;  4Z6I A;  4HXR A;  4NRC A;  3JVL A;  4QSP A;  5E3G A;  4A9N A;  3LQI A;  4LDF A;  4UYF A;  3ZYU A;  4IOO A;  4TYL A;  4YAX A;  4IR4 A;  2F6N A;  2YDW A;  4Z6H A;  4NXJ A;  1N72 A;  5L8U A;  3K2J A;  4YYM A;  4NR9 A;  4ALG A;  3U5P A;  4YAT A;  5AME A;  1WUG A;  5D24 A;  5E9K A;  5IGK A;  4CFK A;  4IR3 A;  5EVA A;  5E9I A;  5D3N A;  5CQ7 A;  5DW1 A;  2DVR A;  3SVH A;  4Q0N A;  5FBX A;  3ONI A;  5HCL A;  5D26 A;  4J1P A;  4O7A A;  4QSV A;  4A9L A;  5E9Y A;  4PKL A;  5CQA A;  4NR8 A;  5EIS A;  4N4H A;  4YAB A;  4QR3 A;  2R10 A; 
#chains in the Genus database with same CATH topology
 3AQA A;  4PS5 A;  5HQ5 A;  3O35 A;  4O7F A;  4PY6 A;  4NR6 A;  5DKH A;  3QZS A;  5HEN A;  5C8G A;  5LJ0 A;  3P5O A;  2I7K A;  4O74 A;  4CUQ A;  3UVD A;  5FE2 A;  5CGP A;  5EV9 A;  4MEQ A;  3IU6 A;  4UIZ A;  4TT4 A;  3IU5 A;  5ENG A;  4YYH A;  5A5Q A;  5DLX A;  4NR5 A;  5D3P A;  5FE1 A;  5CUC A;  5D7X A;  4ZQL A;  3S91 A;  2DAT A;  4QC3 A;  4A9O A;  5E73 A;  2LSP B;  2D82 A;  5FE4 A;  5EWW A;  4UYD A;  5FDZ A;  4BHW A;  4YYK A;  5F63 A;  4O7B A;  2DVQ A;  5HEL A;  4NR7 A;  1X0J A;  4KCX A;  4NUC A;  5LKX A;  4MR6 A;  4YBT A;  2WP2 A;  5HRV A;  5EGU A;  5COI A;  4N4I A;  2R0Y A;  4ZW1 A;  4QSW A;  4KV4 A;  5L99 A;  5G4R A;  4NUD A;  4YY4 A;  3U5N A;  4NYX A;  4QZS A;  5LJ1 A;  4HBX A;  4TS8 A;  2YQD A;  4QSS A;  5FE5 A;  4N4G A;  3O37 A;  5CU8 A;  5A5P A;  4YY6 A;  2F6J A;  5HRX A;  5CQT A;  4PCI A;  4UIT A;  5E7D A;  3QZT A;  5F36 A;  3VKH A;  5CZG A;  5A5N A;  5TB6 A;  4LYI A;  4RVR A;  5F25 A;  5CQ4 A;  4QBM A;  4QSR A;  5ENE A;  4AI6 A;  4YBS A;  4CUP A;  3P1D A;  5D3R A;  5KTX A;  4XY9 A;  1F68 A;  2E7O A;  3D1B A;  5A85 A;  4X2I A;  5ENC A;  2KTB B;  5EPB A;  5EWD A;  4BW3 A;  4Z1Q A;  4PTB A;  4KV1 A;  5I86 A;  4FLP A;  5IGN A;  4HXP A;  5F2P A;  4YAD A;  4MEO A;  3U5M A;  4UYH A;  5F1L A;  3SVF A;  4YYD A;  4TTE A;  5E0R A;  4J0S A;  5HQ6 A;  5L8T A;  4C67 A;  4XUB A;  4LYW A;  4YYN A;  5H1T A;  3U5L A;  5CRM A;  4TU4 A;  5DYC A;  5AMF A;  1E6I A;  4NRB A;  4A9M A;  5CS8 A;  4IR6 A;  4AKG A;  5EP7 A;  5TCM A;  3G0J A;  4C66 A;  3JVM A;  3HMH A;  3Q2F A;  4QYD A;  4NUE A;  5FE9 A;  4AKH A;  4O77 A;  5L98 A;  5I83 A;  5DW2 A;  4N4F A;  5BT5 A;  5FB0 A;  4QYL A;  4Z93 A;  5EPR A;  2OUO A;  5AD2 A;  5C85 A;  2OO1 