5ENEA

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with 5-amino-2-benzyl-1,3-oxazole-4-carbonitrile (sgc - diamond i04-1 fragment screening)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PH-interacting protein
publication title A poised fragment library enables rapid synthetic expansion yielding the first reported inhibitors of PHIP(2), an atypical bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5eneA00
4NR7A 5F63A 4YBTA 2RNYA 4HBYA 2DWWA 3D7CA 5LVRA 5BT4A 4A9OA 4WHUA 3FKMX 5HRWA 2DATA 4O77A 2R0VA 4IORA 4PTBA 5A82A 5D3PA 4XUAA 4YYGA 2I7KA 3P1DA 5C8GA 2DVSA 4PCIA 5A7CA 5CQ4A 4CUTA 4QSQA 4QSWA 4HXSA 4NRAA 5LJ0A 5D3JA 4TT6A 3MQMA 2OSSA 4ALHA 3S91A 4LYWA 5H1VA 4YYIA 5E7DA 4J0SA 5EWWA 5FFWA 4BJXA 5HENA 3U5OA 3O33A 5FH8A 5I1QA 5EPBA 3P5OA 4UIVA 4YYKA 5TB6A 3QZSA 4LZSA 5HRVA 3LQHA 3GG3A 5JI8A 4HBWA 5CUBA 4PY6A 5CZGA 4QNSA 4LDFA 4Z1QA 5EWCA 4O74A 5CGPA 5L8UA 3AADA 4BW3A 5FE9A 4MEQA 4QUTA 5DLXA 1WUGA 5LVQA 3I3JA 5D3TA 4CUUA 1JSPB 4HXKA 2E3KA 5H1TA 3Q2FA 5I7YA 5EWDA 4X2IA 5IGKA 3O36A 4CUQA 2R10A 3U5KA 5CS8A 3MB4A 4UYHA 5I29A 3U5NA 4TU6A 2DVVA 4N4FA 5CQTA 3K2JA 4O7AA 2RS9B 4QSXA 4HXNA 5ACYA 5F36A 4YY6A 5AD3A 4QSSA 5E9YA 4NR9A 3MB3A 5CQ7A 4MEPA 4OGIA 4TT2A 5LJ2A 3SVHA 4IR4A 4N4HA 2I8NA 5ENCA 5ENIA 4N4GA 5F62A 5I88A 4UYGA 3IU6A 2H60A 5CU8A 5E0RA 3LQJA 4HXMA 5F3AA 5KU3A 5K29A 4TZ8A 4YH3A 4E96A 3U5PA 4QC1A 4A9IA 4A9EA 5A5RA 1F68A 4IOQA 3P1FA 4CFLA 5DYXA 5II2A 3P1EA 5DY7A 4NRCA 4NYVA 4XUBA 4XYAA 5IGMA 3TLPA 4IR3A 5A5PA 5EV9A 5C87A 4LRGA 4MR3A 5HCLA 3MXFA 5E9IA 4MR5A 4IR6A 5IBNA 4Y03A 5EU1A 3U5LA 5CFWA 4QEUA 4A9MA 4QYDA 5D25A 4CFKA 2OO1A 5D3LA 4QZSA 3UVYA 5LKXA 4NR6A 3UVWA 5F61A 4QSUA 4KV1A 5COIA 4A9JA 1JM4B 4UYEA 4F3IA 5BT5A 4J0RA 5F60A 4QY4A 4LR6A 2F6NA 2E7NA 2OUOA 5EISA 4IR5A 3LQIA 5E74A 2D82A 4HBXA 4Q0OA 5I7XA 2L84A 4NUEA 5D3RA 5C7NA 4YATA 4UIYA 5LJ1A 4HXOA 4O78A 5F1LA 2DVRA 2YEKA 4QR4A 4IOOA 4CL9A 4QYLA 5CQ6A 5KTXA 4OUFA 2WP1A 5E3DA 5EICA 4UYDA 5EQ1A 5FG6A 4YH4A 4NQNA 3SVFA 5D26A 4ALGA 5TCMA 5DFCA 2GRCA 5DYAA 3JVLA 4ZC9A 5L96A 4LZRA 4J1PA 4UYFB 4O7EA 2N9GA 2R0SA 5KTWA 5CPEA 5HQ7A 5A5SA 5LKZA 5F25A 5HM0A 2L85A 4LC2A 5I86A 5L99A 4A9LA 4KCXA 5CUCA 3HMEA 4BHWA 3P1CA 4HXPA 5ENHA 2WP2A 4A9NA 4QR3A 5DBMA 4WIVA 4N4IA 5DW2A 5EP7A 5C85A 5A83A 4O7BA 2YW5A 5E9VA 5CQ5A 4NR8A 4CUSA 5FH7A 5FE6A 5CY9A 5IIDA 5FE2A 5F2PA 4HXLA 5A5OA 5EPRA 5HLSA 4QSVA 2R0YA 5DFBA 5EA1A 5I40A 5ETDA 2G4AA 2YYNA 5A5QA 5LKUA 5CTLA 4LYIA 3HMHA 4RVRA 2FSAA 5DKDA 4YBSA 4QBMA 4YABA 4Q0NA 5E3GA 4Z93A 4O7FA 5EVAA 2RFJA 4LYSA 5IG6A 5J0DA 3UW9A 3JVMA 4UIWA 5H1UA 4QEWA 4C66A 2L5EA 4UIUA 3O37A 5ETBA 5FFYA 5FE7A 4BW2A 4TS8A 5HJCA 4J3IA 4PKLA 2NXBA 4YAXA 3U5JA 5E9MA 2RNWA 4NR5A 3UV4A 5HFQA 5KHMA 5CUDA 5AMFA 5HELA 4QSTA 1X0JA 5DKHA 4QC3A 5ENGA 5FE1A 3RCWA 5D3HA 5LKTA 1EQFA 3QZVA 4QUUA 3HMFA 5E9KA 4NXJA 5F5ZA 1WUMA 5FFVA 5DYUA 5L8TA 4FLPA 5CQ3A 5A85A 2KTBB 3LJWA 5II1A 5C89A 3UVXA 5EPSA 4MR6A 5LUUA 2F6JA 5ENBA 3ZYUA 5FH6A 5CUEA 5FE0A 2LSPB 4QSRA 3QZTA 2RI7A 4TU4A 4NQMA 5JWMA 3O34A 5HQ6A 5L97A 4CURA 4MR4A 3O35A 4Z6IA 5IGLA 5ENEA 4TQNA 5FBXA 4NYXA 4QR5A 4A9HA 3AQAA 4YK0A 4YBMA 5E73A 4PCEA 5D24A 4PS5A 3NXBA 5CRMA 4C67A 5FE8A 3Q2EA 5IGNA 3DWYA 4O76A 5EM3A 2MJVB 5C4QA 4BW1A 3UV2A 2DVQA 5D7XA 5I80A 5EWVA 4TT4A 4TTEA 5HRXA 5I89A 5DLZA 5FB0A 4NUCA 4NRBA 3ONIA 5D3NA 1N72A 4UIXA 5DX4A 4NR4A 4NYWA 4NUDA 5CRZA 2D9EA 2RO1A 3MULA 3UVDA 5L98A 5EI4A 4KV4A 3DAIA 4CUPA 2YELA 5DW1A 4O75A 4O72A 5DYCA 5E9LA 4YY4A 4ZW1A 3G0JA 4A9KA 4MEOA 3G0LA 5KTUA 4TYLA 