5ENEA

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with 5-amino-2-benzyl-1,3-oxazole-4-carbonitrile (sgc - diamond i04-1 fragment screening)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PH-interacting protein
publication title A poised fragment library enables rapid synthetic expansion yielding the first reported inhibitors of PHIP(2), an atypical bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5eneA00
5L8UA 5EWWA 5E7DA 4IR6A 3U5NA 5F3AA 4TU6A 5HCLA 5D3JA 4O75A 5FFYA 5CQ3A 4MEOA 4RVRA 4OGIA 4ALHA 5I1QA 5DFBA 5HRVA 4O7EA 3P5OA 4QC1A 5EVAA 5FBXA 5AMEA 5DX4A 4NR6A 4QR4A 3U5MA 5EPSA 5D7XA 2RS9B 3RCWA 4YY4A 4MEQA 4HXNA 5L97A 4CURA 5I83A 2RNYA 5E9YA 4NR4A 5CQ7A 5D3RA 3LQJA 5EK9A 5HFRA 4KV4A 5ENCA 5A5RA 3U5JA 5F2PA 4N4HA 4O71A 4ALGA 4QR5A 4UYGA 5FE1A 2NXBA 1N72A 5ENHA 5FFWA 2DWWA 3LXJA 2OUOA 5CRZA 4O77A 5H1VA 4PCIA 5D3NA 2R0VA 4Q0NA 4NYVA 4HXLA 3G0LA 5EWDA 3DAIA 5FG4A 3IU5A 3SVGA 4A9KA 3JVKA 4NS5A 4A9FA 5ACYA 5CQAA 4N4GA 3O35A 4BW2A 4TQNA 5LKTA 2I7KA 3O33A 5DY7A 5L8TA 4PY6A 3Q2EA 4HXKA 5E73A 5FE2A 5DYCA 5DW1A 5CY9A 5F60A 3U5OA 4YK0A 4CUSA 5KU3A 3MXFA 5CGPA 5A5SA 5HM0A 4PS5A 4QSPA 4NUEA 3ZYUA 5F63A 5AMFA 5I88A 2DVVA 5D3SA 4QSQA 5EWVA 4MR6A 2RI7A 4N4FA 4WIVA 4XUAA 5DFCA 4HBVA 5F1HA 2G4AA 5HQ7A 5A5OA 3D7CA 3K2JA 4HBWA 4NUDA 4QZSA 4UIVA 5D3TA 3MB3A 5G4RA 4KCXA 1JSPB 4IR5A 5G4SA 4YYKA 4UYEA 3QZVA 4OUFA 4C66A 4TS8A 4BW3A 5FG5A 5CQTA 2YDWA 4YABA 4NRBA 5KO4A 4CUUA 5HQ5A 5IGNA 5H1TA 5AD3A 5HEMA 5LJ0A 5CUEA 4J0SA 5LKXA 5ENEA 2DVSA 3JVLA 2L85A 5DKCA 5CU8A 4TYLA 2R0YA 4X2IA 5EICA 2F6JA 4QEVA 4DONA 5JI8A 4BJXA 5IGMA 3AQAA 4QUUA 5E9IA 5EPRA 4NQMA 5C7NA 5FE6A 4QSVA 1EQFA 4NXJA 4UYDA 5D3HA 2RO1A 4TTEA 5EI4A 5E9VA 4F3IA 4BHWA 2DATA 3UVDA 2YEKA 4PKLA 5KTXA 4PTBA 5C89A 3HMFA 4O74A 4QEWA 4QYDA 4A9LA 4CUPA 1WUMA 3QZTA 4XY9A 4MR3A 5EISA 5JWMA 5BT4A 5TCMA 4NR5A 5DKHA 4YC9A 4YAXA 4A9MA 5ENGA 4YYIA 4NUCA 5CPEA 4Z93A 2LSPB 5C85A 5DFDA 4UIZA 4UIYA 2L5EA 5KTUA 2OSSA 5HRWA 2WP1A 5C4QA 5FB1A 5FE8A 5I29A 5KTWA 5F36A 3G0JA 4LYWA 4UIXA 4YBTA 4MENA 4QNSA 5CUAA 4QSRA 5A83A 4YBSA 5FE7A 4J1PA 5D24A 4IR4A 4UYFA 4YYMA 4TT2A 5FH8A 4WHWA 5CFWA 5LJ2A 4NYXA 3MQMA 5IGKA 4N4IA 5DLZA 2I8NA 2DKWA 2YW5A 5E9KA 4AKNA 4LZRA 5A5PA 4ZW1A 5L98A 1WUGA 5ENFA 5IGLA 4OGJA 4QC3A 5A7CA 5A82A 5FG6A 5F61A 5FE9A 5FE0A 5DKDA 3SVFA 4UIWA 4NRCA 4O70A 5F62A 4O7AA 4YYJA 2FSAA 4A9NA 4QSTA 3LQIA 5I80A 5CQ5A 4HXMA 4PCEA 4O72A 4NYWA 3LJWA 5EWHA 5DYAA 5I86A 3NXBA 4XY8A 3S92A 5LUUA 5HRXA 4HXSA 2E3KA 4CUQA 5D25A 4IOOA 5HLSA 4WHUA 4UITA 4QYLA 3P1EA 5DBMA 5EPBA 4E96A 4YYGA 4J0RA 4Z1QA 3I3JA 5HQ6A 3UVYA 5CS8A 4HBYA 5IG6A 3JVMA 4A9HA 4Z1SA 4CLBA 5FE5A 4O7BA 5BT3A 3AADA 5KHMA 5D26A 4A9OA 5FE3A 5L96A 4TT6A 5EQ1A 4MEPA 4TT4A 3O34A 5FFVA 5LKZA 2E7OA 4BW1A 2RFJA 2KTBB 2DVQA 4CFLA 5CUGA 3UV5A 5DYXA 5CTLA 4N3WA 5II1A 5TB6A 5IIDA 5K29A 3QZSA 3FKMX 5FH7A 5I40A 4GPJA 5ENIA 5ETBA 4LZSA 5FH6A 2YYNA 2OO1A 2N9GA 3U5KA 5LKUA 4NRAA 5ETDA 3S91A 3UV4A 4QSUA 4UIUA 5EGUA 4QY4A 4Z6HA 1ZS5A 4NQNA 5E3GA 4TU4A 5E0RA 4YY6A 4NR7A 2GRCA 4LC2A 2R10A 5CUBA 3P1DA 4A9IA 2YELA 5FE4A 5FB0A 5CRMA 5ENJA 5EV9A 5D3PA 5A81A 5CP5A 2WP2A 5E74A 5HJCA 1E6IA 5C8GA 4MR5A 4YYHA 4QR3A 5F1LA 5DLXA 5EU1A 4O76A 4YYDA 4HXOA 5EM3A 2YQDA 5EP7A 4IR3A 4FLPA 3HMEA 2F6NA 2YEMA 4A9JA 3O37A 3U5LA 3Q2FA 5LVRA 1F68A 4NR8A 4TZ8A 4A9EA 4QB3A 1X0JA 4Z6IA 4YYNA 4XUBA 5FDZA 3MULA 4YH4A 5D0CA 4LDFA 4LYIA 2H60A 3GG3A 4O7FA 5EA1A 5I89A 3TLPA 5BT5A 5HFQA 2RNWA 5CQ4A 5HELA 3MB4A 5IBNA 5ENBA 2L84A 5E9MA 4J3IA 4MR4A 5E3DA 