5FE7A

Crystal structure of human pcaf bromodomain in complex with fragment zb2216 (fragment 11)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
109
structure length
109
Chain Sequence
RDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Histone acetyltransferase KAT2B
publication title Structure-Based Identification of Inhibitory Fragments Targeting the p300/CBP-Associated Factor Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fe7A00
5EWVA 4UYGA 2D82A 4YY6A 4NR9A 4NR4A 5FH8A 5L96A 3TLPA 3QZVA 5HRWA 4TZ2A 5EPBA 4YYJA 4NR7A 5FH6A 5HQ6A 3JVLA 4PTBA 4J1PA 5DFDA 2H60A 4PCEA 5LVQA 4DONA 5A81A 2YYNA 5CS8A 5D7XA 5TCMA 4BW3A 2DVQA 4Z6IA 5C7NA 4HBVA 2KTBB 5FG6A 3LXJA 5ENIA 5EM3A 2OO1A 5KTUA 4ZW1A 3O37A 5E9LA 5D3LA 4A9HA 4A9IA 5CRMA 5E9MA 4NYVA 2WP1A 3AADA 5EWCA 4QBMA 5F36A 5BT3A 4F3IA 4HXRA 5EA1A 4XUAA 3NXBA 4KCXA 4QSUA 4WIVA 4YABA 5A5OA 4O77A 5C4QA 5CUEA 2RNXA 2YEMA 2GRCA 2FSAA 4IOQA 4OGJA 4YYIA 3LJWA 4QB3A 5I40A 4YYHA 5I80A 5EU1A 4NR5A 3O36A 4CURA 2F6NA 3HMFA 5LKXA 5D0CA 2MJVB 4Z1QA 4NUCA 5FE4A 4CUQA 4O76A 4HBWA 5AMEA 5FE0A 3U5PA 5D3NA 5LKZA 3MB3A 5DKHA 5D3PA 5CPEA 4BJXA 4HBXA 4YBMA 4CUSA 3RCWA 5EK9A 5FDZA 4CLBA 2DVVA 5F25A 4LR6A 3HMHA 5E9IA 4YYGA 5D3HA 5L97A 5H1VA 4J0SA 4MR6A 4ALGA 3U5OA 3QZTA 4IORA 4QYLA 4YADA 5EPSA 5A5NA 4CL9A 5I29A 5DW2A 4BHWA 4QSWA 3UW9A 5FE1A 5FE7A 5CQ6A 5DFCA 4N4HA 5A85A 5IIDA 3FKMX 5CUGA 3U5NA 5F5ZA 5CFWA 5CRZA 3U5JA 5AD2A 3UV4A 2RO1A 5F1HA 4NUEA 5LKTA 4UYFB 4O7EA 5EI4A 5D3SA 4MR5A 5H1TA 5F1LA 3GG3A 5FFVA 5DLXA 3MQMA 1JM4B 5ENEA 4NR8A 5F63A 5C89A 5HELA 2DATA 4TZ8A 5A5SA 2E7OA 4O74A 4YYNA 5DW1A 5ENHA 5E9VA 5CQ8A 4IR3A 4QUTA 5E74A 4UIUA 4YBSA 3O35A 3O34A 5CQTA 4ZQLA 3G0JA 5CZGA 4PKLA 4MR4A 3P1CA 2RNYA 3D7CA 4QEVA 4O72A 4WHWA 3HMEA 4CFLA 5L8TA 4HXLA 4QR5A 4XY8A 3SVGA 3S92A 2R0SA 4HXKA 5FB1A 5HEMA 3P1EA 3UVXA 5JWMA 5CU8A 2RS9B 4A9MA 4QSXA 5I7YA 5JI8A 2OSSA 3P1DA 4KV4A 4YBTA 5FE8A 5F2PA 2DVSA 5C87A 4IOOA 4LZSA 5E7DA 4XYAA 3S91A 4QUUA 5KO4A 4O7AA 5CTLA 5ETDA 5H1UA 4UIWA 5IGNA 3DWYA 3MULA 4BW2A 5IGLA 4HXPA 4YYKA 4IR6A 5DKDA 3K2JA 5HFQA 4QR4A 4J3IA 5IG6A 4O71A 4WHUA 1WUMA 5II1A 4YAXA 4IR5A 5HFRA 5BT5A 4UYFA 4MEOA 5D3JA 5DKCA 3UV5A 5FE2A 5HRXA 1ZS5A 5CQ3A 5FE5A 3JVKA 4O75A 5IBNA 3MXFA 5E9KA 5HQ5A 2RNWA 3UV2A 5EWHA 4N4FA 4TT2A 5I1QA 5I83A 2F6JA 4O7BA 4O7CA 1EQFA 4IR4A 3LQJA 5F3AA 5ENGA 4UYHA 4QNSA 2DKWA 5D24A 5EQ1A 2RFJA 4QR3A 5KTWA 2WP2A 5DY7A 3ZYUA 3G0LA 5KTXA 4HXNA 4TTEA 4CUTA 5CUCA 5FG4A 3AQAA 4O7FA 4OUFA 5G4RA 5K29A 3ONIA 5ETBA 3QZSA 2R0VA 5KHMA 4MEQA 4NRAA 4QSRA 2NXBA 5HCLA 5CGPA 5D26A 4TU4A 4YY4A 4QEUA 4UYEA 4O78A 5A5RA 5LUUA 5E3DA 5F62A 4XY9A 4UIVA 5CUAA 2YW5A 2YELA 4YYMA 2D9EA 5DLZA 4UIXA 5E73A 5I86A 5LJ0A 5ENBA 5ENJA 3UVDA 4LZRA 5I89A 5CQ5A 2RI7A 5A7CA 4Z6HA 5G4SA 5A82A 5EVAA 3UVWA 4LC2A 5EV9A 5DYAA 4XUBA 3SVFA 5EICA 2N9GA 4QSTA 4TT6A 5A5QA 5FFWA 5FE9A 4UIYA 5I88A 5L8UA 4TQNA 5HQ7A 4NR6A 4TYLA 4LZ2A 4LRGA 2LSPB 5FE3A 4UYDA 5COIA 4FLPA 4LYSA 5II2A 4Z1SA 5L99A 3U5KA 4PS5A 4A9EA 5A83A 5KU3A 4NQNA 5EWDA 4NUDA 3U5LA 2DWWA 4QYDA 4BW4A 5HJCA 4TS8A 1WUGA 4NS5A 4Q0NA 4Y03A 4N4GA 4TU6A 3MUKA 2R0YA 5EPRA 4A9NA 5EWWA 5LVRA 2L85A 5CQ7A 5ENCA 4NRBA 4PCIA 5D3RA 4QZSA 4ALHA 5AD3A 4YH3A 4KV1A 4MR3A 4A9LA 4NXJA 4HXSA 4OGIA 4Q0OA 5F60A 4LYIA 3O33A 4QSVA 4QSQA 4PY6A 3Q2EA 3IU5A 4AKNA 4C67A 3DAIA 1F68A 4MENA 5E0RA 4QSSA 2L84A 5F61A 3IU6A 3P5OA 4O70A 5DBMA 5CQAA 4HXOA 5BT4A 2YDWA 5EP7A 3I3JA 4C66A 4YC9A 2YEKA 5TB6A 4GPJA 1E6IA 4YK0A 3MB4A 4CUUA 5IGKA 5CY9A 4BW1A 4NYXA 5DYUA 3JVMA 3Q2FA 