4UYFA 4QSPA 4XY9A 4N3WA 4UIZA 3SVGA 5EWHA 4NS5A 5CQAA 5FE3A 5H85A 4ZQLA 5FDZA 3JVKA 4GPJA 3LXJA 2DKWA 4LZ2A 4TZ2A 4DONA 3MUKA 5FG4A 2RNXA 4YADA 5BT3A 3UV5A 5AMEA 4YYDA 1E6IA 5ENFA 3S92A 5HEMA 5ENJA 5KO4A 5D0CA 4MENA 4QB3A 1ZS5A 4XY8A 5G4RA 5G4SA 4YYHA 4Z1SA 5EK9A 5CQ8A 4HBVA 5A81A 3IU5A 5D3SA 5FG5A 4WHWA 2YQDA 4UITA 3JVJA 5HQ5A 5CUAA 4YYNA 5A5NA 4O7CA 4YC9A 2YEMA 2E7OA 4A9FA 5FE5A 5CP5A 4CLBA 5I83A 4O70A 4OGJA 4HXRA 5DFDA 5EGUA 4QEVA 4YYJA 5AD2A 4Z6HA 4BW4A 5FB1A 3U5MA 5FE4A 2YDWA 5CUGA 5F1HA 4YYMA 4AKNA 4O71A 5DKCA 5HFRA
chains in the Genus database with same CATH superfamily
4NR7A 5F63A 4YBTA 2RNYA 4HBYA 2DWWA 3D7CA 5LVRA 5BT4A 4A9OA 4WHUA 3FKMX 5HRWA 2DATA 4O77A 2R0VA 4IORA 4PTBA 5A82A 5D3PA 4XUAA 4YYGA 2I7KA 3VKHA 3P1DA 5C8GA 2DVSA 4PCIA 5A7CA 5CQ4A 4CUTA 4QSQA 4QSWA 4HXSA 4NRAA 5LJ0A 5D3JA 4TT6A 3MQMA 2OSSA 4ALHA 3S91A 4LYWA 5H1VA 4YYIA 5E7DA 4J0SA 5EWWA 5FFWA 4BJXA 5HENA 3U5OA 3O33A 5FH8A 5I1QA 5EPBA 3P5OA 4UIVA 4YYKA 5TB6A 3QZSA 4LZSA 5HRVA 3LQHA 3GG3A 5JI8A 4HBWA 5CUBA 4PY6A 5CZGA 4QNSA 4LDFA 4Z1QA 5EWCA 4O74A 5CGPA 5L8UA 3AADA 4BW3A 5FE9A 4MEQA 4QUTA 5DLXA 1WUGA 5LVQA 3I3JA 5D3TA 4CUUA 1JSPB 4HXKA 2E3KA 5H1TA 3Q2FA 5I7YA 5EWDA 4X2IA 5IGKA 3O36A 4CUQA 2R10A 3U5KA 5CS8A 3MB4A 4UYHA 5I29A 3U5NA 4TU6A 2DVVA 4N4FA 5CQTA 3K2JA 4O7AA 2RS9B 4QSXA 4HXNA 5ACYA 5F36A 4YY6A 5AD3A 4QSSA 5E9YA 4NR9A 3MB3A 5CQ7A 4MEPA 4OGIA 4TT2A 5LJ2A 3SVHA 4IR4A 4N4HA 2I8NA 5ENCA 5ENIA 4N4GA 5F62A 5I88A 4UYGA 3IU6A 2H60A 5CU8A 5E0RA 3LQJA 4HXMA 5F3AA 5KU3A 5K29A 4TZ8A 4YH3A 4E96A 3U5PA 4QC1A 4A9IA 4A9EA 5A5RA 1F68A 4IOQA 3P1FA 4CFLA 5DYXA 5II2A 3P1EA 5DY7A 4NRCA 4NYVA 4XUBA 4XYAA 5IGMA 3TLPA 4IR3A 5A5PA 5EV9A 5C87A 4LRGA 4MR3A 5HCLA 3MXFA 5E9IA 4MR5A 4IR6A 5IBNA 4Y03A 5EU1A 3U5LA 5CFWA 4QEUA 4A9MA 4QYDA 5D25A 4CFKA 2OO1A 5D3LA 4QZSA 3UVYA 5LKXA 4NR6A 3UVWA 5F61A 4AKGA 4QSUA 4KV1A 5COIA 4A9JA 1JM4B 4UYEA 4F3IA 5BT5A 4J0RA 5F60A 4QY4A 4LR6A 2F6NA 2E7NA 2OUOA 5EISA 4IR5A 3LQIA 5E74A 2D82A 4HBXA 4Q0OA 5I7XA 2L84A 4NUEA 5D3RA 5C7NA 4YATA 4UIYA 5LJ1A 4HXOA 4O78A 5F1LA 2DVRA 2YEKA 4QR4A 4IOOA 4CL9A 4QYLA 5CQ6A 5KTXA 4OUFA 2WP1A 5E3DA 5EICA 4UYDA 5EQ1A 5FG6A 4YH4A 4NQNA 3SVFA 5D26A 4ALGA 5TCMA 5DFCA 2GRCA 5DYAA 3JVLA 4ZC9A 5L96A 4LZRA 3ERRA 4J1PA 4UYFB 4O7EA 2N9GA 2R0SA 5KTWA 5CPEA 5HQ7A 5A5SA 5LKZA 5F25A 5HM0A 2L85A 4LC2A 5I86A 5L99A 4A9LA 4KCXA 5CUCA 3HMEA 4BHWA 3P1CA 4HXPA 5ENHA 2WP2A 4A9NA 4QR3A 5DBMA 4WIVA 4N4IA 5DW2A 5EP7A 5C85A 5A83A 4O7BA 2YW5A 5E9VA 5CQ5A 4NR8A 4CUSA 5FH7A 5FE6A 5CY9A 5IIDA 5FE2A 5F2PA 4HXLA 3D1BA 5A5OA 5EPRA 5HLSA 4QSVA 2R0YA 5DFBA 5EA1A 5I40A 5ETDA 2G4AA 2YYNA 5A5QA 5LKUA 5CTLA 4LYIA 3HMHA 4RVRA 2FSAA 5DKDA 4YBSA 4QBMA 4YABA 4Q0NA 5E3GA 4Z93A 4O7FA 5EVAA 1ZKRA 2RFJA 4LYSA 5IG6A 5J0DA 3UW9A 3JVMA 4UIWA 5H1UA 4QEWA 4C66A 2L5EA 4UIUA 3O37A 5ETBA 5FFYA 5FE7A 4BW2A 4TS8A 5HJCA 4J3IA 4PKLA 2NXBA 4YAXA 3U5JA 5E9MA 2RNWA 4NR5A 3UV4A 1PUOA 5HFQA 5KHMA 5CUDA 5AMFA 5HELA 4QSTA 1X0JA 5DKHA 4QC3A 5ENGA 5FE1A 4AKIA 3RCWA 5D3HA 5LKTA 1EQFA 3QZVA 4QUUA 3HMFA 3D1DA 5E9KA 4NXJA 5F5ZA 1WUMA 5FFVA 5DYUA 5L8TA 4FLPA 5CQ3A 5A85A 2KTBB 3LJWA 5II1A 5C89A 3UVXA 5EPSA 4MR6A 5LUUA 2F6JA 5ENBA 3ZYUA 5FH6A 5CUEA 5FE0A 2LSPB 4QSRA 3QZTA 2RI7A 4TU4A 4NQMA 5JWMA 3O34A 5HQ6A 5L97A 4CURA 4MR4A 3O35A 4Z6IA 5IGLA 5ENEA 4TQNA 5FBXA 4NYXA 4QR5A 4A9HA 3AQAA 4YK0A 4YBMA 5E73A 4PCEA 5D24A 4PS5A 3NXBA 5CRMA 4C67A 5FE8A 3Q2EA 5IGNA 3DWYA 4O76A 5EM3A 2MJVB 5C4QA 4BW1A 3UV2A 2DVQA 5D7XA 5I80A 5EWVA 4TT4A 4AI6A 4TTEA 5HRXA 5I89A 5DLZA 