5CZGA 4LR6A 5A5QA 3JVJA 4ZC9A 2DVRA 3LQHA 4CL9A 5C87A 4QSSA 5A5NA 3O36A 5J0DA 4YH3A 5CQ8A 3SVHA 4HXPA 5HENA 5EWCA 2RNXA 3UVWA 4KV1A 4YATA 4QBMA 4QSWA 5CUCA 2MJVB 5D3LA 2D82A 4TZ2A 4IORA 4ZQLA 4LRGA 5LVQA 3UVXA 4NR9A 4LYSA 5LJ1A 4HXRA 5CUDA 4O7CA 5CQ6A 5F5ZA 5I7YA 3ONIA 4YADA 4YBMA 2R0SA 5A85A 3P1FA 5F25A 4XYAA 4QUTA 5DW2A 4LZ2A 4Q0OA 3IU6A 4QSXA 4Y03A 3UW9A 5II2A 3HMHA 1JM4B 3DWYA 4CFKA 4QEUA 5E9LA 3P1CA 4UYHA 5H85A 5L99A 3UV2A 4HBXA 2D9EA 5DYUA 5I7XA 3MUKA 4O78A 4C67A 4BW4A 4UYFB 5H1UA 5AD2A 4CUTA 3U5PA 5COIA 2E7NA 4IOQA
chains in the Genus database with same CATH superfamily
5L8UA 5EWWA 5E7DA 4IR6A 3U5NA 5F3AA 4TU6A 5HCLA 5D3JA 4O75A 5FFYA 5CQ3A 4MEOA 4RVRA 4OGIA 4ALHA 5I1QA 5DFBA 5HRVA 4O7EA 3P5OA 4QC1A 5EVAA 5FBXA 5AMEA 5DX4A 4NR6A 4QR4A 3U5MA 5EPSA 5D7XA 2RS9B 3RCWA 4YY4A 4MEQA 4HXNA 5L97A 4CURA 5I83A 2RNYA 5E9YA 4NR4A 5CQ7A 5D3RA 3LQJA 5EK9A 5HFRA 4KV4A 5ENCA 5A5RA 3U5JA 5F2PA 4N4HA 4O71A 4ALGA 1ZKRA 4QR5A 4UYGA 5FE1A 2NXBA 1N72A 5ENHA 5FFWA 2DWWA 3LXJA 2OUOA 5CRZA 4O77A 5H1VA 4PCIA 5D3NA 2R0VA 4Q0NA 4NYVA 4HXLA 3G0LA 5EWDA 3DAIA 5FG4A 3IU5A 3SVGA 4A9KA 3JVKA 4NS5A 4A9FA 5ACYA 5CQAA 4N4GA 3O35A 4BW2A 4TQNA 5LKTA 2I7KA 3O33A 5DY7A 5L8TA 4PY6A 3Q2EA 4HXKA 5E73A 5FE2A 5DYCA 5DW1A 5CY9A 5F60A 3U5OA 4YK0A 4CUSA 5KU3A 3MXFA 5CGPA 5A5SA 5HM0A 4PS5A 4QSPA 4NUEA 3ZYUA 5F63A 5AMFA 5I88A 2DVVA 5D3SA 4QSQA 5EWVA 4MR6A 2RI7A 4N4FA 4WIVA 4XUAA 5DFCA 4HBVA 5F1HA 2G4AA 5HQ7A 5A5OA 3D7CA 3K2JA 4HBWA 4NUDA 4QZSA 4UIVA 5D3TA 3MB3A 5G4RA 4KCXA 1JSPB 4IR5A 5G4SA 4YYKA 4UYEA 3QZVA 4OUFA 4C66A 4TS8A 4BW3A 5FG5A 5CQTA 2YDWA 4YABA 4NRBA 5KO4A 4CUUA 5HQ5A 5IGNA 5H1TA 5AD3A 5HEMA 5LJ0A 5CUEA 4J0SA 5LKXA 5ENEA 2DVSA 3JVLA 2L85A 5DKCA 3D1DA 5CU8A 4TYLA 2R0YA 4X2IA 5EICA 2F6JA 4QEVA 4DONA 5JI8A 4BJXA 1PUOA 5IGMA 3AQAA 4QUUA 5E9IA 5EPRA 4NQMA 5C7NA 5FE6A 4QSVA 1EQFA 4NXJA 4UYDA 5D3HA 2RO1A 4TTEA 5EI4A 5E9VA 4F3IA 4BHWA 2DATA 3UVDA 2YEKA 4PKLA 5KTXA 4PTBA 5C89A 3HMFA 4O74A 4QEWA 4QYDA 4A9LA 4CUPA 1WUMA 3QZTA 4XY9A 4MR3A 5EISA 5JWMA 5BT4A 5TCMA 4NR5A 5DKHA 4YC9A 4YAXA 4A9MA 5ENGA 4YYIA 4NUCA 5CPEA 4Z93A 2LSPB 5C85A 5DFDA 4UIZA 4UIYA 2L5EA 5KTUA 2OSSA 5HRWA 2WP1A 5C4QA 5FB1A 5FE8A 5I29A 5KTWA 5F36A 3G0JA 4LYWA 4UIXA 4YBTA 4MENA 4QNSA 5CUAA 4QSRA 5A83A 4YBSA 5FE7A 4J1PA 5D24A 4IR4A 4UYFA 4YYMA 4TT2A 5FH8A 4WHWA 5CFWA 5LJ2A 4NYXA 3MQMA 5IGKA 3ERRA 4N4IA 5DLZA 2I8NA 2DKWA 2YW5A 5E9KA 4AKNA 4LZRA 5A5PA 4ZW1A 5L98A 1WUGA 5ENFA 5IGLA 4OGJA 4QC3A 5A7CA 5A82A 5FG6A 5F61A 5FE9A 5FE0A 5DKDA 3SVFA 4UIWA 4NRCA 4O70A 5F62A 4O7AA 4YYJA 2FSAA 4A9NA 4QSTA 3LQIA 5I80A 5CQ5A 4HXMA 4PCEA 4O72A 3VKGA 4NYWA 3LJWA 5EWHA 5DYAA 5I86A 3NXBA 4XY8A 3S92A 5LUUA 5HRXA 4AI6A 4HXSA 2E3KA 4CUQA 5D25A 4IOOA 5HLSA 4AKGA 4WHUA 4UITA 4QYLA 3P1EA 5DBMA 5EPBA 4E96A 4YYGA 4J0RA 4Z1QA 3I3JA 5HQ6A 3UVYA 5CS8A 4HBYA 5IG6A 3JVMA 4A9HA 4Z1SA 4CLBA 5FE5A 4O7BA 5BT3A 3AADA 5KHMA 5D26A 4A9OA 5FE3A 5L96A 4TT6A 5EQ1A 4MEPA 4TT4A 3O34A 3D1BA 5FFVA 5LKZA 2E7OA 4BW1A 2RFJA 2KTBB 2DVQA 4CFLA 5CUGA 3UV5A 5DYXA 5CTLA 4N3WA 5II1A 5TB6A 5IIDA 5K29A 3QZSA 3FKMX 5FH7A 5I40A 4GPJA 5ENIA 5ETBA 4LZSA 5FH6A 2YYNA 2OO1A 2N9GA 3U5KA 5LKUA 4NRAA 5ETDA 3S91A 3UV4A 4QSUA 4UIUA 5EGUA 4QY4A 4AKIA 4Z6HA 1ZS5A 4NQNA 5E3GA 4TU4A 5E0RA 4YY6A 4NR7A 2GRCA 4LC2A 2R10A 5CUBA 3P1DA 4A9IA 2YELA 5FE4A 5FB0A 5CRMA 5ENJA 5EV9A 5D3PA 5A81A 5CP5A 2WP2A 5E74A 5HJCA 1E6IA 5C8GA 4MR5A 4YYHA 4QR3A 5F1LA 5DLXA 5EU1A 4O76A 4YYDA 4HXOA 5EM3A 2YQDA 5EP7A 4IR3A 4FLPA 3HMEA 2F6NA 2YEMA 4A9JA 3O37A 3U5LA 3Q2FA 