4TT4A 5L98A 4A9FA 5CUDA 4RVRA 5A5PA 4MEPA 4N4IA 5FE6A 5H85A 5ACYA 4X2IA 5EISA 4ZC9A 5FFYA 3UVYA 5CUBA 4N3WA 2E3KA 4QY4A 5D3TA 5LJ2A 5FBXA 5HM0A 1JSPB 2I7KA 5I7XA 2E7NA 5HENA 3LQHA 4NYWA 2YQDA 4A9JA 5FG5A 1X0JA 4A9OA 5EGUA 5C85A 5E9YA 5J0DA 4YH4A 2R10A 5HLSA 4QC1A 5E3GA 4UITA 5ENFA 5FB0A 4UIZA 4NRCA 3LQIA 5DX4A 4HXMA 4A9KA 4HBYA 4J0RA 4Z93A 4CFKA 5LJ1A 5LKUA 4LYWA 3SVHA 4QSPA 5HRVA 5DYCA 5D25A 4QEWA 2OUOA 5IGMA 2L5EA 5FH7A 4QC3A 5CQ4A 5AMFA 3P1FA 2G4AA 2DVRA 5DFBA 4NQMA 5DYXA 4YATA 4CUPA 3U5MA 5CP5A 5C8GA 4E96A 1N72A 3JVJA 4LDFA 2I8NA 4YYDA
chains in the Genus database with same CATH superfamily
5EWVA 4UYGA 2D82A 4YY6A 4NR9A 4NR4A 5FH8A 5L96A 3TLPA 3QZVA 5HRWA 4TZ2A 5EPBA 4YYJA 4NR7A 5FH6A 5HQ6A 3JVLA 4PTBA 4J1PA 5DFDA 2H60A 4PCEA 5LVQA 4DONA 5A81A 2YYNA 5CS8A 5D7XA 5TCMA 4BW3A 2DVQA 4Z6IA 5C7NA 4HBVA 2KTBB 5FG6A 3LXJA 5ENIA 5EM3A 2OO1A 5KTUA 4ZW1A 3O37A 5E9LA 5D3LA 4A9HA 4A9IA 5CRMA 5E9MA 4NYVA 2WP1A 3AADA 5EWCA 4QBMA 5F36A 5BT3A 4F3IA 4HXRA 5EA1A 4XUAA 2EJNA 3NXBA 4KCXA 4QSUA 4WIVA 4YABA 5A5OA 4O77A 5C4QA 5CUEA 2RNXA 2YEMA 2GRCA 2FSAA 4IOQA 4OGJA 4YYIA 3LJWA 4QB3A 5I40A 4YYHA 5I80A 5EU1A 4NR5A 3O36A 4CURA 2F6NA 3HMFA 5LKXA 5D0CA 2MJVB 4Z1QA 4NUCA 5FE4A 4CUQA 4O76A 4HBWA 5AMEA 5FE0A 3U5PA 5D3NA 5LKZA 3MB3A 5DKHA 5D3PA 5CPEA 4BJXA 4HBXA 4YBMA 4CUSA 3RCWA 5EK9A 5FDZA 4CLBA 2DVVA 5F25A 4LR6A 3HMHA 5E9IA 4YYGA 5D3HA 5L97A 5H1VA 4J0SA 4MR6A 4ALGA 3U5OA 3QZTA 4IORA 4QYLA 4YADA 5EPSA 5A5NA 4CL9A 5I29A 5DW2A 4BHWA 4QSWA 3UW9A 5FE1A 5FE7A 5CQ6A 5DFCA 3D1BA 4N4HA 5A85A 5IIDA 3FKMX 5CUGA 3U5NA 5F5ZA 5CFWA 5CRZA 3U5JA 5AD2A 3UV4A 2RO1A 5F1HA 4NUEA 5LKTA 4UYFB 4O7EA 5EI4A 5D3SA 4MR5A 5H1TA 5F1LA 3GG3A 5FFVA 5DLXA 3MQMA 1JM4B 5ENEA 4NR8A 5F63A 5C89A 5HELA 2DATA 4TZ8A 5A5SA 2E7OA 4O74A 4YYNA 5DW1A 5ENHA 5E9VA 5CQ8A 4IR3A 4QUTA 5E74A 4UIUA 4YBSA 3O35A 3O34A 5CQTA 4ZQLA 3G0JA 5CZGA 4PKLA 4MR4A 3P1CA 2RNYA 3D7CA 4QEVA 4O72A 4WHWA 3HMEA 4CFLA 5L8TA 1PUOA 4HXLA 4QR5A 3D1DA 4XY8A 3SVGA 3S92A 2R0SA 4HXKA 5FB1A 5HEMA 3P1EA 3UVXA 5JWMA 5CU8A 2RS9B 4A9MA 4QSXA 5I7YA 5JI8A 2OSSA 3P1DA 4KV4A 4YBTA 5FE8A 5F2PA 2DVSA 5C87A 4IOOA 4LZSA 5E7DA 4XYAA 3S91A 4QUUA 5KO4A 4O7AA 5CTLA 5ETDA 5H1UA 4UIWA 5IGNA 3DWYA 3MULA 4BW2A 5IGLA 4HXPA 3VKGA 4YYKA 4IR6A 5DKDA 3K2JA 5HFQA 4QR4A 4J3IA 5IG6A 4O71A 4WHUA 1WUMA 5II1A 4YAXA 4IR5A 5HFRA 5BT5A 4UYFA 4MEOA 5D3JA 5DKCA 3UV5A 5FE2A 5HRXA 1ZS5A 5CQ3A 5FE5A 3JVKA 4O75A 5IBNA 3MXFA 5E9KA 5HQ5A 2RNWA 3UV2A 5EWHA 4N4FA 4TT2A 5I1QA 5I83A 2F6JA 4O7BA 4O7CA 1EQFA 4IR4A 3LQJA 5F3AA 5ENGA 4UYHA 4QNSA 2DKWA 5D24A 5EQ1A 2RFJA 4QR3A 5KTWA 2WP2A 5DY7A 3ZYUA 3G0LA 5KTXA 4HXNA 4TTEA 4CUTA 5CUCA 5FG4A 3AQAA 4O7FA 4OUFA 5G4RA 5K29A 3ONIA 5ETBA 3QZSA 2R0VA 5KHMA 4MEQA 4NRAA 4QSRA 2NXBA 5HCLA 3VKHA 5CGPA 5D26A 4TU4A 4YY4A 4QEUA 4UYEA 4O78A 5A5RA 5LUUA 5E3DA 5F62A 4XY9A 4UIVA 5CUAA 2YW5A 2YELA 4YYMA 2D9EA 5DLZA 4UIXA 5E73A 5I86A 5LJ0A 5ENBA 5ENJA 3UVDA 4LZRA 5I89A 5CQ5A 2RI7A 5A7CA 4Z6HA 5G4SA 5A82A 5EVAA 3UVWA 4LC2A 5EV9A 5DYAA 4XUBA 3SVFA 5EICA 2N9GA 4QSTA 4TT6A 5A5QA 5FFWA 5FE9A 4UIYA 5I88A 5L8UA 4TQNA 5HQ7A 4NR6A 4TYLA 4LZ2A 4LRGA 2LSPB 5FE3A 4UYDA 3ERRA 5COIA 4FLPA 4LYSA 5II2A 4Z1SA 5L99A 3U5KA 4PS5A 4A9EA 5A83A 5KU3A 4NQNA 5EWDA 4NUDA 3U5LA 2DWWA 4QYDA 4BW4A 5HJCA 4TS8A 1WUGA 4NS5A 4Q0NA 4Y03A 4N4GA 4TU6A 3MUKA 2R0YA 5EPRA 4A9NA 5EWWA 5LVRA 2L85A 5CQ7A 5ENCA 4NRBA 4PCIA 5D3RA 4QZSA 4ALHA 5AD3A 4AKHA 4YH3A 4KV1A 4MR3A 4A9LA 4NXJA 4HXSA 4OGIA 4Q0OA 5F60A 4LYIA 3O33A 4QSVA 4QSQA 4PY6A 3Q2EA 3IU5A 4AKNA 