5FB0A 4NUCA 4NRBA 3ONIA 5D3NA 1N72A 2EJNA 4UIXA 5DX4A 4NR4A 4NYWA 4NUDA 5CRZA 2D9EA 2RO1A 3MULA 3UVDA 5L98A 5EI4A 4KV4A 3DAIA 4CUPA 2YELA 5DW1A 4O75A 4O72A 5DYCA 5E9LA 4YY4A 4ZW1A 3G0JA 4A9KA 4MEOA 3G0LA 5KTUA 4TYLA 4UYFA 4QSPA 4XY9A 4N3WA 4UIZA 3SVGA 5EWHA 4NS5A 5CQAA 5FE3A 5H85A 4ZQLA 5FDZA 3JVKA 4GPJA 3LXJA 2DKWA 4LZ2A 4TZ2A 4DONA 3MUKA 5FG4A 2RNXA 3VKGA 4YADA 5BT3A 3UV5A 5AMEA 4YYDA 1E6IA 5ENFA 3S92A 5HEMA 5ENJA 5KO4A 5D0CA 4MENA 4QB3A 1ZS5A 4XY8A 4AKHA 5G4RA 5G4SA 4YYHA 4Z1SA 5EK9A 5CQ8A 4HBVA 5A81A 3IU5A 5D3SA 5FG5A 4WHWA 2YQDA 4UITA 3JVJA 5HQ5A 5CUAA 4YYNA 5A5NA 4O7CA 4YC9A 2YEMA 2E7OA 4A9FA 5FE5A 5CP5A 4CLBA 5I83A 4O70A 4OGJA 4HXRA 5DFDA 5EGUA 4QEVA 4YYJA 5AD2A 4Z6HA 4BW4A 5FB1A 3U5MA 5FE4A 2YDWA 5CUGA 5F1HA 4YYMA 4AKNA 4O71A 5DKCA 5HFRA
chains in the Genus database with same CATH topology
4NR7A 5F63A 4YBTA 2RNYA 4HBYA 2DWWA 3D7CA 5LVRA 5BT4A 4A9OA 4WHUA 3FKMX 5HRWA 2DATA 4O77A 2R0VA 4IORA 4PTBA 5A82A 5D3PA 4XUAA 4YYGA 2I7KA 3P1DA 5C8GA 2DVSA 4PCIA 5A7CA 5CQ4A 4CUTA 4QSQA 4QSWA 4HXSA 4NRAA 5LJ0A 5D3JA 4TT6A 3MQMA 2OSSA 4ALHA 3S91A 4LYWA 5H1VA 4YYIA 5E7DA 4J0SA 5EWWA 5FFWA 4BJXA 5HENA 3U5OA 3O33A 5FH8A 5I1QA 5EPBA 3P5OA 4UIVA 4YYKA 5TB6A 3QZSA 4LZSA 5HRVA 3LQHA 3GG3A 5JI8A 4HBWA 5CUBA 4PY6A 5CZGA 4QNSA 4LDFA 4Z1QA 5EWCA 4O74A 5CGPA 5L8UA 3AADA 4BW3A 5FE9A 4MEQA 4QUTA 5DLXA 1WUGA 5LVQA 3I3JA 5D3TA 4CUUA 1JSPB 4HXKA 2E3KA 5H1TA 3Q2FA 5I7YA 5EWDA 4X2IA 5IGKA 3O36A 4CUQA 2R10A 3U5KA 5CS8A 3MB4A 4UYHA 5I29A 3U5NA 4TU6A 2DVVA 4N4FA 5CQTA 3K2JA 4O7AA 2RS9B 4QSXA 4HXNA 5ACYA 5F36A 4YY6A 5AD3A 4QSSA 5E9YA 4NR9A 3MB3A 5CQ7A 4MEPA 4OGIA 4TT2A 5LJ2A 3SVHA 4IR4A 4N4HA 2I8NA 5ENCA 5ENIA 4N4GA 5F62A 5I88A 4UYGA 3IU6A 2H60A 5CU8A 5E0RA 3LQJA 4HXMA 5F3AA 5KU3A 5K29A 4TZ8A 4YH3A 4E96A 3U5PA 4QC1A 4A9IA 4A9EA 5A5RA 1F68A 4IOQA 3P1FA 4CFLA 5DYXA 5II2A 3P1EA 5DY7A 4NRCA 4NYVA 4XUBA 4XYAA 5IGMA 3TLPA 4IR3A 5A5PA 5EV9A 5C87A 4LRGA 4MR3A 5HCLA 3MXFA 5E9IA 4MR5A 4IR6A 5IBNA 4Y03A 5EU1A 3U5LA 5CFWA 4QEUA 4A9MA 4QYDA 5D25A 4CFKA 2OO1A 5D3LA 4QZSA 3UVYA 5LKXA 4NR6A 3UVWA 5F61A 4QSUA 4KV1A 5COIA 4A9JA 1JM4B 4UYEA 4F3IA 5BT5A 4J0RA 5F60A 4QY4A 4LR6A 2F6NA 2E7NA 2OUOA 5EISA 4IR5A 3LQIA 5E74A 2D82A 4HBXA 4Q0OA 5I7XA 2L84A 4NUEA 5D3RA 5C7NA 4YATA 4UIYA 5LJ1A 4HXOA 4O78A 5F1LA 2DVRA 2YEKA 4QR4A 4IOOA 4CL9A 4QYLA 5CQ6A 5KTXA 4OUFA 2WP1A 5E3DA 5EICA 4UYDA 5EQ1A 5FG6A 4YH4A 4NQNA 3SVFA 5D26A 4ALGA 5TCMA 5DFCA 2GRCA 5DYAA 3JVLA 4ZC9A 5L96A 4LZRA 4J1PA 4UYFB 4O7EA 2N9GA 2R0SA 5KTWA 5CPEA 5HQ7A 5A5SA 5LKZA 5F25A 5HM0A 2L85A 4LC2A 5I86A 5L99A 4A9LA 4KCXA 5CUCA 3HMEA 4BHWA 3P1CA 4HXPA 5ENHA 2WP2A 4A9NA 4QR3A 5DBMA 4WIVA 4N4IA 5DW2A 5EP7A 5C85A 5A83A 4O7BA 2YW5A 5E9VA 5CQ5A 4NR8A 4CUSA 5FH7A 5FE6A 5CY9A 5IIDA 5FE2A 5F2PA 4HXLA 5A5OA 5EPRA 5HLSA 4QSVA 2R0YA 5DFBA 5EA1A 5I40A 5ETDA 2G4AA 2YYNA 5A5QA 5LKUA 5CTLA 4LYIA 3HMHA 4RVRA 2FSAA 5DKDA 4YBSA 4QBMA 4YABA 4Q0NA 5E3GA 4Z93A 4O7FA 5EVAA 2RFJA 4LYSA 5IG6A 5J0DA 3UW9A 3JVMA 4UIWA 5H1UA 4QEWA 4C66A 2L5EA 4UIUA 3O37A 5ETBA 5FFYA 5FE7A 4BW2A 4TS8A 5HJCA 4J3IA 4PKLA 2NXBA 4YAXA 3U5JA 5E9MA 2RNWA 4NR5A 3UV4A 5HFQA 5KHMA 5CUDA 5AMFA 5HELA 4QSTA 1X0JA 5DKHA 4QC3A 5ENGA 5FE1A 3RCWA 5D3HA 5LKTA 1EQFA 3QZVA 4QUUA 3HMFA 5E9KA 4NXJA 5F5ZA 1WUMA 5FFVA 5DYUA 5L8TA 4FLPA 5CQ3A 5A85A 2KTBB 3LJWA 5II1A 5C89A 3UVXA 5EPSA 4MR6A 5LUUA 2F6JA 5ENBA 3ZYUA 5FH6A 5CUEA 5FE0A 2LSPB 4QSRA 3QZTA 2RI7A 4TU4A 4NQMA 5JWMA 3O34A 5HQ6A 5L97A 4CURA 4MR4A 3O35A 4Z6IA 5IGLA 5ENEA 4TQNA 5FBXA 4NYXA 4QR5A 4A9HA 3AQAA 