5LVRA 1F68A 4NR8A 4TZ8A 4A9EA 4QB3A 1X0JA 4Z6IA 4YYNA 4XUBA 5FDZA 3MULA 4YH4A 5D0CA 4LDFA 4LYIA 2H60A 3GG3A 4O7FA 5EA1A 5I89A 3TLPA 5BT5A 5HFQA 2RNWA 5CQ4A 5HELA 3MB4A 5IBNA 5ENBA 2L84A 5E9MA 4J3IA 4MR4A 5E3DA 5CZGA 4LR6A 5A5QA 3JVJA 4ZC9A 2DVRA 3LQHA 4CL9A 5C87A 4QSSA 5A5NA 3O36A 5J0DA 4YH3A 5CQ8A 3SVHA 4HXPA 5HENA 5EWCA 3VKHA 2RNXA 3UVWA 4KV1A 4YATA 4QBMA 4QSWA 5CUCA 2MJVB 5D3LA 2D82A 4TZ2A 4IORA 4ZQLA 4LRGA 5LVQA 3UVXA 4NR9A 4LYSA 5LJ1A 4HXRA 5CUDA 4O7CA 5CQ6A 5F5ZA 5I7YA 3ONIA 4YADA 4YBMA 2R0SA 5A85A 3P1FA 5F25A 4XYAA 4QUTA 5DW2A 4LZ2A 4Q0OA 3IU6A 4QSXA 4Y03A 3UW9A 5II2A 3HMHA 1JM4B 3DWYA 4CFKA 4AKHA 4QEUA 5E9LA 3P1CA 4UYHA 5H85A 5L99A 3UV2A 4HBXA 2D9EA 5DYUA 5I7XA 3MUKA 2EJNA 4O78A 4C67A 4BW4A 4UYFB 5H1UA 5AD2A 4CUTA 3U5PA 5COIA 2E7NA 4IOQA
chains in the Genus database with same CATH topology
5L8UA 5EWWA 5E7DA 4IR6A 3U5NA 5F3AA 4TU6A 5HCLA 5D3JA 4O75A 5FFYA 5CQ3A 4MEOA 4RVRA 4OGIA 4ALHA 5I1QA 5DFBA 5HRVA 4O7EA 3P5OA 4QC1A 5EVAA 5FBXA 5AMEA 5DX4A 4NR6A 4QR4A 3U5MA 5EPSA 5D7XA 2RS9B 3RCWA 4YY4A 4MEQA 4HXNA 5L97A 4CURA 5I83A 2RNYA 5E9YA 4NR4A 5CQ7A 5D3RA 3LQJA 5EK9A 5HFRA 4KV4A 5ENCA 5A5RA 3U5JA 5F2PA 4N4HA 4O71A 4ALGA 4QR5A 4UYGA 5FE1A 2NXBA 1N72A 5ENHA 5FFWA 2DWWA 3LXJA 2OUOA 5CRZA 4O77A 5H1VA 4PCIA 5D3NA 2R0VA 4Q0NA 4NYVA 4HXLA 3G0LA 5EWDA 3DAIA 5FG4A 3IU5A 3SVGA 4A9KA 3JVKA 4NS5A 4A9FA 5ACYA 5CQAA 4N4GA 3O35A 4BW2A 4TQNA 5LKTA 2I7KA 3O33A 5DY7A 5L8TA 4PY6A 3Q2EA 4HXKA 5E73A 5FE2A 5DYCA 5DW1A 5CY9A 5F60A 3U5OA 4YK0A 4CUSA 5KU3A 3MXFA 5CGPA 5A5SA 5HM0A 4PS5A 4QSPA 4NUEA 3ZYUA 5F63A 5AMFA 5I88A 2DVVA 5D3SA 4QSQA 5EWVA 4MR6A 2RI7A 4N4FA 4WIVA 4XUAA 5DFCA 4HBVA 5F1HA 2G4AA 5HQ7A 5A5OA 3D7CA 3K2JA 4HBWA 4NUDA 4QZSA 4UIVA 5D3TA 3MB3A 5G4RA 4KCXA 1JSPB 4IR5A 5G4SA 4YYKA 4UYEA 3QZVA 4OUFA 4C66A 4TS8A 4BW3A 5FG5A 5CQTA 2YDWA 4YABA 4NRBA 5KO4A 4CUUA 5HQ5A 5IGNA 5H1TA 5AD3A 5HEMA 5LJ0A 5CUEA 4J0SA 5LKXA 5ENEA 2DVSA 3JVLA 2L85A 5DKCA 5CU8A 4TYLA 2R0YA 4X2IA 5EICA 2F6JA 4QEVA 4DONA 5JI8A 4BJXA 5IGMA 3AQAA 4QUUA 5E9IA 5EPRA 4NQMA 5C7NA 5FE6A 4QSVA 1EQFA 4NXJA 4UYDA 5D3HA 2RO1A 4TTEA 5EI4A 5E9VA 4F3IA 4BHWA 2DATA 3UVDA 2YEKA 4PKLA 5KTXA 4PTBA 5C89A 3HMFA 4O74A 4QEWA 4QYDA 4A9LA 4CUPA 1WUMA 3QZTA 4XY9A 4MR3A 5EISA 5JWMA 5BT4A 5TCMA 4NR5A 5DKHA 4YC9A 4YAXA 4A9MA 5ENGA 4YYIA 4NUCA 5CPEA 4Z93A 2LSPB 5C85A 5DFDA 4UIZA 4UIYA 2L5EA 5KTUA 2OSSA 5HRWA 2WP1A 5C4QA 5FB1A 5FE8A 5I29A 5KTWA 5F36A 3G0JA 4LYWA 4UIXA 4YBTA 4MENA 4QNSA 5CUAA 4QSRA 5A83A 4YBSA 5FE7A 4J1PA 5D24A 4IR4A 4UYFA 4YYMA 4TT2A 5FH8A 4WHWA 5CFWA 5LJ2A 4NYXA 3MQMA 5IGKA 4N4IA 5DLZA 2I8NA 2DKWA 2YW5A 5E9KA 4AKNA 4LZRA 5A5PA 4ZW1A 5L98A 1WUGA 5ENFA 5IGLA 4OGJA 4QC3A 5A7CA 5A82A 5FG6A 5F61A 5FE9A 5FE0A 5DKDA 3SVFA 4UIWA 4NRCA 4O70A 5F62A 4O7AA 4YYJA 2FSAA 4A9NA 4QSTA 3LQIA 5I80A 5CQ5A 4HXMA 4PCEA 4O72A 4NYWA 3LJWA 5EWHA 5DYAA 5I86A 3NXBA 4XY8A 3S92A 5LUUA 5HRXA 4HXSA 2E3KA 4CUQA 5D25A 4IOOA 5HLSA 4WHUA 4UITA 4QYLA 3P1EA 5DBMA 5EPBA 4E96A 4YYGA 4J0RA 4Z1QA 3I3JA 5HQ6A 3UVYA 5CS8A 4HBYA 5IG6A 3JVMA 4A9HA 4Z1SA 4CLBA 5FE5A 4O7BA 5BT3A 3AADA 5KHMA 5D26A 4A9OA 5FE3A 5L96A 4TT6A 5EQ1A 4MEPA 4TT4A 3O34A 5FFVA 5LKZA 2E7OA 4BW1A 2RFJA 2KTBB 2DVQA 4CFLA 5CUGA 3UV5A 5DYXA 5CTLA 4N3WA 5II1A 5TB6A 5IIDA 5K29A 3QZSA 3FKMX 5FH7A 5I40A 4GPJA 5ENIA 5ETBA 4LZSA 5FH6A 2YYNA 2OO1A 2N9GA 3U5KA 5LKUA 4NRAA 5ETDA 3S91A 3UV4A 4QSUA 4UIUA 5EGUA 4QY4A 4Z6HA 1ZS5A 4NQNA 5E3GA 4TU4A 5E0RA 4YY6A 4NR7A 2GRCA 4LC2A 2R10A 5CUBA 3P1DA 4A9IA 2YELA 5FE4A 5FB0A 5CRMA 5ENJA 5EV9A 5D3PA 