4AKGA 4C67A 3DAIA 1F68A 4MENA 5E0RA 4QSSA 2L84A 5F61A 3IU6A 3P5OA 4O70A 5DBMA 5CQAA 4HXOA 5BT4A 2YDWA 5EP7A 3I3JA 4C66A 4YC9A 2YEKA 5TB6A 4GPJA 1E6IA 4YK0A 3MB4A 4CUUA 5IGKA 5CY9A 4BW1A 4NYXA 1ZKRA 5DYUA 3JVMA 3Q2FA 4TT4A 5L98A 4A9FA 5CUDA 4RVRA 5A5PA 4MEPA 4N4IA 5FE6A 5H85A 5ACYA 4X2IA 5EISA 4ZC9A 5FFYA 3UVYA 5CUBA 4N3WA 2E3KA 4QY4A 5D3TA 5LJ2A 5FBXA 5HM0A 1JSPB 2I7KA 5I7XA 2E7NA 5HENA 3LQHA 4NYWA 2YQDA 4A9JA 5FG5A 1X0JA 4A9OA 5EGUA 5C85A 4AKIA 5E9YA 5J0DA 4YH4A 2R10A 5HLSA 4QC1A 5E3GA 4UITA 5ENFA 5FB0A 4UIZA 4NRCA 3LQIA 5DX4A 4HXMA 4A9KA 4HBYA 4J0RA 4Z93A 4CFKA 5LJ1A 5LKUA 4LYWA 3SVHA 4QSPA 4AI6A 5HRVA 5DYCA 5D25A 4QEWA 2OUOA 5IGMA 2L5EA 5FH7A 4QC3A 5CQ4A 5AMFA 3P1FA 2G4AA 2DVRA 5DFBA 4NQMA 5DYXA 4YATA 4CUPA 3U5MA 5CP5A 5C8GA 4E96A 1N72A 3JVJA 4LDFA 2I8NA 4YYDA
chains in the Genus database with same CATH topology
5EWVA 4UYGA 2D82A 4YY6A 4NR9A 4NR4A 5FH8A 5L96A 3TLPA 3QZVA 5HRWA 4TZ2A 5EPBA 4YYJA 4NR7A 5FH6A 5HQ6A 3JVLA 4PTBA 4J1PA 5DFDA 2H60A 4PCEA 5LVQA 4DONA 5A81A 2YYNA 5CS8A 5D7XA 5TCMA 4BW3A 2DVQA 4Z6IA 5C7NA 4HBVA 2KTBB 5FG6A 3LXJA 5ENIA 5EM3A 2OO1A 5KTUA 4ZW1A 3O37A 5E9LA 5D3LA 4A9HA 4A9IA 5CRMA 5E9MA 4NYVA 2WP1A 3AADA 5EWCA 4QBMA 5F36A 5BT3A 4F3IA 4HXRA 5EA1A 4XUAA 3NXBA 4KCXA 4QSUA 4WIVA 4YABA 5A5OA 4O77A 5C4QA 5CUEA 2RNXA 2YEMA 2GRCA 2FSAA 4IOQA 4OGJA 4YYIA 3LJWA 4QB3A 5I40A 4YYHA 5I80A 5EU1A 4NR5A 3O36A 4CURA 2F6NA 3HMFA 5LKXA 5D0CA 2MJVB 4Z1QA 4NUCA 5FE4A 4CUQA 4O76A 4HBWA 5AMEA 5FE0A 3U5PA 5D3NA 5LKZA 3MB3A 5DKHA 5D3PA 5CPEA 4BJXA 4HBXA 4YBMA 4CUSA 3RCWA 5EK9A 5FDZA 4CLBA 2DVVA 5F25A 4LR6A 3HMHA 5E9IA 4YYGA 5D3HA 5L97A 5H1VA 4J0SA 4MR6A 4ALGA 3U5OA 3QZTA 4IORA 4QYLA 4YADA 5EPSA 5A5NA 4CL9A 5I29A 5DW2A 4BHWA 4QSWA 3UW9A 5FE1A 5FE7A 5CQ6A 5DFCA 4N4HA 5A85A 5IIDA 3FKMX 5CUGA 3U5NA 5F5ZA 5CFWA 5CRZA 3U5JA 5AD2A 3UV4A 2RO1A 5F1HA 4NUEA 5LKTA 4UYFB 4O7EA 5EI4A 5D3SA 4MR5A 5H1TA 5F1LA 3GG3A 5FFVA 5DLXA 3MQMA 1JM4B 5ENEA 4NR8A 5F63A 5C89A 5HELA 2DATA 4TZ8A 5A5SA 2E7OA 4O74A 4YYNA 5DW1A 5ENHA 5E9VA 5CQ8A 4IR3A 4QUTA 5E74A 4UIUA 4YBSA 3O35A 3O34A 5CQTA 4ZQLA 3G0JA 5CZGA 4PKLA 4MR4A 3P1CA 2RNYA 3D7CA 4QEVA 4O72A 4WHWA 3HMEA 4CFLA 5L8TA 4HXLA 4QR5A 4XY8A 3SVGA 3S92A 2R0SA 4HXKA 5FB1A 5HEMA 3P1EA 3UVXA 5JWMA 5CU8A 2RS9B 4A9MA 4QSXA 5I7YA 5JI8A 2OSSA 3P1DA 4KV4A 4YBTA 5FE8A 5F2PA 2DVSA 5C87A 4IOOA 4LZSA 5E7DA 4XYAA 3S91A 4QUUA 5KO4A 4O7AA 5CTLA 5ETDA 5H1UA 4UIWA 5IGNA 3DWYA 3MULA 4BW2A 5IGLA 4HXPA 4YYKA 4IR6A 5DKDA 3K2JA 5HFQA 4QR4A 4J3IA 5IG6A 4O71A 4WHUA 1WUMA 5II1A 4YAXA 4IR5A 5HFRA 5BT5A 4UYFA 4MEOA 5D3JA 5DKCA 3UV5A 5FE2A 5HRXA 1ZS5A 5CQ3A 5FE5A 3JVKA 4O75A 5IBNA 3MXFA 5E9KA 5HQ5A 2RNWA 3UV2A 5EWHA 4N4FA 4TT2A 5I1QA 5I83A 2F6JA 4O7BA 4O7CA 1EQFA 4IR4A 3LQJA 5F3AA 5ENGA 4UYHA 4QNSA 2DKWA 5D24A 5EQ1A 2RFJA 4QR3A 5KTWA 2WP2A 5DY7A 3ZYUA 3G0LA 5KTXA 4HXNA 4TTEA 4CUTA 5CUCA 5FG4A 3AQAA 4O7FA 4OUFA 5G4RA 5K29A 3ONIA 5ETBA 3QZSA 2R0VA 5KHMA 4MEQA 4NRAA 4QSRA 2NXBA 5HCLA 5CGPA 5D26A 4TU4A 4YY4A 4QEUA 4UYEA 4O78A 5A5RA 5LUUA 5E3DA 5F62A 4XY9A 4UIVA 5CUAA 2YW5A 2YELA 4YYMA 2D9EA 5DLZA 4UIXA 5E73A 5I86A 5LJ0A 5ENBA 5ENJA 3UVDA 4LZRA 5I89A 5CQ5A 2RI7A 5A7CA 4Z6HA 5G4SA 5A82A 5EVAA 3UVWA 4LC2A 5EV9A 5DYAA 4XUBA 3SVFA 5EICA 2N9GA 4QSTA 4TT6A 5A5QA 5FFWA 5FE9A 4UIYA 5I88A 5L8UA 4TQNA 5HQ7A 4NR6A 4TYLA 4LZ2A 4LRGA 2LSPB 5FE3A 4UYDA 5COIA 4FLPA 4LYSA 5II2A 4Z1SA 5L99A 3U5KA 4PS5A 4A9EA 5A83A 5KU3A 4NQNA 5EWDA 4NUDA 3U5LA 2DWWA 4QYDA 4BW4A 5HJCA 4TS8A 1WUGA 4NS5A 4Q0NA 4Y03A 4N4GA 4TU6A 3MUKA 2R0YA 5EPRA 