4YK0A 4YBMA 5E73A 4PCEA 5D24A 4PS5A 3NXBA 5CRMA 4C67A 5FE8A 3Q2EA 5IGNA 3DWYA 4O76A 5EM3A 2MJVB 5C4QA 4BW1A 3UV2A 2DVQA 5D7XA 5I80A 5EWVA 4TT4A 4TTEA 5HRXA 5I89A 5DLZA 5FB0A 4NUCA 4NRBA 3ONIA 5D3NA 1N72A 4UIXA 5DX4A 4NR4A 4NYWA 4NUDA 5CRZA 2D9EA 2RO1A 3MULA 3UVDA 5L98A 5EI4A 4KV4A 3DAIA 4CUPA 2YELA 5DW1A 4O75A 4O72A 5DYCA 5E9LA 4YY4A 4ZW1A 3G0JA 4A9KA 4MEOA 3G0LA 5KTUA 4TYLA 4UYFA 4QSPA 4XY9A 4N3WA 4UIZA 3SVGA 5EWHA 4NS5A 5CQAA 5FE3A 5H85A 4ZQLA 5FDZA 3JVKA 4GPJA 3LXJA 2DKWA 4LZ2A 4TZ2A 4DONA 3MUKA 5FG4A 2RNXA 4YADA 5BT3A 3UV5A 5AMEA 4YYDA 1E6IA 5ENFA 3S92A 5HEMA 5ENJA 5KO4A 5D0CA 4MENA 4QB3A 1ZS5A 4XY8A 5G4RA 5G4SA 4YYHA 4Z1SA 5EK9A 5CQ8A 4HBVA 5A81A 3IU5A 5D3SA 5FG5A 4WHWA 2YQDA 4UITA 3JVJA 5HQ5A 5CUAA 4YYNA 5A5NA 4O7CA 4YC9A 2YEMA 2E7OA 4A9FA 5FE5A 5CP5A 4CLBA 5I83A 4O70A 4OGJA 4HXRA 5DFDA 5EGUA 4QEVA 4YYJA 5AD2A 4Z6HA 4BW4A 5FB1A 3U5MA 5FE4A 2YDWA 5CUGA 5F1HA 4YYMA 4AKNA 4O71A 5DKCA 5HFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NR7 A;  5F63 A;  4YBT A;  2RNY A;  4HBY A;  2DWW A;  3D7C A;  5LVR A;  5BT4 A;  4A9O A;  4WHU A;  3FKM X;  5HRW A;  2DAT A;  4O77 A;  2R0V A;  4IOR A;  4PTB A;  5A82 A;  5D3P A;  4XUA A;  4YYG A;  2I7K A;  3P1D A;  5C8G A;  2DVS A;  4PCI A;  5A7C A;  5CQ4 A;  4CUT A;  4QSQ A;  4QSW A;  4HXS A;  4NRA A;  5LJ0 A;  5D3J A;  4TT6 A;  3MQM A;  2OSS A;  4ALH A;  3S91 A;  4LYW A;  5H1V A;  4YYI A;  5E7D A;  4J0S A;  5EWW A;  5FFW A;  4BJX A;  5HEN A;  3U5O A;  3O33 A;  5FH8 A;  5I1Q A;  5EPB A;  3P5O A;  4UIV A;  4YYK A;  5TB6 A;  3QZS A;  4LZS A;  5HRV A;  3LQH A;  3GG3 A;  5JI8 A;  4HBW A;  5CUB A;  4PY6 A;  5CZG A;  4QNS A;  4LDF A;  4Z1Q A;  5EWC A;  4O74 A;  5CGP A;  5L8U A;  3AAD A;  4BW3 A;  5FE9 A;  4MEQ A;  4QUT A;  5DLX A;  1WUG A;  5LVQ A;  3I3J A;  5D3T A;  4CUU A;  1JSP B;  4HXK A;  2E3K A;  5H1T A;  3Q2F A;  5I7Y A;  5EWD A;  4X2I A;  5IGK A;  3O36 A;  4CUQ A;  2R10 A;  3U5K A;  5CS8 A;  3MB4 A;  4UYH A;  5I29 A;  3U5N A;  4TU6 A;  2DVV A;  4N4F A;  5CQT A;  3K2J A;  4O7A A;  2RS9 B;  4QSX A;  4HXN A;  5ACY A;  5F36 A;  4YY6 A;  5AD3 A;  4QSS A;  5E9Y A;  4NR9 A;  3MB3 A;  5CQ7 A;  4MEP A;  4OGI A;  4TT2 A;  5LJ2 A;  3SVH A;  4IR4 A;  4N4H A;  2I8N A;  5ENC A;  5ENI A;  4N4G A;  5F62 A;  5I88 A;  4UYG A;  3IU6 A;  2H60 A;  5CU8 A;  5E0R A;  3LQJ A;  4HXM A;  5F3A A;  5KU3 A;  5K29 A;  4TZ8 A;  4YH3 A;  4E96 A;  3U5P A;  4QC1 A;  4A9I A;  4A9E A;  5A5R A;  1F68 A;  4IOQ A;  3P1F A;  4CFL A;  5DYX A;  5II2 A;  3P1E A;  5DY7 A;  4NRC A;  4NYV A;  4XUB A;  4XYA A;  5IGM A;  3TLP A;  4IR3 A;  5A5P A;  5EV9 A;  5C87 A;  4LRG A;  4MR3 A;  5HCL A;  3MXF A;  5E9I A;  4MR5 A;  4IR6 A;  5IBN A;  4Y03 A;  5EU1 A;  3U5L A;  5CFW A;  4QEU A;  4A9M A;  4QYD A;  5D25 A;  4CFK A;  2OO1 A;  5D3L A;  4QZS A;  3UVY A;  5LKX A;  4NR6 A;  3UVW A;  5F61 A;  4QSU A;  4KV1 A;  5COI A;  4A9J A;  1JM4 B;  4UYE A;  4F3I A;  5BT5 A;  4J0R A;  5F60 A;  4QY4 A;  4LR6 A;  2F6N A;  2E7N A;  2OUO A;  5EIS A;  4IR5 A;  3LQI A;  5E74 A;  2D82 A;  4HBX A;  4Q0O A;  5I7X A;  2L84 A;  4NUE A;  5D3R A;  5C7N A;  4YAT A;  4UIY A;  5LJ1 A;  4HXO A;  4O78 A;  5F1L A;  2DVR A;  2YEK A;  4QR4 A;  4IOO A;  4CL9 A;  4QYL A;  5CQ6 A;  5KTX A;  4OUF A;  2WP1 A;  5E3D A;  5EIC A;  4UYD A;  5EQ1 A;  5FG6 A;  4YH4 A;  4NQN A;  3SVF A;  5D26 A;  4ALG A;  5TCM A;  5DFC A;  2GRC A;  5DYA A;  3JVL A;  4ZC9 A;  5L96 A;  4LZR A;  4J1P A;  4UYF B;  4O7E A;  2N9G A;  2R0S A;  5KTW A;  5CPE A;  5HQ7 A;  