5A81A 5CP5A 2WP2A 5E74A 5HJCA 1E6IA 5C8GA 4MR5A 4YYHA 4QR3A 5F1LA 5DLXA 5EU1A 4O76A 4YYDA 4HXOA 5EM3A 2YQDA 5EP7A 4IR3A 4FLPA 3HMEA 2F6NA 2YEMA 4A9JA 3O37A 3U5LA 3Q2FA 5LVRA 1F68A 4NR8A 4TZ8A 4A9EA 4QB3A 1X0JA 4Z6IA 4YYNA 4XUBA 5FDZA 3MULA 4YH4A 5D0CA 4LDFA 4LYIA 2H60A 3GG3A 4O7FA 5EA1A 5I89A 3TLPA 5BT5A 5HFQA 2RNWA 5CQ4A 5HELA 3MB4A 5IBNA 5ENBA 2L84A 5E9MA 4J3IA 4MR4A 5E3DA 5CZGA 4LR6A 5A5QA 3JVJA 4ZC9A 2DVRA 3LQHA 4CL9A 5C87A 4QSSA 5A5NA 3O36A 5J0DA 4YH3A 5CQ8A 3SVHA 4HXPA 5HENA 5EWCA 2RNXA 3UVWA 4KV1A 4YATA 4QBMA 4QSWA 5CUCA 2MJVB 5D3LA 2D82A 4TZ2A 4IORA 4ZQLA 4LRGA 5LVQA 3UVXA 4NR9A 4LYSA 5LJ1A 4HXRA 5CUDA 4O7CA 5CQ6A 5F5ZA 5I7YA 3ONIA 4YADA 4YBMA 2R0SA 5A85A 3P1FA 5F25A 4XYAA 4QUTA 5DW2A 4LZ2A 4Q0OA 3IU6A 4QSXA 4Y03A 3UW9A 5II2A 3HMHA 1JM4B 3DWYA 4CFKA 4QEUA 5E9LA 3P1CA 4UYHA 5H85A 5L99A 3UV2A 4HBXA 2D9EA 5DYUA 5I7XA 3MUKA 4O78A 4C67A 4BW4A 4UYFB 5H1UA 5AD2A 4CUTA 3U5PA 5COIA 2E7NA 4IOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L8U A;  5EWW A;  5E7D A;  4IR6 A;  3U5N A;  5F3A A;  4TU6 A;  5HCL A;  5D3J A;  4O75 A;  5FFY A;  5CQ3 A;  4MEO A;  4RVR A;  4OGI A;  4ALH A;  5I1Q A;  5DFB A;  5HRV A;  4O7E A;  3P5O A;  4QC1 A;  5EVA A;  5FBX A;  5AME A;  5DX4 A;  4NR6 A;  4QR4 A;  3U5M A;  5EPS A;  5D7X A;  2RS9 B;  3RCW A;  4YY4 A;  4MEQ A;  4HXN A;  5L97 A;  4CUR A;  5I83 A;  2RNY A;  5E9Y A;  4NR4 A;  5CQ7 A;  5D3R A;  3LQJ A;  5EK9 A;  5HFR A;  4KV4 A;  5ENC A;  5A5R A;  3U5J A;  5F2P A;  4N4H A;  4O71 A;  4ALG A;  4QR5 A;  4UYG A;  5FE1 A;  2NXB A;  1N72 A;  5ENH A;  5FFW A;  2DWW A;  3LXJ A;  2OUO A;  5CRZ A;  4O77 A;  5H1V A;  4PCI A;  5D3N A;  2R0V A;  4Q0N A;  4NYV A;  4HXL A;  3G0L A;  5EWD A;  3DAI A;  5FG4 A;  3IU5 A;  3SVG A;  4A9K A;  3JVK A;  4NS5 A;  4A9F A;  5ACY A;  5CQA A;  4N4G A;  3O35 A;  4BW2 A;  4TQN A;  5LKT A;  2I7K A;  3O33 A;  5DY7 A;  5L8T A;  4PY6 A;  3Q2E A;  4HXK A;  5E73 A;  5FE2 A;  5DYC A;  5DW1 A;  5CY9 A;  5F60 A;  3U5O A;  4YK0 A;  4CUS A;  5KU3 A;  3MXF A;  5CGP A;  5A5S A;  5HM0 A;  4PS5 A;  4QSP A;  4NUE A;  3ZYU A;  5F63 A;  5AMF A;  5I88 A;  2DVV A;  5D3S A;  4QSQ A;  5EWV A;  4MR6 A;  2RI7 A;  4N4F A;  4WIV A;  4XUA A;  5DFC A;  4HBV A;  5F1H A;  2G4A A;  5HQ7 A;  5A5O A;  3D7C A;  3K2J A;  4HBW A;  4NUD A;  4QZS A;  4UIV A;  5D3T A;  3MB3 A;  5G4R A;  4KCX A;  1JSP B;  4IR5 A;  5G4S A;  4YYK A;  4UYE A;  3QZV A;  4OUF A;  4C66 A;  4TS8 A;  4BW3 A;  5FG5 A;  5CQT A;  2YDW A;  4YAB A;  4NRB A;  5KO4 A;  4CUU A;  5HQ5 A;  5IGN A;  5H1T A;  5AD3 A;  5HEM A;  5LJ0 A;  5CUE A;  4J0S A;  5LKX A;  5ENE A;  2DVS A;  3JVL A;  2L85 A;  5DKC A;  5CU8 A;  4TYL A;  2R0Y A;  4X2I A;  5EIC A;  2F6J A;  4QEV A;  4DON A;  5JI8 A;  4BJX A;  5IGM A;  3AQA A;  4QUU A;  5E9I A;  5EPR A;  4NQM A;  5C7N A;  5FE6 A;  4QSV A;  1EQF A;  4NXJ A;  4UYD A;  5D3H A;  2RO1 A;  4TTE A;  5EI4 A;  5E9V A;  4F3I A;  4BHW A;  2DAT A;  3UVD A;  2YEK A;  4PKL A;  5KTX A;  4PTB A;  5C89 A;  3HMF A;  4O74 A;  4QEW A;  4QYD A;  4A9L A;  4CUP A;  1WUM A;  3QZT A;  4XY9 A;  4MR3 A;  5EIS A;  5JWM A;  5BT4 A;  5TCM A;  4NR5 A;  5DKH A;  4YC9 A;  4YAX A;  4A9M A;  5ENG A;  4YYI A;  4NUC A;  5CPE A;  4Z93 A;  2LSP B;  5C85 A;  5DFD A;  4UIZ A;  4UIY A;  2L5E A;  5KTU A;  2OSS A;  5HRW A;  2WP1 A;  5C4Q A;  5FB1 A;  5FE8 A;  5I29 A;  5KTW A;  5F36 A;  3G0J A;  4LYW A;  4UIX A;  4YBT A;  4MEN A;  4QNS A;  5CUA A;  4QSR A;  5A83 A;  4YBS A;  5FE7 A;  4J1P A;  5D24 A;  4IR4 A;  4UYF A;  