A;  5KHM A;  5DFC A;  4NYW A;  5CP5 A;  5HJC A;  5I40 A;  4O70 A;  4ZC9 A;  4LRG A;  4UYG A;  5K29 A;  4HBV A;  4LZ2 A;  4IOR A;  4UIU A;  4IR5 A;  4A9K A;  5HRW A;  3U5K A;  4HBY A;  2RI7 A;  5IGM A;  5FFV A;  4CLB A;  3MUK A;  5FH7 A;  4TQN A;  2RFJ A;  3O33 A;  5LVQ A;  3MUL A;  5EQ1 A;  1ZKR A;  4QUT A;  4QY4 A;  5CPE A;  3AAD A;  4O7E A;  5LJ2 A;  4TT2 A;  4MR3 A;  1ZS5 A;  5FH6 A;  4NR4 A;  4MEN A;  4Q0O A;  5CY9 A;  1JSP B;  3UV2 A;  5A5R A;  1JM4 B;  4QEU A;  4O78 A;  4LYS A;  4UIV A;  5FE7 A;  5D3S A;  3JVK A;  5DFB A;  4YK0 A;  2YYN A;  5II2 A;  5CQ3 A;  4CUU A;  3P1E A;  5EWC A;  4QUU A;  5D25 A;  4XYA A;  3UVW A;  5EPS A;  5CQ6 A;  4MR5 A;  2RNX A;  3S92 A;  4HXK A;  2E7N A;  2N9G A;  3UV5 A;  5HLS A;  5EM3 A;  4A9F A;  5IGL A;  4UIY A;  5ENJ A;  5I7X A;  4O72 A;  5FE6 A;  5H1U A;  5FE3 A;  5A82 A;  4WHU A;  5F3A A;  4YYI A;  3RCW A;  5FE0 A;  4HXM A;  3UVY A;  5A83 A;  5C7N A;  3JVJ A;  5FG5 A;  5CUE A;  2R0S A;  5H85 A;  4AKN A;  4QEW A;  4CUS A;  4Z1S A;  4QSX A;  4NYV A;  2I8N A;  2YW5 A;  3G0L A;  4BJX A;  5D3H A;  2DWW A;  5CQ8 A;  5G4S A;  5IID A;  4LC2 A;  4QSU A;  5DYU A;  4OGI A;  5EIC A;  2RS9 B;  4QST A;  4QSQ A;  4O75 A;  4WIV A;  1WUM A;  5II1 A;  3MQM A;  4UYF B;  4BW2 A;  5CUG A;  4MEP A;  4DON A;  5DX4 A;  5LKZ A;  5DFD A;  5HQ7 A;  4QNS A;  4YYJ A;  4J3I A;  5IG6 A;  3MB3 A;  5E9L A;  2FSA A;  4MR4 A;  5DKD A;  5C4Q A;  3GG3 A;  5HFR A;  4YC9 A;  4HXN A;  3U5O A;  4QB3 A;  3ERR A;  5I89 A;  5DBM A;  4O71 A;  4A9H A;  2YEL A;  4BW4 A;  5CQ5 A;  4YH3 A;  2NXB A;  5ETD A;  5JI8 A;  4J0R A;  5ENB A;  5EWV A;  4Y03 A;  5FE8 A;  5BT3 A;  5CTL A;  2RO1 A;  2GRC A;  5A7C A;  5E9V A;  5IBN A;  5CUB A;  5ENI A;  5EK9 A;  3NXB A;  4HXS A;  2YEM A;  4N3W A;  4LR6 A;  4QR4 A;  5E74 A;  5DLZ A;  4YBM A;  5CRZ A;  4GPJ A;  5CUD A;  3DWY A;  5DYX A;  4IOQ A;  3D1D A;  5LKU A;  5F62 A;  3D7C A;  2DKW A;  5DKC A;  3I3J A;  5FG4 A;  5I29 A;  2OSS A;  3LJW A;  3HME A;  5A81 A;  4AKI A;  5F1H A;  5I7Y A;  4OGJ A;  3MB4 A;  5AD3 A;  3O34 A;  5I80 A;  5D3L A;  5ENF A;  5DYA A;  3UW9 A;  5EI4 A;  4TU6 A;  4LZS A;  4NQM A;  5HM0 A;  5LVR A;  5A5S A;  5J0D A;  5FG6 A;  2RNY A;  4UIW A;  5D3J A;  5ACY A;  2L84 A;  4QEV A;  2D9E A;  2H60 A;  5HEM A;  4YYG A;  5E3D A;  4WHW A;  5EWH A;  