5A5S A;  5LKZ A;  5F25 A;  5HM0 A;  2L85 A;  4LC2 A;  5I86 A;  5L99 A;  4A9L A;  4KCX A;  5CUC A;  3HME A;  4BHW A;  3P1C A;  4HXP A;  5ENH A;  2WP2 A;  4A9N A;  4QR3 A;  5DBM A;  4WIV A;  4N4I A;  5DW2 A;  5EP7 A;  5C85 A;  5A83 A;  4O7B A;  2YW5 A;  5E9V A;  5CQ5 A;  4NR8 A;  4CUS A;  5FH7 A;  5FE6 A;  5CY9 A;  5IID A;  5FE2 A;  5F2P A;  4HXL A;  5A5O A;  5EPR A;  5HLS A;  4QSV A;  2R0Y A;  5DFB A;  5EA1 A;  5I40 A;  5ETD A;  2G4A A;  2YYN A;  5A5Q A;  5LKU A;  5CTL A;  4LYI A;  3HMH A;  4RVR A;  2FSA A;  5DKD A;  4YBS A;  4QBM A;  4YAB A;  4Q0N A;  5E3G A;  4Z93 A;  4O7F A;  5EVA A;  2RFJ A;  4LYS A;  5IG6 A;  5J0D A;  3UW9 A;  3JVM A;  4UIW A;  5H1U A;  4QEW A;  4C66 A;  2L5E A;  4UIU A;  3O37 A;  5ETB A;  5FFY A;  5FE7 A;  4BW2 A;  4TS8 A;  5HJC A;  4J3I A;  4PKL A;  2NXB A;  4YAX A;  3U5J A;  5E9M A;  2RNW A;  4NR5 A;  3UV4 A;  5HFQ A;  5KHM A;  5CUD A;  5AMF A;  5HEL A;  4QST A;  1X0J A;  5DKH A;  4QC3 A;  5ENG A;  5FE1 A;  3RCW A;  5D3H A;  5LKT A;  1EQF A;  3QZV A;  4QUU A;  3HMF A;  5E9K A;  4NXJ A;  5F5Z A;  1WUM A;  5FFV A;  5DYU A;  5L8T A;  4FLP A;  5CQ3 A;  5A85 A;  2KTB B;  3LJW A;  5II1 A;  5C89 A;  3UVX A;  5EPS A;  4MR6 A;  5LUU A;  2F6J A;  5ENB A;  3ZYU A;  5FH6 A;  5CUE A;  5FE0 A;  2LSP B;  4QSR A;  3QZT A;  2RI7 A;  4TU4 A;  4NQM A;  5JWM A;  3O34 A;  5HQ6 A;  5L97 A;  4CUR A;  4MR4 A;  3O35 A;  4Z6I A;  5IGL A;  5ENE A;  4TQN A;  5FBX A;  4NYX A;  4QR5 A;  4A9H A;  3AQA A;  4YK0 A;  4YBM A;  5E73 A;  4PCE A;  5D24 A;  4PS5 A;  3NXB A;  5CRM A;  4C67 A;  5FE8 A;  3Q2E A;  5IGN A;  3DWY A;  4O76 A;  5EM3 A;  2MJV B;  5C4Q A;  4BW1 A;  3UV2 A;  2DVQ A;  5D7X A;  5I80 A;  5EWV A;  4TT4 A;  4TTE A;  5HRX A;  5I89 A;  5DLZ A;  5FB0 A;  4NUC A;  4NRB A;  3ONI A;  5D3N A;  1N72 A;  4UIX A;  5DX4 A;  4NR4 A;  4NYW A;  4NUD A;  5CRZ A;  2D9E A;  2RO1 A;  3MUL A;  3UVD A;  5L98 A;  5EI4 A;  4KV4 A;  3DAI A;  4CUP A;  2YEL A;  5DW1 A;  4O75 A;  4O72 A;  5DYC A;  5E9L A;  4YY4 A;  4ZW1 A;  3G0J A;  4A9K A;  4MEO A;  3G0L A;  5KTU A;  4TYL A;  4UYF A;  4QSP A;  4XY9 A;  4N3W A;  4UIZ A;  3SVG A;  5EWH A;  4NS5 A;  5CQA A;  5FE3 A;  5H85 A;  4ZQL A;  5FDZ A;  3JVK A;  4GPJ A;  3LXJ A;  2DKW A;  4LZ2 A;  4TZ2 A;  4DON A;  3MUK A;  5FG4 A;  2RNX A;  4YAD A;  5BT3 A;  3UV5 A;  5AME A;  4YYD A;  1E6I A;  5ENF A;  3S92 A;  5HEM A;  5ENJ A;  5KO4 A;  5D0C A;  4MEN A;  4QB3 A;  1ZS5 A;  4XY8 A;  5G4R A;  5G4S A;  4YYH A;  4Z1S A;  5EK9 A;  5CQ8 A;  4HBV A;  5A81 A;  3IU5 A;  5D3S A;  5FG5 A;  4WHW A;  2YQD A;  4UIT A;  3JVJ A;  5HQ5 A;  5CUA A;  4YYN A;  5A5N A;  4O7C A;  4YC9 A;  2YEM A;  2E7O A;  4A9F A;  5FE5 A;  5CP5 A;  4CLB A;  5I83 A;  4O70 A;  4OGJ A;  4HXR A;  5DFD A;  5EGU A;  4QEV A;  4YYJ A;  5AD2 A;  4Z6H A;  4BW4 A;  5FB1 A;  3U5M A;  5FE4 A;  2YDW A;  5CUG A;  5F1H A;  4YYM A;  4AKN A;  4O71 A;  5DKC A;  5HFR A; 
#chains in the Genus database with same CATH topology
 4NR7 A;  5F63 A;  4YBT A;  2RNY A;  4HBY A;  2DWW A;  3D7C A;  5LVR A;  5BT4 A;  4A9O A;  4WHU A;  3FKM X;  5HRW A;  2DAT A;  4O77 A;  2R0V A;  4IOR A;  4PTB A;  5A82 A;  5D3P A;  4XUA A;  4YYG A;  2I7K A;  3VKH A;  3P1D A;  5C8G A;  2DVS A;  4PCI A;  5A7C A;  5CQ4 A;  4CUT A;  4QSQ A;  4QSW A;  4HXS A;  4NRA A;  5LJ0 A;  5D3J A;  4TT6 A;  3MQM A;  2OSS A;  4ALH A;  3S91 A;  4LYW A;  5H1V A;  4YYI A;  5E7D A;  4J0S A;  5EWW A;  5FFW A;  4BJX A;  5HEN A;  3U5O A;  3O33 A;  5FH8 A;  5I1Q A;  5EPB A;  3P5O A;  