4A9NA 5EWWA 5LVRA 2L85A 5CQ7A 5ENCA 4NRBA 4PCIA 5D3RA 4QZSA 4ALHA 5AD3A 4YH3A 4KV1A 4MR3A 4A9LA 4NXJA 4HXSA 4OGIA 4Q0OA 5F60A 4LYIA 3O33A 4QSVA 4QSQA 4PY6A 3Q2EA 3IU5A 4AKNA 4C67A 3DAIA 1F68A 4MENA 5E0RA 4QSSA 2L84A 5F61A 3IU6A 3P5OA 4O70A 5DBMA 5CQAA 4HXOA 5BT4A 2YDWA 5EP7A 3I3JA 4C66A 4YC9A 2YEKA 5TB6A 4GPJA 1E6IA 4YK0A 3MB4A 4CUUA 5IGKA 5CY9A 4BW1A 4NYXA 5DYUA 3JVMA 3Q2FA 4TT4A 5L98A 4A9FA 5CUDA 4RVRA 5A5PA 4MEPA 4N4IA 5FE6A 5H85A 5ACYA 4X2IA 5EISA 4ZC9A 5FFYA 3UVYA 5CUBA 4N3WA 2E3KA 4QY4A 5D3TA 5LJ2A 5FBXA 5HM0A 1JSPB 2I7KA 5I7XA 2E7NA 5HENA 3LQHA 4NYWA 2YQDA 4A9JA 5FG5A 1X0JA 4A9OA 5EGUA 5C85A 5E9YA 5J0DA 4YH4A 2R10A 5HLSA 4QC1A 5E3GA 4UITA 5ENFA 5FB0A 4UIZA 4NRCA 3LQIA 5DX4A 4HXMA 4A9KA 4HBYA 4J0RA 4Z93A 4CFKA 5LJ1A 5LKUA 4LYWA 3SVHA 4QSPA 5HRVA 5DYCA 5D25A 4QEWA 2OUOA 5IGMA 2L5EA 5FH7A 4QC3A 5CQ4A 5AMFA 3P1FA 2G4AA 2DVRA 5DFBA 4NQMA 5DYXA 4YATA 4CUPA 3U5MA 5CP5A 5C8GA 4E96A 1N72A 3JVJA 4LDFA 2I8NA 4YYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWV A;  4UYG A;  2D82 A;  4YY6 A;  4NR9 A;  4NR4 A;  5FH8 A;  5L96 A;  3TLP A;  3QZV A;  5HRW A;  4TZ2 A;  5EPB A;  4YYJ A;  4NR7 A;  5FH6 A;  5HQ6 A;  3JVL A;  4PTB A;  4J1P A;  5DFD A;  2H60 A;  4PCE A;  5LVQ A;  4DON A;  5A81 A;  2YYN A;  5CS8 A;  5D7X A;  5TCM A;  4BW3 A;  2DVQ A;  4Z6I A;  5C7N A;  4HBV A;  2KTB B;  5FG6 A;  3LXJ A;  5ENI A;  5EM3 A;  2OO1 A;  5KTU A;  4ZW1 A;  3O37 A;  5E9L A;  5D3L A;  4A9H A;  4A9I A;  5CRM A;  5E9M A;  4NYV A;  2WP1 A;  3AAD A;  5EWC A;  4QBM A;  5F36 A;  5BT3 A;  4F3I A;  4HXR A;  5EA1 A;  4XUA A;  3NXB A;  4KCX A;  4QSU A;  4WIV A;  4YAB A;  5A5O A;  4O77 A;  5C4Q A;  5CUE A;  2RNX A;  2YEM A;  2GRC A;  2FSA A;  4IOQ A;  4OGJ A;  4YYI A;  3LJW A;  4QB3 A;  5I40 A;  4YYH A;  5I80 A;  5EU1 A;  4NR5 A;  3O36 A;  4CUR A;  2F6N A;  3HMF A;  5LKX A;  5D0C A;  2MJV B;  4Z1Q A;  4NUC A;  5FE4 A;  4CUQ A;  4O76 A;  4HBW A;  5AME A;  5FE0 A;  3U5P A;  5D3N A;  5LKZ A;  3MB3 A;  5DKH A;  5D3P A;  5CPE A;  4BJX A;  4HBX A;  4YBM A;  4CUS A;  3RCW A;  5EK9 A;  5FDZ A;  4CLB A;  2DVV A;  5F25 A;  4LR6 A;  3HMH A;  5E9I A;  4YYG A;  5D3H A;  5L97 A;  5H1V A;  4J0S A;  4MR6 A;  4ALG A;  3U5O A;  3QZT A;  4IOR A;  4QYL A;  4YAD A;  5EPS A;  5A5N A;  4CL9 A;  5I29 A;  5DW2 A;  4BHW A;  4QSW A;  3UW9 A;  5FE1 A;  5FE7 A;  5CQ6 A;  5DFC A;  4N4H A;  5A85 A;  5IID A;  3FKM X;  5CUG A;  3U5N A;  5F5Z A;  5CFW A;  5CRZ A;  3U5J A;  5AD2 A;  3UV4 A;  2RO1 A;  5F1H A;  4NUE A;  5LKT A;  4UYF B;  4O7E A;  5EI4 A;  5D3S A;  4MR5 A;  5H1T A;  5F1L A;  3GG3 A;  5FFV A;  5DLX A;  3MQM A;  1JM4 B;  5ENE A;  4NR8 A;  5F63 A;  5C89 A;  5HEL A;  2DAT A;  4TZ8 A;  5A5S A;  2E7O A;  4O74 A;  4YYN A;  5DW1 A;  5ENH A;  5E9V A;  5CQ8 A;  4IR3 A;  4QUT A;  5E74 A;  4UIU A;  4YBS A;  3O35 A;  3O34 A;  5CQT A;  4ZQL A;  3G0J A;  5CZG A;  4PKL A;  4MR4 A;  3P1C A;  2RNY A;  3D7C A;  4QEV A;  4O72 A;  4WHW A;  3HME A;  4CFL A;  5L8T A;  4HXL A;  4QR5 A;  4XY8 A;  3SVG A;  3S92 A;  2R0S A;  4HXK A;  5FB1 A;  5HEM A;  3P1E A;  3UVX A;  5JWM A;  5CU8 A;  2RS9 B;  4A9M A;  4QSX A;  5I7Y A;  5JI8 A;  2OSS A;  3P1D A;  4KV4 A;  4YBT A;  5FE8 A;  5F2P A;  2DVS A;  5C87 A;  4IOO A;  4LZS A;  5E7D A;  4XYA A;  3S91 A;  4QUU A;  5KO4 A;  4O7A A;  5CTL A;  5ETD A;  5H1U A;  4UIW A;  5IGN A;  3DWY A;  3MUL A;  4BW2 A;  5IGL A;  4HXP A;  4YYK A;  4IR6 A;  5DKD A;  3K2J A;  5HFQ A;  4QR4 A;  4J3I A;  5IG6 A;  4O71 A;  4WHU A;  1WUM A;  5II1 A;  4YAX