2DVV A;  4F3I A;  3P1F A;  5KTU A;  4UYE A;  3FKM X;  4A9I A;  2YEK A;  4YH4 A;  5KU3 A;  4XY8 A;  3LXJ A;  5FFW A;  4CUT A;  4CUR A;  5C87 A;  5I88 A;  5LUU A;  5F60 A;  5JWM A;  5D3T A;  5EA1 A;  4LZR A;  4HXL A;  3P1C A;  2DVS A;  5I1Q A;  4A9J A;  4TT6 A;  3TLP A;  4NS5 A;  4QC1 A;  5L96 A;  2E3K A;  2MJV B;  5FH8 A;  4HBW A;  3QZV A;  2RNW A;  5L97 A;  3UV4 A;  5CFW A;  5FFY A;  2WP1 A;  5KO4 A;  3HMF A;  3O36 A;  4NRA A;  5KTW A;  1EQF A;  3DAI A;  3LQH A;  4O76 A;  4A9E A;  4ALH A;  4OUF A;  4QR5 A;  5C89 A;  5ETB A;  5DY7 A;  2EJN A;  4UIX A;  4O7C A;  4E96 A;  2L5E A;  5H1V A;  4TZ8 A;  4CL9 A;  2G4A A;  5E9M A;  2L85 A;  4NQN A;  5EU1 A;  4HXO A;  3U5J A;  5F5Z A;  4XUA A;  5D0C A;  5FB1 A;  5CUA A;  4BW1 A;  3LQJ A;  3Q2E A;  5F61 A;  5ENH A;  4PCE A;  4TZ2 A;  5BT4 A;  3SVG A;  4CFL A;  3MXF A;  5LKT A;  3UVX A;  5A5O A;  2R0V A;  5HFQ A;  4Z6I A;  4HXR A;  4NRC A;  3JVL A;  4QSP A;  5E3G A;  4A9N A;  3LQI A;  4LDF A;  4UYF A;  3ZYU A;  4IOO A;  4TYL A;  4YAX A;  1PUO A;  4IR4 A;  2F6N A;  2YDW A;  4Z6H A;  4NXJ A;  1N72 A;  5L8U A;  3K2J A;  4YYM A;  4NR9 A;  4ALG A;  3VKG A;  3U5P A;  4YAT A;  5AME A;  1WUG A;  5D24 A;  5E9K A;  5IGK A;  4CFK A;  4IR3 A;  5EVA A;  5E9I A;  5D3N A;  5CQ7 A;  5DW1 A;  2DVR A;  3SVH A;  4Q0N A;  5FBX A;  3ONI A;  5HCL A;  5D26 A;  4J1P A;  4O7A A;  4QSV A;  4A9L A;  5E9Y A;  4PKL A;  5CQA A;  4NR8 A;  5EIS A;  4N4H A;  4YAB A;  4QR3 A;  2R10 A; 
#chains in the Genus database with same CATH homology
 3AQA A;  4PS5 A;  5HQ5 A;  3O35 A;  4O7F A;  4PY6 A;  4NR6 A;  5DKH A;  3QZS A;  5HEN A;  5C8G A;  5LJ0 A;  3P5O A;  2I7K A;  4O74 A;  4CUQ A;  3UVD A;  5FE2 A;  5CGP A;  5EV9 A;  4MEQ A;  3IU6 A;  4UIZ A;  4TT4 A;  3IU5 A;  5ENG A;  4YYH A;  5A5Q A;  5DLX A;  4NR5 A;  5D3P A;  5FE1 A;  5CUC A;  5D7X A;  4ZQL A;  3S91 A;  2DAT A;  4QC3 A;  4A9O A;  5E73 A;  2LSP B;  2D82 A;  5FE4 A;  5EWW A;  4UYD A;  5FDZ A;  4BHW A;  4YYK A;  5F63 A;  4O7B A;  2DVQ A;  5HEL A;  4NR7 A;  1X0J A;  4KCX A;  4NUC A;  5LKX A;  4MR6 A;  4YBT A;  2WP2 A;  5HRV A;  5EGU A;  5COI A;  4N4I A;  2R0Y A;  4ZW1 A;  4QSW A;  4KV4 A;  5L99 A;  5G4R A;  4NUD A;  4YY4 A;  3U5N A;  4NYX A;  4QZS A;  5LJ1 A;  4HBX A;  4TS8 A;  2YQD A;  4QSS A;  5FE5 A;  4N4G A;  3O37 A;  5CU8 A;  5A5P A;  