4YYM A;  4TT2 A;  5FH8 A;  4WHW A;  5CFW A;  5LJ2 A;  4NYX A;  3MQM A;  5IGK A;  4N4I A;  5DLZ A;  2I8N A;  2DKW A;  2YW5 A;  5E9K A;  4AKN A;  4LZR A;  5A5P A;  4ZW1 A;  5L98 A;  1WUG A;  5ENF A;  5IGL A;  4OGJ A;  4QC3 A;  5A7C A;  5A82 A;  5FG6 A;  5F61 A;  5FE9 A;  5FE0 A;  5DKD A;  3SVF A;  4UIW A;  4NRC A;  4O70 A;  5F62 A;  4O7A A;  4YYJ A;  2FSA A;  4A9N A;  4QST A;  3LQI A;  5I80 A;  5CQ5 A;  4HXM A;  4PCE A;  4O72 A;  4NYW A;  3LJW A;  5EWH A;  5DYA A;  5I86 A;  3NXB A;  4XY8 A;  3S92 A;  5LUU A;  5HRX A;  4HXS A;  2E3K A;  4CUQ A;  5D25 A;  4IOO A;  5HLS A;  4WHU A;  4UIT A;  4QYL A;  3P1E A;  5DBM A;  5EPB A;  4E96 A;  4YYG A;  4J0R A;  4Z1Q A;  3I3J A;  5HQ6 A;  3UVY A;  5CS8 A;  4HBY A;  5IG6 A;  3JVM A;  4A9H A;  4Z1S A;  4CLB A;  5FE5 A;  4O7B A;  5BT3 A;  3AAD A;  5KHM A;  5D26 A;  4A9O A;  5FE3 A;  5L96 A;  4TT6 A;  5EQ1 A;  4MEP A;  4TT4 A;  3O34 A;  5FFV A;  5LKZ A;  2E7O A;  4BW1 A;  2RFJ A;  2KTB B;  2DVQ A;  4CFL A;  5CUG A;  3UV5 A;  5DYX A;  5CTL A;  4N3W A;  5II1 A;  5TB6 A;  5IID A;  5K29 A;  3QZS A;  3FKM X;  5FH7 A;  5I40 A;  4GPJ A;  5ENI A;  5ETB A;  4LZS A;  5FH6 A;  2YYN A;  2OO1 A;  2N9G A;  3U5K A;  5LKU A;  4NRA A;  5ETD A;  3S91 A;  3UV4 A;  4QSU A;  4UIU A;  5EGU A;  4QY4 A;  4Z6H A;  1ZS5 A;  4NQN A;  5E3G A;  4TU4 A;  5E0R A;  4YY6 A;  4NR7 A;  2GRC A;  4LC2 A;  2R10 A;  5CUB A;  3P1D A;  4A9I A;  2YEL A;  5FE4 A;  5FB0 A;  5CRM A;  5ENJ A;  5EV9 A;  5D3P A;  5A81 A;  5CP5 A;  2WP2 A;  5E74 A;  5HJC A;  1E6I A;  5C8G A;  4MR5 A;  4YYH A;  4QR3 A;  5F1L A;  5DLX A;  5EU1 A;  4O76 A;  4YYD A;  4HXO A;  5EM3 A;  2YQD A;  5EP7 A;  4IR3 A;  4FLP A;  3HME A;  2F6N A;  2YEM A;  4A9J A;  3O37 A;  3U5L A;  3Q2F A;  5LVR A;  1F68 A;  4NR8 A;  4TZ8 A;  4A9E A;  4QB3 A;  1X0J A;  4Z6I A;  4YYN A;  4XUB A;  5FDZ A;  3MUL A;  4YH4 A;  5D0C A;  4LDF A;  4LYI A;  2H60 A;  3GG3 A;  4O7F A;  5EA1 A;  5I89 A;  3TLP A;  5BT5 A;  5HFQ A;  2RNW A;  5CQ4 A;  5HEL A;  3MB4 A;  5IBN A;  5ENB A;  2L84 A;  5E9M A;  4J3I A;  4MR4 A;  5E3D A;  5CZG A;  4LR6 A;  5A5Q A;  3JVJ A;  4ZC9 A;  2DVR A;  3LQH A;  4CL9 A;  5C87 A;  4QSS A;  5A5N A;  3O36 A;  5J0D A;  4YH3 A;  5CQ8 A;  3SVH A;  4HXP A;  5HEN A;  5EWC A;  2RNX A;  3UVW A;  4KV1 A;  4YAT A;  4QBM A;  4QSW A;  5CUC A;  2MJV B;  5D3L A;  2D82 A;  4TZ2 A;  4IOR A;  4ZQL A;  4LRG A;  5LVQ A;  3UVX A;  4NR9 A;  4LYS A;  5LJ1 A;  4HXR A;  5CUD A;  4O7C A;  5CQ6 A;  5F5Z A;  5I7Y A;  3ONI A;  4YAD A;  4YBM A;  2R0S A;  5A85 A;  3P1F A;  5F25 A;  4XYA A;  4QUT A;  5DW2 A;  4LZ2 A;  4Q0O A;  3IU6 A;  4QSX A;  4Y03 A;  3UW9 A;  5II2 A;  3HMH A;  1JM4 B;  3DWY A;  4CFK A;  4QEU A;  5E9L A;  3P1C A;  4UYH A;  5H85 A;  5L99 A;  3UV2 A;  4HBX A;  2D9E A;  5DYU A;  5I7X A;  3MUK A;  4O78 A;  4C67 A;  4BW4 A;  4UYF B;  5H1U A;  5AD2 A;  4CUT A;  3U5P A;  5COI A;  2E7N A;  4IOQ A; 
#chains in the Genus database with same CATH topology
 5L8U A;  5EWW A;  5E7D A;  4IR6 A;  3U5N A;  5F3A A;  4TU6 A;  5HCL A;  5D3J A;  4O75 A;  5FFY A;  5CQ3 A;  4MEO A;  4RVR A;  4OGI A;  4ALH A;  5I1Q A;  5DFB A;  5HRV A;  4O7E A;  3P5O A;  4QC1 A;  5EVA A;  5FBX A;  5AME A;  5DX4 A;  4NR6 A;  4QR4 A;  3U5M A;  5EPS A;  5D7X A;  2RS9 B;  3RCW A;  4YY4 A;  4MEQ A;  4HXN A;  5L97 A;  4CUR A;  5I83 A;  2RNY A;  5E9Y A;  4NR4 A;  5CQ7 A;  5D3R A;  3LQJ A;  5EK9 A;  5HFR A;  4KV4 A;  5ENC A;  5A5R A;  3U5J A;  5F2P A;  4N4H A;  4O71 A;  4ALG A;  1ZKR A;  4QR5 A;  