A;  4IR5 A;  5HFR A;  5BT5 A;  4UYF A;  4MEO A;  5D3J A;  5DKC A;  3UV5 A;  5FE2 A;  5HRX A;  1ZS5 A;  5CQ3 A;  5FE5 A;  3JVK A;  4O75 A;  5IBN A;  3MXF A;  5E9K A;  5HQ5 A;  2RNW A;  3UV2 A;  5EWH A;  4N4F A;  4TT2 A;  5I1Q A;  5I83 A;  2F6J A;  4O7B A;  4O7C A;  1EQF A;  4IR4 A;  3LQJ A;  5F3A A;  5ENG A;  4UYH A;  4QNS A;  2DKW A;  5D24 A;  5EQ1 A;  2RFJ A;  4QR3 A;  5KTW A;  2WP2 A;  5DY7 A;  3ZYU A;  3G0L A;  5KTX A;  4HXN A;  4TTE A;  4CUT A;  5CUC A;  5FG4 A;  3AQA A;  4O7F A;  4OUF A;  5G4R A;  5K29 A;  3ONI A;  5ETB A;  3QZS A;  2R0V A;  5KHM A;  4MEQ A;  4NRA A;  4QSR A;  2NXB A;  5HCL A;  5CGP A;  5D26 A;  4TU4 A;  4YY4 A;  4QEU A;  4UYE A;  4O78 A;  5A5R A;  5LUU A;  5E3D A;  5F62 A;  4XY9 A;  4UIV A;  5CUA A;  2YW5 A;  2YEL A;  4YYM A;  2D9E A;  5DLZ A;  4UIX A;  5E73 A;  5I86 A;  5LJ0 A;  5ENB A;  5ENJ A;  3UVD A;  4LZR A;  5I89 A;  5CQ5 A;  2RI7 A;  5A7C A;  4Z6H A;  5G4S A;  5A82 A;  5EVA A;  3UVW A;  4LC2 A;  5EV9 A;  5DYA A;  4XUB A;  3SVF A;  5EIC A;  2N9G A;  4QST A;  4TT6 A;  5A5Q A;  5FFW A;  5FE9 A;  4UIY A;  5I88 A;  5L8U A;  4TQN A;  5HQ7 A;  4NR6 A;  4TYL A;  4LZ2 A;  4LRG A;  2LSP B;  5FE3 A;  4UYD A;  5COI A;  4FLP A;  4LYS A;  5II2 A;  4Z1S A;  5L99 A;  3U5K A;  4PS5 A;  4A9E A;  5A83 A;  5KU3 A;  4NQN A;  5EWD A;  4NUD A;  3U5L A;  2DWW A;  4QYD A;  4BW4 A;  5HJC A;  4TS8 A;  1WUG A;  4NS5 A;  4Q0N A;  4Y03 A;  4N4G A;  4TU6 A;  3MUK A;  2R0Y A;  5EPR A;  4A9N A;  5EWW A;  5LVR A;  2L85 A;  5CQ7 A;  5ENC A;  4NRB A;  4PCI A;  5D3R A;  4QZS A;  4ALH A;  5AD3 A;  4YH3 A;  4KV1 A;  4MR3 A;  4A9L A;  4NXJ A;  4HXS A;  4OGI A;  4Q0O A;  5F60 A;  4LYI A;  3O33 A;  4QSV A;  4QSQ A;  4PY6 A;  3Q2E A;  3IU5 A;  4AKN A;  4C67 A;  3DAI A;  1F68 A;  4MEN A;  5E0R A;  4QSS A;  2L84 A;  5F61 A;  3IU6 A;  3P5O A;  4O70 A;  5DBM A;  5CQA A;  4HXO A;  5BT4 A;  2YDW A;  5EP7 A;  3I3J A;  4C66 A;  4YC9 A;  2YEK A;  5TB6 A;  4GPJ A;  1E6I A;  4YK0 A;  3MB4 A;  4CUU A;  5IGK A;  5CY9 A;  4BW1 A;  4NYX A;  5DYU A;  3JVM A;  3Q2F A;  4TT4 A;  5L98 A;  4A9F A;  5CUD A;  4RVR A;  5A5P A;  4MEP A;  4N4I A;  5FE6 A;  5H85 A;  5ACY A;  4X2I A;  5EIS A;  4ZC9 A;  5FFY A;  3UVY A;  5CUB A;  4N3W A;  2E3K A;  4QY4 A;  5D3T A;  5LJ2 A;  5FBX A;  5HM0 A;  1JSP B;  2I7K A;  5I7X A;  2E7N A;  5HEN A;  3LQH A;  4NYW A;  2YQD A;  4A9J A;  5FG5 A;  1X0J A;  4A9O A;  5EGU A;  5C85 A;  5E9Y A;  5J0D A;  4YH4 A;  2R10 A;  5HLS A;  4QC1 A;  5E3G A;  4UIT A;  5ENF A;  5FB0 A;  4UIZ A;  4NRC A;  3LQI A;  5DX4 A;  4HXM A;  4A9K A;  4HBY A;  4J0R A;  4Z93 A;  4CFK A;  5LJ1 A;  5LKU A;  4LYW A;  3SVH A;  4QSP A;  5HRV A;  5DYC A;  5D25 A;  4QEW A;  2OUO A;  5IGM A;  2L5E A;  5FH7 A;  4QC3 A;  5CQ4 A;  5AMF A;  3P1F A;  2G4A A;  2DVR A;  5DFB A;  4NQM A;  5DYX A;  4YAT A;  4CUP A;  3U5M A;  5CP5 A;  5C8G A;  4E96 A;  1N72 A;  3JVJ A;  4LDF A;  2I8N A;  4YYD A; 
#chains in the Genus database with same CATH topology
 5EWV A;  4UYG A;  2D82 A;  4YY6 A;  4NR9 A;  4NR4 A;  5FH8 A;  5L96 A;  3TLP A;  3QZV A;  5HRW A;  4TZ2 A;  5EPB A;  4YYJ A;  4NR7 A;  5FH6 A;  5HQ6 A;  3JVL A;  4PTB A;  4J1P A;  5DFD A;  2H60 A;  4PCE A;  5LVQ A;  4DON A;  5A81 A;  2YYN A;  5CS8 A;  5D7X A;  5TCM A;  4BW3 A;  2DVQ A;  4Z6I A;  5C7N A;  4HBV A;  2KTB B;  5FG6 A;  3LXJ A;  5ENI A;  5EM3 A;  2OO1 A;  5KTU A;  4ZW1 A;  3O37 A;  5E9L A;  5D3L A;  4A9H A;  4A9I A;  5CRM A;  5E9M A;  4NYV A;  2WP1 A;  3AAD A;  5EWC A;  4QBM A;  5F36 A;  