4YY6 A;  2F6J A;  5HRX A;  5CQT A;  4PCI A;  4UIT A;  5E7D A;  3QZT A;  5F36 A;  5CZG A;  5A5N A;  5TB6 A;  4LYI A;  4RVR A;  5F25 A;  5CQ4 A;  4QBM A;  4QSR A;  5ENE A;  4YBS A;  4CUP A;  3P1D A;  5D3R A;  5KTX A;  4XY9 A;  1F68 A;  2E7O A;  5A85 A;  4X2I A;  5ENC A;  2KTB B;  5EPB A;  5EWD A;  4BW3 A;  4Z1Q A;  4PTB A;  4KV1 A;  5I86 A;  4FLP A;  5IGN A;  4HXP A;  5F2P A;  4YAD A;  4MEO A;  3U5M A;  4UYH A;  5F1L A;  3SVF A;  4YYD A;  4TTE A;  5E0R A;  4J0S A;  5HQ6 A;  5L8T A;  4C67 A;  4XUB A;  4LYW A;  4YYN A;  5H1T A;  3U5L A;  5CRM A;  4TU4 A;  5DYC A;  5AMF A;  1E6I A;  4NRB A;  4A9M A;  5CS8 A;  4IR6 A;  5EP7 A;  5TCM A;  3G0J A;  4C66 A;  3JVM A;  3HMH A;  3Q2F A;  4QYD A;  4NUE A;  5FE9 A;  4O77 A;  5L98 A;  5I83 A;  5DW2 A;  4N4F A;  5BT5 A;  5FB0 A;  4QYL A;  4Z93 A;  5EPR A;  2OUO A;  5AD2 A;  5C85 A;  2OO1 A;  5KHM A;  5DFC A;  4NYW A;  5CP5 A;  5HJC A;  5I40 A;  4O70 A;  4ZC9 A;  4LRG A;  4UYG A;  5K29 A;  4HBV A;  4LZ2 A;  4IOR A;  4UIU A;  4IR5 A;  4A9K A;  5HRW A;  3U5K A;  4HBY A;  2RI7 A;  5IGM A;  5FFV A;  4CLB A;  3MUK A;  5FH7 A;  4TQN A;  2RFJ A;  3O33 A;  5LVQ A;  3MUL A;  5EQ1 A;  4QUT A;  4QY4 A;  5CPE A;  3AAD A;  4O7E A;  5LJ2 A;  4TT2 A;  4MR3 A;  1ZS5 A;  5FH6 A;  4NR4 A;  4MEN A;  4Q0O A;  5CY9 A;  1JSP B;  3UV2 A;  5A5R A;  1JM4 B;  4QEU A;  4O78 A;  4LYS A;  4UIV A;  5FE7 A;  5D3S A;  3JVK A;  5DFB A;  4YK0 A;  2YYN A;  5II2 A;  5CQ3 A;  4CUU A;  3P1E A;  5EWC A;  4QUU A;  5D25 A;  4XYA A;  3UVW A;  5EPS A;  5CQ6 A;  4MR5 A;  2RNX A;  3S92 A;  4HXK A;  2E7N A;  2N9G A;  3UV5 A;  5HLS A;  5EM3 A;  4A9F A;  5IGL A;  4UIY A;  5ENJ A;  5I7X A;  4O72 A;  5FE6 A;  5H1U A;  5FE3 A;  5A82 A;  4WHU A;  5F3A A;  4YYI A;  3RCW A;  5FE0 A;  4HXM A;  3UVY A;  5A83 A;  5C7N A;  3JVJ A;  5FG5 A;  5CUE A;  2R0S A;  5H85 A;  4AKN A;  4QEW A;  4CUS A;  4Z1S A;  4QSX A;  4NYV A;  2I8N A;  2YW5 A;  3G0L A;  4BJX A;  5D3H A;  2DWW A;  5CQ8 A;  5G4S A;  5IID A;  4LC2 A;  4QSU A;  5DYU A;  4OGI A;  5EIC A;  2RS9 B;  4QST A;  4QSQ A;  4O75 A;  4WIV A;  1WUM A;  5II1 A;  3MQM A;  4UYF B;  4BW2 A;  5CUG A;  4MEP A;  4DON A;  5DX4 A;  5LKZ A;  5DFD A;  5HQ7 A;  4QNS A;  4YYJ A;  4J3I A;  5IG6 A;  3MB3 A;  5E9L A;  2FSA A;  4MR4 A;  5DKD A;  5C4Q A;  3GG3 A;  5HFR A;  4YC9 A;  4HXN A;  