4UIV A;  4YYK A;  5TB6 A;  3QZS A;  4LZS A;  5HRV A;  3LQH A;  3GG3 A;  5JI8 A;  4HBW A;  5CUB A;  4PY6 A;  5CZG A;  4QNS A;  4LDF A;  4Z1Q A;  5EWC A;  4O74 A;  5CGP A;  5L8U A;  3AAD A;  4BW3 A;  5FE9 A;  4MEQ A;  4QUT A;  5DLX A;  1WUG A;  5LVQ A;  3I3J A;  5D3T A;  4CUU A;  1JSP B;  4HXK A;  2E3K A;  5H1T A;  3Q2F A;  5I7Y A;  5EWD A;  4X2I A;  5IGK A;  3O36 A;  4CUQ A;  2R10 A;  3U5K A;  5CS8 A;  3MB4 A;  4UYH A;  5I29 A;  3U5N A;  4TU6 A;  2DVV A;  4N4F A;  5CQT A;  3K2J A;  4O7A A;  2RS9 B;  4QSX A;  4HXN A;  5ACY A;  5F36 A;  4YY6 A;  5AD3 A;  4QSS A;  5E9Y A;  4NR9 A;  3MB3 A;  5CQ7 A;  4MEP A;  4OGI A;  4TT2 A;  5LJ2 A;  3SVH A;  4IR4 A;  4N4H A;  2I8N A;  5ENC A;  5ENI A;  4N4G A;  5F62 A;  5I88 A;  4UYG A;  3IU6 A;  2H60 A;  5CU8 A;  5E0R A;  3LQJ A;  4HXM A;  5F3A A;  5KU3 A;  5K29 A;  4TZ8 A;  4YH3 A;  4E96 A;  3U5P A;  4QC1 A;  4A9I A;  4A9E A;  5A5R A;  1F68 A;  4IOQ A;  3P1F A;  4CFL A;  5DYX A;  5II2 A;  3P1E A;  5DY7 A;  4NRC A;  4NYV A;  4XUB A;  4XYA A;  5IGM A;  3TLP A;  4IR3 A;  5A5P A;  5EV9 A;  5C87 A;  4LRG A;  4MR3 A;  5HCL A;  3MXF A;  5E9I A;  4MR5 A;  4IR6 A;  5IBN A;  4Y03 A;  5EU1 A;  3U5L A;  5CFW A;  4QEU A;  4A9M A;  4QYD A;  5D25 A;  4CFK A;  2OO1 A;  5D3L A;  4QZS A;  3UVY A;  5LKX A;  4NR6 A;  3UVW A;  5F61 A;  4AKG A;  4QSU A;  4KV1 A;  5COI A;  4A9J A;  1JM4 B;  4UYE A;  4F3I A;  5BT5 A;  4J0R A;  5F60 A;  4QY4 A;  4LR6 A;  2F6N A;  2E7N A;  2OUO A;  5EIS A;  4IR5 A;  3LQI A;  5E74 A;  2D82 A;  4HBX A;  4Q0O A;  5I7X A;  2L84 A;  4NUE A;  5D3R A;  5C7N A;  4YAT A;  4UIY A;  5LJ1 A;  4HXO A;  4O78 A;  5F1L A;  2DVR A;  2YEK A;  4QR4 A;  4IOO A;  4CL9 A;  4QYL A;  5CQ6 A;  5KTX A;  4OUF A;  2WP1 A;  5E3D A;  5EIC A;  4UYD A;  5EQ1 A;  5FG6 A;  4YH4 A;  4NQN A;  3SVF A;  5D26 A;  4ALG A;  5TCM A;  5DFC A;  2GRC A;  5DYA A;  3JVL A;  4ZC9 A;  5L96 A;  4LZR A;  3ERR A;  4J1P A;  4UYF B;  4O7E A;  2N9G A;  2R0S A;  5KTW A;  5CPE A;  5HQ7 A;  5A5S A;  5LKZ A;  5F25 A;  5HM0 A;  2L85 A;  4LC2 A;  5I86 A;  5L99 A;  4A9L A;  4KCX A;  5CUC A;  3HME A;  4BHW A;  3P1C A;  4HXP A;  5ENH A;  2WP2 A;  4A9N A;  4QR3 A;  5DBM A;  4WIV A;  4N4I A;  5DW2 A;  5EP7 A;  5C85 A;  5A83 A;  4O7B A;  2YW5 A;  5E9V A;  5CQ5 A;  4NR8 A;  4CUS A;  5FH7 A;  5FE6 A;  5CY9 A;  5IID A;  5FE2 A;  5F2P A;  4HXL A;  3D1B A;  5A5O A;  5EPR A;  5HLS A;  4QSV A;  2R0Y A;  5DFB A;  5EA1 A;  5I40 A;  5ETD A;  2G4A A;  2YYN A;  5A5Q A;  5LKU A;  5CTL A;  4LYI A;  3HMH A;  4RVR A;  2FSA A;  5DKD A;  4YBS A;  4QBM A;  4YAB A;  4Q0N A;  5E3G A;  4Z93 A;  4O7F A;  5EVA A;  1ZKR A;  2RFJ A;  4LYS A;  5IG6 A;  5J0D A;  3UW9 A;  3JVM A;  4UIW A;  5H1U A;  4QEW A;  4C66 A;  2L5E A;  4UIU A;  3O37 A;  5ETB A;  5FFY A;  5FE7 A;  4BW2 A;  4TS8 A;  5HJC A;  4J3I A;  4PKL A;  2NXB A;  4YAX A;  3U5J A;  5E9M A;  2RNW A;  4NR5 A;  3UV4 A;  1PUO A;  5HFQ A;  5KHM A;  5CUD A;  5AMF A;  5HEL A;  4QST A;  1X0J A;  5DKH A;  4QC3 A;  5ENG A;  5FE1 A;  4AKI A;  3RCW A;  5D3H A;  5LKT A;  1EQF A;  3QZV A;  4QUU A;  3HMF A;  3D1D A;  5E9K A;  4NXJ A;  5F5Z A;  1WUM A;  5FFV A;  5DYU A;  5L8T A;  4FLP A;  5CQ3 A;  5A85 A;  2KTB B;  3LJW A;  5II1 A;  5C89 A;  3UVX A;  5EPS A;  4MR6 A;  5LUU A;  2F6J A;  5ENB A;  3ZYU A;  5FH6 A;  5CUE A;  5FE0 A;  2LSP B;  4QSR A;  3QZT A;  2RI7 A;  4TU4 A;  4NQM A;  5JWM A;  3O34 A;  5HQ6 A;  5L97 A;  4CUR A;  4MR4 A;  3O35 A;  4Z6I A;  5IGL A;  5ENE A;  4TQN A;  5FBX A;  4NYX A;  