5BT3 A;  4F3I A;  4HXR A;  5EA1 A;  4XUA A;  2EJN A;  3NXB A;  4KCX A;  4QSU A;  4WIV A;  4YAB A;  5A5O A;  4O77 A;  5C4Q A;  5CUE A;  2RNX A;  2YEM A;  2GRC A;  2FSA A;  4IOQ A;  4OGJ A;  4YYI A;  3LJW A;  4QB3 A;  5I40 A;  4YYH A;  5I80 A;  5EU1 A;  4NR5 A;  3O36 A;  4CUR A;  2F6N A;  3HMF A;  5LKX A;  5D0C A;  2MJV B;  4Z1Q A;  4NUC A;  5FE4 A;  4CUQ A;  4O76 A;  4HBW A;  5AME A;  5FE0 A;  3U5P A;  5D3N A;  5LKZ A;  3MB3 A;  5DKH A;  5D3P A;  5CPE A;  4BJX A;  4HBX A;  4YBM A;  4CUS A;  3RCW A;  5EK9 A;  5FDZ A;  4CLB A;  2DVV A;  5F25 A;  4LR6 A;  3HMH A;  5E9I A;  4YYG A;  5D3H A;  5L97 A;  5H1V A;  4J0S A;  4MR6 A;  4ALG A;  3U5O A;  3QZT A;  4IOR A;  4QYL A;  4YAD A;  5EPS A;  5A5N A;  4CL9 A;  5I29 A;  5DW2 A;  4BHW A;  4QSW A;  3UW9 A;  5FE1 A;  5FE7 A;  5CQ6 A;  5DFC A;  3D1B A;  4N4H A;  5A85 A;  5IID A;  3FKM X;  5CUG A;  3U5N A;  5F5Z A;  5CFW A;  5CRZ A;  3U5J A;  5AD2 A;  3UV4 A;  2RO1 A;  5F1H A;  4NUE A;  5LKT A;  4UYF B;  4O7E A;  5EI4 A;  5D3S A;  4MR5 A;  5H1T A;  5F1L A;  3GG3 A;  5FFV A;  5DLX A;  3MQM A;  1JM4 B;  5ENE A;  4NR8 A;  5F63 A;  5C89 A;  5HEL A;  2DAT A;  4TZ8 A;  5A5S A;  2E7O A;  4O74 A;  4YYN A;  5DW1 A;  5ENH A;  5E9V A;  5CQ8 A;  4IR3 A;  4QUT A;  5E74 A;  4UIU A;  4YBS A;  3O35 A;  3O34 A;  5CQT A;  4ZQL A;  3G0J A;  5CZG A;  4PKL A;  4MR4 A;  3P1C A;  2RNY A;  3D7C A;  4QEV A;  4O72 A;  4WHW A;  3HME A;  4CFL A;  5L8T A;  1PUO A;  4HXL A;  4QR5 A;  3D1D A;  4XY8 A;  3SVG A;  3S92 A;  2R0S A;  4HXK A;  5FB1 A;  5HEM A;  3P1E A;  3UVX A;  5JWM A;  5CU8 A;  2RS9 B;  4A9M A;  4QSX A;  5I7Y A;  5JI8 A;  2OSS A;  3P1D A;  4KV4 A;  4YBT A;  5FE8 A;  5F2P A;  2DVS A;  5C87 A;  4IOO A;  4LZS A;  5E7D A;  4XYA A;  3S91 A;  4QUU A;  5KO4 A;  4O7A A;  5CTL A;  5ETD A;  5H1U A;  4UIW A;  5IGN A;  3DWY A;  3MUL A;  4BW2 A;  5IGL A;  4HXP A;  3VKG A;  4YYK A;  4IR6 A;  5DKD A;  3K2J A;  5HFQ A;  4QR4 A;  4J3I A;  5IG6 A;  4O71 A;  4WHU A;  1WUM A;  5II1 A;  4YAX A;  4IR5 A;  5HFR A;  5BT5 A;  4UYF A;  4MEO A;  5D3J A;  5DKC A;  3UV5 A;  5FE2 A;  5HRX A;  1ZS5 A;  5CQ3 A;  5FE5 A;  3JVK A;  4O75 A;  5IBN A;  3MXF A;  5E9K A;  5HQ5 A;  2RNW A;  3UV2 A;  5EWH A;  4N4F A;  4TT2 A;  5I1Q A;  5I83 A;  2F6J A;  4O7B A;  4O7C A;  1EQF A;  4IR4 A;  3LQJ A;  5F3A A;  5ENG A;  4UYH A;  4QNS A;  2DKW A;  5D24 A;  5EQ1 A;  2RFJ A;  4QR3 A;  5KTW A;  2WP2 A;  5DY7 A;  3ZYU A;  3G0L A;  5KTX A;  4HXN A;  4TTE A;  4CUT A;  5CUC A;  5FG4 A;  3AQA A;  4O7F A;  4OUF A;  5G4R A;  5K29 A;  3ONI A;  5ETB A;  3QZS A;  2R0V A;  5KHM A;  4MEQ A;  4NRA A;  4QSR A;  2NXB A;  5HCL A;  3VKH A;  5CGP A;  5D26 A;  4TU4 A;  4YY4 A;  4QEU A;  4UYE A;  4O78 A;  5A5R A;  5LUU A;  5E3D A;  5F62 A;  4XY9 A;  4UIV A;  5CUA A;  2YW5 A;  2YEL A;  4YYM A;  2D9E A;  5DLZ A;  4UIX A;  5E73 A;  5I86 A;  5LJ0 A;  5ENB A;  5ENJ A;  3UVD A;  4LZR A;  5I89 A;  5CQ5 A;  2RI7 A;  5A7C A;  4Z6H A;  5G4S A;  5A82 A;  5EVA A;  3UVW A;  4LC2 A;  5EV9 A;  5DYA A;  4XUB A;  3SVF A;  5EIC A;  2N9G A;  4QST A;  4TT6 A;  5A5Q A;  5FFW A;  5FE9 A;  4UIY A;  5I88 A;  5L8U A;  4TQN A;  5HQ7 A;  4NR6 A;  4TYL A;  4LZ2 A;  4LRG A;  2LSP B;  5FE3 A;  4UYD A;  3ERR A;  5COI A;  4FLP A;  4LYS A;  5II2 A;  4Z1S A;  5L99 A;  3U5K A;  4PS5 A;  4A9E A;  5A83 A;  5KU3 A;  4NQN A;  5EWD A;  4NUD A;  3U5L A;  2DWW A;  4QYD A;  4BW4 A;  5HJC A;  4TS8 A;  1WUG A;  4NS5 A;  4Q0N A;  4Y03 A;  4N4G A;  4TU6 A;  3MUK A;  2R0Y A;  5EPR A;  4A9N