4UYG A;  5FE1 A;  2NXB A;  1N72 A;  5ENH A;  5FFW A;  2DWW A;  3LXJ A;  2OUO A;  5CRZ A;  4O77 A;  5H1V A;  4PCI A;  5D3N A;  2R0V A;  4Q0N A;  4NYV A;  4HXL A;  3G0L A;  5EWD A;  3DAI A;  5FG4 A;  3IU5 A;  3SVG A;  4A9K A;  3JVK A;  4NS5 A;  4A9F A;  5ACY A;  5CQA A;  4N4G A;  3O35 A;  4BW2 A;  4TQN A;  5LKT A;  2I7K A;  3O33 A;  5DY7 A;  5L8T A;  4PY6 A;  3Q2E A;  4HXK A;  5E73 A;  5FE2 A;  5DYC A;  5DW1 A;  5CY9 A;  5F60 A;  3U5O A;  4YK0 A;  4CUS A;  5KU3 A;  3MXF A;  5CGP A;  5A5S A;  5HM0 A;  4PS5 A;  4QSP A;  4NUE A;  3ZYU A;  5F63 A;  5AMF A;  5I88 A;  2DVV A;  5D3S A;  4QSQ A;  5EWV A;  4MR6 A;  2RI7 A;  4N4F A;  4WIV A;  4XUA A;  5DFC A;  4HBV A;  5F1H A;  2G4A A;  5HQ7 A;  5A5O A;  3D7C A;  3K2J A;  4HBW A;  4NUD A;  4QZS A;  4UIV A;  5D3T A;  3MB3 A;  5G4R A;  4KCX A;  1JSP B;  4IR5 A;  5G4S A;  4YYK A;  4UYE A;  3QZV A;  4OUF A;  4C66 A;  4TS8 A;  4BW3 A;  5FG5 A;  5CQT A;  2YDW A;  4YAB A;  4NRB A;  5KO4 A;  4CUU A;  5HQ5 A;  5IGN A;  5H1T A;  5AD3 A;  5HEM A;  5LJ0 A;  5CUE A;  4J0S A;  5LKX A;  5ENE A;  2DVS A;  3JVL A;  2L85 A;  5DKC A;  3D1D A;  5CU8 A;  4TYL A;  2R0Y A;  4X2I A;  5EIC A;  2F6J A;  4QEV A;  4DON A;  5JI8 A;  4BJX A;  1PUO A;  5IGM A;  3AQA A;  4QUU A;  5E9I A;  5EPR A;  4NQM A;  5C7N A;  5FE6 A;  4QSV A;  1EQF A;  4NXJ A;  4UYD A;  5D3H A;  2RO1 A;  4TTE A;  5EI4 A;  5E9V A;  4F3I A;  4BHW A;  2DAT A;  3UVD A;  2YEK A;  4PKL A;  5KTX A;  4PTB A;  5C89 A;  3HMF A;  4O74 A;  4QEW A;  4QYD A;  4A9L A;  4CUP A;  1WUM A;  3QZT A;  4XY9 A;  4MR3 A;  5EIS A;  5JWM A;  5BT4 A;  5TCM A;  4NR5 A;  5DKH A;  4YC9 A;  4YAX A;  4A9M A;  5ENG A;  4YYI A;  4NUC A;  5CPE A;  4Z93 A;  2LSP B;  5C85 A;  5DFD A;  4UIZ A;  4UIY A;  2L5E A;  5KTU A;  2OSS A;  5HRW A;  2WP1 A;  5C4Q A;  5FB1 A;  5FE8 A;  5I29 A;  5KTW A;  5F36 A;  3G0J A;  4LYW A;  4UIX A;  4YBT A;  4MEN A;  4QNS A;  5CUA A;  4QSR A;  5A83 A;  4YBS A;  5FE7 A;  4J1P A;  5D24 A;  4IR4 A;  4UYF A;  4YYM A;  4TT2 A;  5FH8 A;  4WHW A;  5CFW A;  5LJ2 A;  4NYX A;  3MQM A;  5IGK A;  3ERR A;  4N4I A;  5DLZ A;  2I8N A;  2DKW A;  2YW5 A;  5E9K A;  4AKN A;  4LZR A;  5A5P A;  4ZW1 A;  5L98 A;  1WUG A;  5ENF A;  5IGL A;  4OGJ A;  4QC3 A;  5A7C A;  5A82 A;  5FG6 A;  5F61 A;  5FE9 A;  5FE0 A;  5DKD A;  3SVF A;  4UIW A;  4NRC A;  4O70 A;  5F62 A;  4O7A A;  4YYJ A;  2FSA A;  4A9N A;  4QST A;  3LQI A;  5I80 A;  5CQ5 A;  4HXM A;  4PCE A;  4O72 A;  3VKG A;  4NYW A;  3LJW A;  5EWH A;  5DYA A;  5I86 A;  3NXB A;  4XY8 A;  3S92 A;  5LUU A;  5HRX A;  4AI6 A;  4HXS A;  2E3K A;  4CUQ A;  5D25 A;  4IOO A;  5HLS A;  4AKG A;  4WHU A;  4UIT A;  4QYL A;  3P1E A;  5DBM A;  5EPB A;  4E96 A;  4YYG A;  4J0R A;  4Z1Q A;  3I3J A;  5HQ6 A;  3UVY A;  5CS8 A;  4HBY A;  5IG6 A;  3JVM A;  4A9H A;  4Z1S A;  4CLB A;  5FE5 A;  4O7B A;  5BT3 A;  3AAD A;  5KHM A;  5D26 A;  4A9O A;  5FE3 A;  5L96 A;  4TT6 A;  5EQ1 A;  4MEP A;  4TT4 A;  3O34 A;  3D1B A;  5FFV A;  5LKZ A;  2E7O A;  4BW1 A;  2RFJ A;  2KTB B;  2DVQ A;  4CFL A;  5CUG A;  3UV5 A;  5DYX A;  5CTL A;  4N3W A;  5II1 A;  5TB6 A;  5IID A;  5K29 A;  3QZS A;  3FKM X;  5FH7 A;  5I40 A;  4GPJ A;  5ENI A;  5ETB A;  4LZS A;  5FH6 A;  2YYN A;  2OO1 A;  2N9G A;  3U5K A;  5LKU A;  4NRA A;  5ETD A;  3S91 A;  3UV4 A;  4QSU A;  4UIU A;  5EGU A;  4QY4 A;  4AKI A;  4Z6H A;  1ZS5 A;  4NQN A;  5E3G A;  4TU4 A;  5E0R A;  4YY6 A;  4NR7 A;  2GRC A;  4LC2 A;  2R10 A;  5CUB A;  3P1D A;  4A9I A;  2YEL A;  5FE4 A;  5FB0 A;  