4QR5 A;  4A9H A;  3AQA A;  4YK0 A;  4YBM A;  5E73 A;  4PCE A;  5D24 A;  4PS5 A;  3NXB A;  5CRM A;  4C67 A;  5FE8 A;  3Q2E A;  5IGN A;  3DWY A;  4O76 A;  5EM3 A;  2MJV B;  5C4Q A;  4BW1 A;  3UV2 A;  2DVQ A;  5D7X A;  5I80 A;  5EWV A;  4TT4 A;  4AI6 A;  4TTE A;  5HRX A;  5I89 A;  5DLZ A;  5FB0 A;  4NUC A;  4NRB A;  3ONI A;  5D3N A;  1N72 A;  2EJN A;  4UIX A;  5DX4 A;  4NR4 A;  4NYW A;  4NUD A;  5CRZ A;  2D9E A;  2RO1 A;  3MUL A;  3UVD A;  5L98 A;  5EI4 A;  4KV4 A;  3DAI A;  4CUP A;  2YEL A;  5DW1 A;  4O75 A;  4O72 A;  5DYC A;  5E9L A;  4YY4 A;  4ZW1 A;  3G0J A;  4A9K A;  4MEO A;  3G0L A;  5KTU A;  4TYL A;  4UYF A;  4QSP A;  4XY9 A;  4N3W A;  4UIZ A;  3SVG A;  5EWH A;  4NS5 A;  5CQA A;  5FE3 A;  5H85 A;  4ZQL A;  5FDZ A;  3JVK A;  4GPJ A;  3LXJ A;  2DKW A;  4LZ2 A;  4TZ2 A;  4DON A;  3MUK A;  5FG4 A;  2RNX A;  3VKG A;  4YAD A;  5BT3 A;  3UV5 A;  5AME A;  4YYD A;  1E6I A;  5ENF A;  3S92 A;  5HEM A;  5ENJ A;  5KO4 A;  5D0C A;  4MEN A;  4QB3 A;  1ZS5 A;  4XY8 A;  4AKH A;  5G4R A;  5G4S A;  4YYH A;  4Z1S A;  5EK9 A;  5CQ8 A;  4HBV A;  5A81 A;  3IU5 A;  5D3S A;  5FG5 A;  4WHW A;  2YQD A;  4UIT A;  3JVJ A;  5HQ5 A;  5CUA A;  4YYN A;  5A5N A;  4O7C A;  4YC9 A;  2YEM A;  2E7O A;  4A9F A;  5FE5 A;  5CP5 A;  4CLB A;  5I83 A;  4O70 A;  4OGJ A;  4HXR A;  5DFD A;  5EGU A;  4QEV A;  4YYJ A;  5AD2 A;  4Z6H A;  4BW4 A;  5FB1 A;  3U5M A;  5FE4 A;  2YDW A;  5CUG A;  5F1H A;  4YYM A;  4AKN A;  4O71 A;  5DKC A;  5HFR A; 
#chains in the Genus database with same CATH homology
 4NR7 A;  5F63 A;  4YBT A;  2RNY A;  4HBY A;  2DWW A;  3D7C A;  5LVR A;  5BT4 A;  4A9O A;  4WHU A;  3FKM X;  5HRW A;  2DAT A;  4O77 A;  2R0V A;  4IOR A;  4PTB A;  5A82 A;  5D3P A;  4XUA A;  4YYG A;  2I7K A;  3P1D A;  5C8G A;  2DVS A;  4PCI A;  5A7C A;  5CQ4 A;  4CUT A;  4QSQ A;  4QSW A;  4HXS A;  4NRA A;  5LJ0 A;  5D3J A;  4TT6 A;  3MQM A;  2OSS A;  4ALH A;  3S91 A;  4LYW A;  5H1V A;  4YYI A;  5E7D A;  4J0S A;  5EWW A;  5FFW A;  4BJX A;  5HEN A;  3U5O A;  3O33 A;  5FH8 A;  5I1Q A;  5EPB A;  3P5O A;  4UIV A;  4YYK A;  5TB6 A;  3QZS A;  4LZS A;  5HRV A;  3LQH A;  3GG3 A;  5JI8 A;  4HBW A;  5CUB A;  4PY6 A;  5CZG A;  4QNS A;  4LDF A;  4Z1Q A;  5EWC A;  4O74 A;  5CGP A;  5L8U A;  3AAD A;  4BW3 A;  5FE9 A;  4MEQ A;  4QUT A;  5DLX A;  1WUG A;  5LVQ A;  3I3J A;  5D3T A;  4CUU A;  1JSP B;  4HXK A;  2E3K A;  5H1T A;  3Q2F A;  5I7Y A;  5EWD A;  4X2I A;  5IGK A;  3O36 A;  4CUQ A;  2R10 A;  3U5K A;  5CS8 A;  3MB4 A;  4UYH A;  5I29 A;  3U5N A;  4TU6 A;  2DVV A;  4N4F A;  5CQT A;  3K2J A;  4O7A A;  2RS9 B;  4QSX A;  4HXN A;  5ACY A;  5F36 A;  4YY6 A;  5AD3 A;  4QSS A;  5E9Y A;  4NR9 A;  3MB3 A;  5CQ7 A;  4MEP A;  4OGI A;  4TT2 A;  5LJ2 A;  3SVH A;  4IR4 A;  4N4H A;  2I8N A;  5ENC A;  5ENI A;  4N4G A;  5F62 A;  5I88 A;  4UYG A;  3IU6 A;  2H60 A;  5CU8 A;  5E0R A;  3LQJ A;  4HXM A;  5F3A A;  5KU3 A;  5K29 A;  4TZ8 A;  4YH3 A;  4E96 A;  3U5P A;  4QC1 A;  4A9I A;  4A9E A;  5A5R A;  1F68 A;  4IOQ A;  3P1F A;  4CFL A;  5DYX A;  5II2 A;  3P1E A;  5DY7 A;  4NRC A;  4NYV A;  4XUB A;  4XYA A;  5IGM A;  3TLP A;  4IR3 A;  5A5P A;  5EV9 A;  5C87 A;  4LRG A;  4MR3 A;  5HCL A;  3MXF A;  5E9I A;  4MR5 A;  4IR6 A;  5IBN A;  4Y03 A;  5EU1 A;  3U5L A;  5CFW A;  4QEU A;  4A9M A;  4QYD A;  5D25 A;  4CFK A;  2OO1 A;  5D3L A;  4QZS A;  3UVY A;  5LKX A;  4NR6 A;  3UVW A;  5F61 A;  4QSU A;  4KV1 A;  5COI A;  4A9J A;  1JM4 B;  4UYE A;  4F3I A;  5BT5 A;  4J0R A;  5F60 A;  4QY4 A;  4LR6 