A;  5EWW A;  5LVR A;  2L85 A;  5CQ7 A;  5ENC A;  4NRB A;  4PCI A;  5D3R A;  4QZS A;  4ALH A;  5AD3 A;  4AKH A;  4YH3 A;  4KV1 A;  4MR3 A;  4A9L A;  4NXJ A;  4HXS A;  4OGI A;  4Q0O A;  5F60 A;  4LYI A;  3O33 A;  4QSV A;  4QSQ A;  4PY6 A;  3Q2E A;  3IU5 A;  4AKN A;  4AKG A;  4C67 A;  3DAI A;  1F68 A;  4MEN A;  5E0R A;  4QSS A;  2L84 A;  5F61 A;  3IU6 A;  3P5O A;  4O70 A;  5DBM A;  5CQA A;  4HXO A;  5BT4 A;  2YDW A;  5EP7 A;  3I3J A;  4C66 A;  4YC9 A;  2YEK A;  5TB6 A;  4GPJ A;  1E6I A;  4YK0 A;  3MB4 A;  4CUU A;  5IGK A;  5CY9 A;  4BW1 A;  4NYX A;  1ZKR A;  5DYU A;  3JVM A;  3Q2F A;  4TT4 A;  5L98 A;  4A9F A;  5CUD A;  4RVR A;  5A5P A;  4MEP A;  4N4I A;  5FE6 A;  5H85 A;  5ACY A;  4X2I A;  5EIS A;  4ZC9 A;  5FFY A;  3UVY A;  5CUB A;  4N3W A;  2E3K A;  4QY4 A;  5D3T A;  5LJ2 A;  5FBX A;  5HM0 A;  1JSP B;  2I7K A;  5I7X A;  2E7N A;  5HEN A;  3LQH A;  4NYW A;  2YQD A;  4A9J A;  5FG5 A;  1X0J A;  4A9O A;  5EGU A;  5C85 A;  4AKI A;  5E9Y A;  5J0D A;  4YH4 A;  2R10 A;  5HLS A;  4QC1 A;  5E3G A;  4UIT A;  5ENF A;  5FB0 A;  4UIZ A;  4NRC A;  3LQI A;  5DX4 A;  4HXM A;  4A9K A;  4HBY A;  4J0R A;  4Z93 A;  4CFK A;  5LJ1 A;  5LKU A;  4LYW A;  3SVH A;  4QSP A;  4AI6 A;  5HRV A;  5DYC A;  5D25 A;  4QEW A;  2OUO A;  5IGM A;  2L5E A;  5FH7 A;  4QC3 A;  5CQ4 A;  5AMF A;  3P1F A;  2G4A A;  2DVR A;  5DFB A;  4NQM A;  5DYX A;  4YAT A;  4CUP A;  3U5M A;  5CP5 A;  5C8G A;  4E96 A;  1N72 A;  3JVJ A;  4LDF A;  2I8N A;  4YYD A; 
#chains in the Genus database with same CATH homology
 5EWV A;  4UYG A;  2D82 A;  4YY6 A;  4NR9 A;  4NR4 A;  5FH8 A;  5L96 A;  3TLP A;  3QZV A;  5HRW A;  4TZ2 A;  5EPB A;  4YYJ A;  4NR7 A;  5FH6 A;  5HQ6 A;  3JVL A;  4PTB A;  4J1P A;  5DFD A;  2H60 A;  4PCE A;  5LVQ A;  4DON A;  5A81 A;  2YYN A;  5CS8 A;  5D7X A;  5TCM A;  4BW3 A;  2DVQ A;  4Z6I A;  5C7N A;  4HBV A;  2KTB B;  5FG6 A;  3LXJ A;  5ENI A;  5EM3 A;  2OO1 A;  5KTU A;  4ZW1 A;  3O37 A;  5E9L A;  5D3L A;  4A9H A;  4A9I A;  5CRM A;  5E9M A;  4NYV A;  2WP1 A;  3AAD A;  5EWC A;  4QBM A;  5F36 A;  5BT3 A;  4F3I A;  4HXR A;  5EA1 A;  4XUA A;  3NXB A;  4KCX A;  4QSU A;  4WIV A;  4YAB A;  5A5O A;  4O77 A;  5C4Q A;  5CUE A;  2RNX A;  2YEM A;  2GRC A;  2FSA A;  4IOQ A;  4OGJ A;  4YYI A;  3LJW A;  4QB3 A;  5I40 A;  4YYH A;  5I80 A;  5EU1 A;  4NR5 A;  3O36 A;  4CUR A;  2F6N A;  3HMF A;  5LKX A;  5D0C A;  2MJV B;  4Z1Q A;  4NUC A;  5FE4 A;  4CUQ A;  4O76 A;  4HBW A;  5AME A;  5FE0 A;  3U5P A;  5D3N A;  5LKZ A;  3MB3 A;  5DKH A;  5D3P A;  5CPE A;  4BJX A;  4HBX A;  4YBM A;  4CUS A;  3RCW A;  5EK9 A;  5FDZ A;  4CLB A;  2DVV A;  5F25 A;  4LR6 A;  3HMH A;  5E9I A;  4YYG A;  5D3H A;  5L97 A;  5H1V A;  4J0S A;  4MR6 A;  4ALG A;  3U5O A;  3QZT A;  4IOR A;  4QYL A;  4YAD A;  5EPS A;  5A5N A;  4CL9 A;  5I29 A;  5DW2 A;  4BHW A;  4QSW A;  3UW9 A;  5FE1 A;  5FE7 A;  5CQ6 A;  5DFC A;  4N4H A;  5A85 A;  5IID A;  3FKM X;  5CUG A;  3U5N A;  5F5Z A;  5CFW A;  5CRZ A;  3U5J A;  5AD2 A;  3UV4 A;  2RO1 A;  5F1H A;  4NUE A;  5LKT A;  4UYF B;  4O7E A;  5EI4 A;  5D3S A;  4MR5 A;  5H1T A;  5F1L A;  3GG3 A;  5FFV A;  5DLX A;  3MQM A;  1JM4 B;  5ENE A;  4NR8 A;  5F63 A;  5C89 A;  5HEL A;  2DAT A;  4TZ8 A;  5A5S A;  2E7O A;  4O74 A;  4YYN A;  5DW1 A;  5ENH A;  5E9V A;  5CQ8 A;  4IR3 A;  4QUT A;  5E74 A;  4UIU A;  4YBS A;  3O35 A;  3O34 A;  5CQT A;  4ZQL A;  3G0J A;  5CZG A;  4PKL A;  4MR4 A;  3P1C A;  2RNY A;  3D7C A;  4QEV A;  4O72 A;  4WHW A;  3HME A;  4CFL A;  5L8T A;  