5CRM A;  5ENJ A;  5EV9 A;  5D3P A;  5A81 A;  5CP5 A;  2WP2 A;  5E74 A;  5HJC A;  1E6I A;  5C8G A;  4MR5 A;  4YYH A;  4QR3 A;  5F1L A;  5DLX A;  5EU1 A;  4O76 A;  4YYD A;  4HXO A;  5EM3 A;  2YQD A;  5EP7 A;  4IR3 A;  4FLP A;  3HME A;  2F6N A;  2YEM A;  4A9J A;  3O37 A;  3U5L A;  3Q2F A;  5LVR A;  1F68 A;  4NR8 A;  4TZ8 A;  4A9E A;  4QB3 A;  1X0J A;  4Z6I A;  4YYN A;  4XUB A;  5FDZ A;  3MUL A;  4YH4 A;  5D0C A;  4LDF A;  4LYI A;  2H60 A;  3GG3 A;  4O7F A;  5EA1 A;  5I89 A;  3TLP A;  5BT5 A;  5HFQ A;  2RNW A;  5CQ4 A;  5HEL A;  3MB4 A;  5IBN A;  5ENB A;  2L84 A;  5E9M A;  4J3I A;  4MR4 A;  5E3D A;  5CZG A;  4LR6 A;  5A5Q A;  3JVJ A;  4ZC9 A;  2DVR A;  3LQH A;  4CL9 A;  5C87 A;  4QSS A;  5A5N A;  3O36 A;  5J0D A;  4YH3 A;  5CQ8 A;  3SVH A;  4HXP A;  5HEN A;  5EWC A;  3VKH A;  2RNX A;  3UVW A;  4KV1 A;  4YAT A;  4QBM A;  4QSW A;  5CUC A;  2MJV B;  5D3L A;  2D82 A;  4TZ2 A;  4IOR A;  4ZQL A;  4LRG A;  5LVQ A;  3UVX A;  4NR9 A;  4LYS A;  5LJ1 A;  4HXR A;  5CUD A;  4O7C A;  5CQ6 A;  5F5Z A;  5I7Y A;  3ONI A;  4YAD A;  4YBM A;  2R0S A;  5A85 A;  3P1F A;  5F25 A;  4XYA A;  4QUT A;  5DW2 A;  4LZ2 A;  4Q0O A;  3IU6 A;  4QSX A;  4Y03 A;  3UW9 A;  5II2 A;  3HMH A;  1JM4 B;  3DWY A;  4CFK A;  4AKH A;  4QEU A;  5E9L A;  3P1C A;  4UYH A;  5H85 A;  5L99 A;  3UV2 A;  4HBX A;  2D9E A;  5DYU A;  5I7X A;  3MUK A;  2EJN A;  4O78 A;  4C67 A;  4BW4 A;  4UYF B;  5H1U A;  5AD2 A;  4CUT A;  3U5P A;  5COI A;  2E7N A;  4IOQ A; 
#chains in the Genus database with same CATH homology
 5L8U A;  5EWW A;  5E7D A;  4IR6 A;  3U5N A;  5F3A A;  4TU6 A;  5HCL A;  5D3J A;  4O75 A;  5FFY A;  5CQ3 A;  4MEO A;  4RVR A;  4OGI A;  4ALH A;  5I1Q A;  5DFB A;  5HRV A;  4O7E A;  3P5O A;  4QC1 A;  5EVA A;  5FBX A;  5AME A;  5DX4 A;  4NR6 A;  4QR4 A;  3U5M A;  5EPS A;  5D7X A;  2RS9 B;  3RCW A;  4YY4 A;  4MEQ A;  4HXN A;  5L97 A;  4CUR A;  5I83 A;  2RNY A;  5E9Y A;  4NR4 A;  5CQ7 A;  5D3R A;  3LQJ A;  5EK9 A;  5HFR A;  4KV4 A;  5ENC A;  5A5R A;  3U5J A;  5F2P A;  4N4H A;  4O71 A;  4ALG A;  4QR5 A;  4UYG A;  5FE1 A;  2NXB A;  1N72 A;  5ENH A;  5FFW A;  2DWW A;  3LXJ A;  2OUO A;  5CRZ A;  4O77 A;  5H1V A;  4PCI A;  5D3N A;  2R0V A;  4Q0N A;  4NYV A;  4HXL A;  3G0L A;  5EWD A;  3DAI A;  5FG4 A;  3IU5 A;  3SVG A;  4A9K A;  3JVK A;  4NS5 A;  4A9F A;  5ACY A;  5CQA A;  4N4G A;  3O35 A;  4BW2 A;  4TQN A;  5LKT A;  2I7K A;  3O33 A;  5DY7 A;  5L8T A;  4PY6 A;  3Q2E A;  4HXK A;  5E73 A;  5FE2 A;  5DYC A;  5DW1 A;  5CY9 A;  5F60 A;  3U5O A;  4YK0 A;  4CUS A;  5KU3 A;  3MXF A;  5CGP A;  5A5S A;  5HM0 A;  4PS5 A;  4QSP A;  4NUE A;  3ZYU A;  5F63 A;  5AMF A;  5I88 A;  2DVV A;  5D3S A;  4QSQ A;  5EWV A;  4MR6 A;  2RI7 A;  4N4F A;  4WIV A;  4XUA A;  5DFC A;  4HBV A;  5F1H A;  2G4A A;  5HQ7 A;  5A5O A;  3D7C A;  3K2J A;  4HBW A;  4NUD A;  4QZS A;  4UIV A;  5D3T A;  3MB3 A;  5G4R A;  4KCX A;  1JSP B;  4IR5 A;  5G4S A;  4YYK A;  4UYE A;  3QZV A;  4OUF A;  4C66 A;  4TS8 A;  4BW3 A;  5FG5 A;  5CQT A;  2YDW A;  4YAB A;  4NRB A;  5KO4 A;  4CUU A;  5HQ5 A;  5IGN A;  5H1T A;  5AD3 A;  5HEM A;  5LJ0 A;  5CUE A;  4J0S A;  5LKX A;  5ENE A;  2DVS A;  3JVL A;  2L85 A;  5DKC A;  5CU8 A;  4TYL A;  2R0Y A;  4X2I A;  5EIC A;  2F6J A;  4QEV A;  4DON A;  5JI8 A;  4BJX A;  5IGM A;  3AQA A;  4QUU A;  5E9I A;  5EPR A;  4NQM A;  5C7N A;  5FE6 A;  4QSV A;  1EQF A;  4NXJ A;  4UYD A;  5D3H A;  2RO1 A;  4TTE A;  5EI4 A;  5E9V A;  4F3I A;  4BHW A;  2DAT A;  3UVD A;  2YEK A;  4PKL A;  5KTX