A;  2F6N A;  2E7N A;  2OUO A;  5EIS A;  4IR5 A;  3LQI A;  5E74 A;  2D82 A;  4HBX A;  4Q0O A;  5I7X A;  2L84 A;  4NUE A;  5D3R A;  5C7N A;  4YAT A;  4UIY A;  5LJ1 A;  4HXO A;  4O78 A;  5F1L A;  2DVR A;  2YEK A;  4QR4 A;  4IOO A;  4CL9 A;  4QYL A;  5CQ6 A;  5KTX A;  4OUF A;  2WP1 A;  5E3D A;  5EIC A;  4UYD A;  5EQ1 A;  5FG6 A;  4YH4 A;  4NQN A;  3SVF A;  5D26 A;  4ALG A;  5TCM A;  5DFC A;  2GRC A;  5DYA A;  3JVL A;  4ZC9 A;  5L96 A;  4LZR A;  4J1P A;  4UYF B;  4O7E A;  2N9G A;  2R0S A;  5KTW A;  5CPE A;  5HQ7 A;  5A5S A;  5LKZ A;  5F25 A;  5HM0 A;  2L85 A;  4LC2 A;  5I86 A;  5L99 A;  4A9L A;  4KCX A;  5CUC A;  3HME A;  4BHW A;  3P1C A;  4HXP A;  5ENH A;  2WP2 A;  4A9N A;  4QR3 A;  5DBM A;  4WIV A;  4N4I A;  5DW2 A;  5EP7 A;  5C85 A;  5A83 A;  4O7B A;  2YW5 A;  5E9V A;  5CQ5 A;  4NR8 A;  4CUS A;  5FH7 A;  5FE6 A;  5CY9 A;  5IID A;  5FE2 A;  5F2P A;  4HXL A;  5A5O A;  5EPR A;  5HLS A;  4QSV A;  2R0Y A;  5DFB A;  5EA1 A;  5I40 A;  5ETD A;  2G4A A;  2YYN A;  5A5Q A;  5LKU A;  5CTL A;  4LYI A;  3HMH A;  4RVR A;  2FSA A;  5DKD A;  4YBS A;  4QBM A;  4YAB A;  4Q0N A;  5E3G A;  4Z93 A;  4O7F A;  5EVA A;  2RFJ A;  4LYS A;  5IG6 A;  5J0D A;  3UW9 A;  3JVM A;  4UIW A;  5H1U A;  4QEW A;  4C66 A;  2L5E A;  4UIU A;  3O37 A;  5ETB A;  5FFY A;  5FE7 A;  4BW2 A;  4TS8 A;  5HJC A;  4J3I A;  4PKL A;  2NXB A;  4YAX A;  3U5J A;  5E9M A;  2RNW A;  4NR5 A;  3UV4 A;  5HFQ A;  5KHM A;  5CUD A;  5AMF A;  5HEL A;  4QST A;  1X0J A;  5DKH A;  4QC3 A;  5ENG A;  5FE1 A;  3RCW A;  5D3H A;  5LKT A;  1EQF A;  3QZV A;  4QUU A;  3HMF A;  5E9K A;  4NXJ A;  5F5Z A;  1WUM A;  5FFV A;  5DYU A;  5L8T A;  4FLP A;  5CQ3 A;  5A85 A;  2KTB B;  3LJW A;  5II1 A;  5C89 A;  3UVX A;  5EPS A;  4MR6 A;  5LUU A;  2F6J A;  5ENB A;  3ZYU A;  5FH6 A;  5CUE A;  5FE0 A;  2LSP B;  4QSR A;  3QZT A;  2RI7 A;  4TU4 A;  4NQM A;  5JWM A;  3O34 A;  5HQ6 A;  5L97 A;  4CUR A;  4MR4 A;  3O35 A;  4Z6I A;  5IGL A;  5ENE A;  4TQN A;  5FBX A;  4NYX A;  4QR5 A;  4A9H A;  3AQA A;  4YK0 A;  4YBM A;  5E73 A;  4PCE A;  5D24 A;  4PS5 A;  3NXB A;  5CRM A;  4C67 A;  5FE8 A;  3Q2E A;  5IGN A;  3DWY A;  4O76 A;  5EM3 A;  2MJV B;  5C4Q A;  4BW1 A;  3UV2 A;  2DVQ A;  5D7X A;  5I80 A;  5EWV A;  4TT4 A;  4TTE A;  5HRX A;  5I89 A;  5DLZ A;  5FB0 A;  4NUC A;  4NRB A;  3ONI A;  5D3N A;  1N72 A;  4UIX A;  5DX4 A;  4NR4 A;  4NYW A;  4NUD A;  5CRZ A;  2D9E A;  2RO1 A;  3MUL A;  3UVD A;  5L98 A;  5EI4 A;  4KV4 A;  3DAI A;  4CUP A;  2YEL A;  5DW1 A;  4O75 A;  4O72 A;  5DYC A;  5E9L A;  4YY4 A;  4ZW1 A;  3G0J A;  4A9K A;  4MEO A;  3G0L A;  5KTU A;  4TYL A;  4UYF A;  4QSP A;  4XY9 A;  4N3W A;  4UIZ A;  3SVG A;  5EWH A;  4NS5 A;  5CQA A;  5FE3 A;  5H85 A;  4ZQL A;  5FDZ A;  3JVK A;  4GPJ A;  3LXJ A;  2DKW A;  4LZ2 A;  4TZ2 A;  4DON A;  3MUK A;  5FG4 A;  2RNX A;  4YAD A;  5BT3 A;  3UV5 A;  5AME A;  4YYD A;  1E6I A;  5ENF A;  3S92 A;  5HEM A;  5ENJ A;  5KO4 A;  5D0C A;  4MEN A;  4QB3 A;  1ZS5 A;  4XY8 A;  5G4R A;  5G4S A;  4YYH A;  4Z1S A;  5EK9 A;  5CQ8 A;  4HBV A;  5A81 A;  3IU5 A;  5D3S A;  5FG5 A;  4WHW A;  2YQD A;  4UIT A;  3JVJ A;  5HQ5 A;  5CUA A;  4YYN A;  5A5N A;  4O7C A;  4YC9 A;  2YEM A;  2E7O A;  4A9F A;  5FE5 A;  5CP5 A;  4CLB A;  5I83 A;  4O70 A;  4OGJ A;  4HXR A;  5DFD A;  5EGU A;  4QEV A;  4YYJ A;  5AD2 A;  4Z6H A;  4BW4 A;  5FB1 A;  3U5M A;  5FE4 A;  2YDW A;  5CUG A;  5F1H A;  4YYM A;  4AKN A;  4O71 A;  5DKC A;  5HFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...