4HXL A;  4QR5 A;  4XY8 A;  3SVG A;  3S92 A;  2R0S A;  4HXK A;  5FB1 A;  5HEM A;  3P1E A;  3UVX A;  5JWM A;  5CU8 A;  2RS9 B;  4A9M A;  4QSX A;  5I7Y A;  5JI8 A;  2OSS A;  3P1D A;  4KV4 A;  4YBT A;  5FE8 A;  5F2P A;  2DVS A;  5C87 A;  4IOO A;  4LZS A;  5E7D A;  4XYA A;  3S91 A;  4QUU A;  5KO4 A;  4O7A A;  5CTL A;  5ETD A;  5H1U A;  4UIW A;  5IGN A;  3DWY A;  3MUL A;  4BW2 A;  5IGL A;  4HXP A;  4YYK A;  4IR6 A;  5DKD A;  3K2J A;  5HFQ A;  4QR4 A;  4J3I A;  5IG6 A;  4O71 A;  4WHU A;  1WUM A;  5II1 A;  4YAX A;  4IR5 A;  5HFR A;  5BT5 A;  4UYF A;  4MEO A;  5D3J A;  5DKC A;  3UV5 A;  5FE2 A;  5HRX A;  1ZS5 A;  5CQ3 A;  5FE5 A;  3JVK A;  4O75 A;  5IBN A;  3MXF A;  5E9K A;  5HQ5 A;  2RNW A;  3UV2 A;  5EWH A;  4N4F A;  4TT2 A;  5I1Q A;  5I83 A;  2F6J A;  4O7B A;  4O7C A;  1EQF A;  4IR4 A;  3LQJ A;  5F3A A;  5ENG A;  4UYH A;  4QNS A;  2DKW A;  5D24 A;  5EQ1 A;  2RFJ A;  4QR3 A;  5KTW A;  2WP2 A;  5DY7 A;  3ZYU A;  3G0L A;  5KTX A;  4HXN A;  4TTE A;  4CUT A;  5CUC A;  5FG4 A;  3AQA A;  4O7F A;  4OUF A;  5G4R A;  5K29 A;  3ONI A;  5ETB A;  3QZS A;  2R0V A;  5KHM A;  4MEQ A;  4NRA A;  4QSR A;  2NXB A;  5HCL A;  5CGP A;  5D26 A;  4TU4 A;  4YY4 A;  4QEU A;  4UYE A;  4O78 A;  5A5R A;  5LUU A;  5E3D A;  5F62 A;  4XY9 A;  4UIV A;  5CUA A;  2YW5 A;  2YEL A;  4YYM A;  2D9E A;  5DLZ A;  4UIX A;  5E73 A;  5I86 A;  5LJ0 A;  5ENB A;  5ENJ A;  3UVD A;  4LZR A;  5I89 A;  5CQ5 A;  2RI7 A;  5A7C A;  4Z6H A;  5G4S A;  5A82 A;  5EVA A;  3UVW A;  4LC2 A;  5EV9 A;  5DYA A;  4XUB A;  3SVF A;  5EIC A;  2N9G A;  4QST A;  4TT6 A;  5A5Q A;  5FFW A;  5FE9 A;  4UIY A;  5I88 A;  5L8U A;  4TQN A;  5HQ7 A;  4NR6 A;  4TYL A;  4LZ2 A;  4LRG A;  2LSP B;  5FE3 A;  4UYD A;  5COI A;  4FLP A;  4LYS A;  5II2 A;  4Z1S A;  5L99 A;  3U5K A;  4PS5 A;  4A9E A;  5A83 A;  5KU3 A;  4NQN A;  5EWD A;  4NUD A;  3U5L A;  2DWW A;  4QYD A;  4BW4 A;  5HJC A;  4TS8 A;  1WUG A;  4NS5 A;  4Q0N A;  4Y03 A;  4N4G A;  4TU6 A;  3MUK A;  2R0Y A;  5EPR A;  4A9N A;  5EWW A;  5LVR A;  2L85 A;  5CQ7 A;  5ENC A;  4NRB A;  4PCI A;  5D3R A;  4QZS A;  4ALH A;  5AD3 A;  4YH3 A;  4KV1 A;  4MR3 A;  4A9L A;  4NXJ A;  4HXS A;  4OGI A;  4Q0O A;  5F60 A;  4LYI A;  3O33 A;  4QSV A;  4QSQ A;  4PY6 A;  3Q2E A;  3IU5 A;  4AKN A;  4C67 A;  3DAI A;  1F68 A;  4MEN A;  5E0R A;  4QSS A;  2L84 A;  5F61 A;  3IU6 A;  3P5O A;  4O70 A;  5DBM A;  5CQA A;  4HXO A;  5BT4 A;  2YDW A;  5EP7 A;  3I3J A;  4C66 A;  4YC9 A;  2YEK A;  5TB6 A;  4GPJ A;  1E6I A;  4YK0 A;  3MB4 A;  4CUU A;  5IGK A;  5CY9 A;  4BW1 A;  4NYX A;  5DYU A;  3JVM A;  3Q2F A;  4TT4 A;  5L98 A;  4A9F A;  5CUD A;  4RVR A;  5A5P A;  4MEP A;  4N4I A;  5FE6 A;  5H85 A;  5ACY A;  4X2I A;  5EIS A;  4ZC9 A;  5FFY A;  3UVY A;  5CUB A;  4N3W A;  2E3K A;  4QY4 A;  5D3T A;  5LJ2 A;  5FBX A;  5HM0 A;  1JSP B;  2I7K A;  5I7X A;  2E7N A;  5HEN A;  3LQH A;  4NYW A;  2YQD A;  4A9J A;  5FG5 A;  1X0J A;  4A9O A;  5EGU A;  5C85 A;  5E9Y A;  5J0D A;  4YH4 A;  2R10 A;  5HLS A;  4QC1 A;  5E3G A;  4UIT A;  5ENF A;  5FB0 A;  4UIZ A;  4NRC A;  3LQI A;  5DX4 A;  4HXM A;  4A9K A;  4HBY A;  4J0R A;  4Z93 A;  4CFK A;  5LJ1 A;  5LKU A;  4LYW A;  3SVH A;  4QSP A;  5HRV A;  5DYC A;  5D25 A;  4QEW A;  2OUO A;  5IGM A;  2L5E A;  5FH7 A;  4QC3 A;  5CQ4 A;  5AMF A;  3P1F A;  2G4A A;  2DVR A;  5DFB A;  4NQM A;  5DYX A;  4YAT A;  4CUP A;  3U5M A;  5CP5 A;  5C8G A;  4E96 A;  1N72 A;  3JVJ A;  4LDF A;  2I8N A;  4YYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...