3U5O A;  4QB3 A;  5I89 A;  5DBM A;  4O71 A;  4A9H A;  2YEL A;  4BW4 A;  5CQ5 A;  4YH3 A;  2NXB A;  5ETD A;  5JI8 A;  4J0R A;  5ENB A;  5EWV A;  4Y03 A;  5FE8 A;  5BT3 A;  5CTL A;  2RO1 A;  2GRC A;  5A7C A;  5E9V A;  5IBN A;  5CUB A;  5ENI A;  5EK9 A;  3NXB A;  4HXS A;  2YEM A;  4N3W A;  4LR6 A;  4QR4 A;  5E74 A;  5DLZ A;  4YBM A;  5CRZ A;  4GPJ A;  5CUD A;  3DWY A;  5DYX A;  4IOQ A;  5LKU A;  5F62 A;  3D7C A;  2DKW A;  5DKC A;  3I3J A;  5FG4 A;  5I29 A;  2OSS A;  3LJW A;  3HME A;  5A81 A;  5F1H A;  5I7Y A;  4OGJ A;  3MB4 A;  5AD3 A;  3O34 A;  5I80 A;  5D3L A;  5ENF A;  5DYA A;  3UW9 A;  5EI4 A;  4TU6 A;  4LZS A;  4NQM A;  5HM0 A;  5LVR A;  5A5S A;  5J0D A;  5FG6 A;  2RNY A;  4UIW A;  5D3J A;  5ACY A;  2L84 A;  4QEV A;  2D9E A;  2H60 A;  5HEM A;  4YYG A;  5E3D A;  4WHW A;  5EWH A;  2DVV A;  4F3I A;  3P1F A;  5KTU A;  4UYE A;  3FKM X;  4A9I A;  2YEK A;  4YH4 A;  5KU3 A;  4XY8 A;  3LXJ A;  5FFW A;  4CUT A;  4CUR A;  5C87 A;  5I88 A;  5LUU A;  5F60 A;  5JWM A;  5D3T A;  5EA1 A;  4LZR A;  4HXL A;  3P1C A;  2DVS A;  5I1Q A;  4A9J A;  4TT6 A;  3TLP A;  4NS5 A;  4QC1 A;  5L96 A;  2E3K A;  2MJV B;  5FH8 A;  4HBW A;  3QZV A;  2RNW A;  5L97 A;  3UV4 A;  5CFW A;  5FFY A;  2WP1 A;  5KO4 A;  3HMF A;  3O36 A;  4NRA A;  5KTW A;  1EQF A;  3DAI A;  3LQH A;  4O76 A;  4A9E A;  4ALH A;  4OUF A;  4QR5 A;  5C89 A;  5ETB A;  5DY7 A;  4UIX A;  4O7C A;  4E96 A;  2L5E A;  5H1V A;  4TZ8 A;  4CL9 A;  2G4A A;  5E9M A;  2L85 A;  4NQN A;  5EU1 A;  4HXO A;  3U5J A;  5F5Z A;  4XUA A;  5D0C A;  5FB1 A;  5CUA A;  4BW1 A;  3LQJ A;  3Q2E A;  5F61 A;  5ENH A;  4PCE A;  4TZ2 A;  5BT4 A;  3SVG A;  4CFL A;  3MXF A;  5LKT A;  3UVX A;  5A5O A;  2R0V A;  5HFQ A;  4Z6I A;  4HXR A;  4NRC A;  3JVL A;  4QSP A;  5E3G A;  4A9N A;  3LQI A;  4LDF A;  4UYF A;  3ZYU A;  4IOO A;  4TYL A;  4YAX A;  4IR4 A;  2F6N A;  2YDW A;  4Z6H A;  4NXJ A;  1N72 A;  5L8U A;  3K2J A;  4YYM A;  4NR9 A;  4ALG A;  3U5P A;  4YAT A;  5AME A;  1WUG A;  5D24 A;  5E9K A;  5IGK A;  4CFK A;  4IR3 A;  5EVA A;  5E9I A;  5D3N A;  5CQ7 A;  5DW1 A;  2DVR A;  3SVH A;  4Q0N A;  5FBX A;  3ONI A;  5HCL A;  5D26 A;  4J1P A;  4O7A A;  4QSV A;  4A9L A;  5E9Y A;  4PKL A;  5CQA A;  4NR8 A;  5EIS A;  4N4H A;  4YAB A;  4QR3 A;  2R10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...