A;  4PTB A;  5C89 A;  3HMF A;  4O74 A;  4QEW A;  4QYD A;  4A9L A;  4CUP A;  1WUM A;  3QZT A;  4XY9 A;  4MR3 A;  5EIS A;  5JWM A;  5BT4 A;  5TCM A;  4NR5 A;  5DKH A;  4YC9 A;  4YAX A;  4A9M A;  5ENG A;  4YYI A;  4NUC A;  5CPE A;  4Z93 A;  2LSP B;  5C85 A;  5DFD A;  4UIZ A;  4UIY A;  2L5E A;  5KTU A;  2OSS A;  5HRW A;  2WP1 A;  5C4Q A;  5FB1 A;  5FE8 A;  5I29 A;  5KTW A;  5F36 A;  3G0J A;  4LYW A;  4UIX A;  4YBT A;  4MEN A;  4QNS A;  5CUA A;  4QSR A;  5A83 A;  4YBS A;  5FE7 A;  4J1P A;  5D24 A;  4IR4 A;  4UYF A;  4YYM A;  4TT2 A;  5FH8 A;  4WHW A;  5CFW A;  5LJ2 A;  4NYX A;  3MQM A;  5IGK A;  4N4I A;  5DLZ A;  2I8N A;  2DKW A;  2YW5 A;  5E9K A;  4AKN A;  4LZR A;  5A5P A;  4ZW1 A;  5L98 A;  1WUG A;  5ENF A;  5IGL A;  4OGJ A;  4QC3 A;  5A7C A;  5A82 A;  5FG6 A;  5F61 A;  5FE9 A;  5FE0 A;  5DKD A;  3SVF A;  4UIW A;  4NRC A;  4O70 A;  5F62 A;  4O7A A;  4YYJ A;  2FSA A;  4A9N A;  4QST A;  3LQI A;  5I80 A;  5CQ5 A;  4HXM A;  4PCE A;  4O72 A;  4NYW A;  3LJW A;  5EWH A;  5DYA A;  5I86 A;  3NXB A;  4XY8 A;  3S92 A;  5LUU A;  5HRX A;  4HXS A;  2E3K A;  4CUQ A;  5D25 A;  4IOO A;  5HLS A;  4WHU A;  4UIT A;  4QYL A;  3P1E A;  5DBM A;  5EPB A;  4E96 A;  4YYG A;  4J0R A;  4Z1Q A;  3I3J A;  5HQ6 A;  3UVY A;  5CS8 A;  4HBY A;  5IG6 A;  3JVM A;  4A9H A;  4Z1S A;  4CLB A;  5FE5 A;  4O7B A;  5BT3 A;  3AAD A;  5KHM A;  5D26 A;  4A9O A;  5FE3 A;  5L96 A;  4TT6 A;  5EQ1 A;  4MEP A;  4TT4 A;  3O34 A;  5FFV A;  5LKZ A;  2E7O A;  4BW1 A;  2RFJ A;  2KTB B;  2DVQ A;  4CFL A;  5CUG A;  3UV5 A;  5DYX A;  5CTL A;  4N3W A;  5II1 A;  5TB6 A;  5IID A;  5K29 A;  3QZS A;  3FKM X;  5FH7 A;  5I40 A;  4GPJ A;  5ENI A;  5ETB A;  4LZS A;  5FH6 A;  2YYN A;  2OO1 A;  2N9G A;  3U5K A;  5LKU A;  4NRA A;  5ETD A;  3S91 A;  3UV4 A;  4QSU A;  4UIU A;  5EGU A;  4QY4 A;  4Z6H A;  1ZS5 A;  4NQN A;  5E3G A;  4TU4 A;  5E0R A;  4YY6 A;  4NR7 A;  2GRC A;  4LC2 A;  2R10 A;  5CUB A;  3P1D A;  4A9I A;  2YEL A;  5FE4 A;  5FB0 A;  5CRM A;  5ENJ A;  5EV9 A;  5D3P A;  5A81 A;  5CP5 A;  2WP2 A;  5E74 A;  5HJC A;  1E6I A;  5C8G A;  4MR5 A;  4YYH A;  4QR3 A;  5F1L A;  5DLX A;  5EU1 A;  4O76 A;  4YYD A;  4HXO A;  5EM3 A;  2YQD A;  5EP7 A;  4IR3 A;  4FLP A;  3HME A;  2F6N A;  2YEM A;  4A9J A;  3O37 A;  3U5L A;  3Q2F A;  5LVR A;  1F68 A;  4NR8 A;  4TZ8 A;  4A9E A;  4QB3 A;  1X0J A;  4Z6I A;  4YYN A;  4XUB A;  5FDZ A;  3MUL A;  4YH4 A;  5D0C A;  4LDF A;  4LYI A;  2H60 A;  3GG3 A;  4O7F A;  5EA1 A;  5I89 A;  3TLP A;  5BT5 A;  5HFQ A;  2RNW A;  5CQ4 A;  5HEL A;  3MB4 A;  5IBN A;  5ENB A;  2L84 A;  5E9M A;  4J3I A;  4MR4 A;  5E3D A;  5CZG A;  4LR6 A;  5A5Q A;  3JVJ A;  4ZC9 A;  2DVR A;  3LQH A;  4CL9 A;  5C87 A;  4QSS A;  5A5N A;  3O36 A;  5J0D A;  4YH3 A;  5CQ8 A;  3SVH A;  4HXP A;  5HEN A;  5EWC A;  2RNX A;  3UVW A;  4KV1 A;  4YAT A;  4QBM A;  4QSW A;  5CUC A;  2MJV B;  5D3L A;  2D82 A;  4TZ2 A;  4IOR A;  4ZQL A;  4LRG A;  5LVQ A;  3UVX A;  4NR9 A;  4LYS A;  5LJ1 A;  4HXR A;  5CUD A;  4O7C A;  5CQ6 A;  5F5Z A;  5I7Y A;  3ONI A;  4YAD A;  4YBM A;  2R0S A;  5A85 A;  3P1F A;  5F25 A;  4XYA A;  4QUT A;  5DW2 A;  4LZ2 A;  4Q0O A;  3IU6 A;  4QSX A;  4Y03 A;  3UW9 A;  5II2 A;  3HMH A;  1JM4 B;  3DWY A;  4CFK A;  4QEU A;  5E9L A;  3P1C A;  4UYH A;  5H85 A;  5L99 A;  3UV2 A;  4HBX A;  2D9E A;  5DYU A;  5I7X A;  3MUK A;  4O78 A;  4C67 A;  4BW4 A;  4UYF B;  5H1U A;  5AD2 A;  4CUT A;  3U5P A;  5COI A;  2E7N A;  4IOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...