5ENEA

Crystal structure of the second bromodomain of pleckstrin homology domain interacting protein (phip) in complex with 5-amino-2-benzyl-1,3-oxazole-4-carbonitrile (sgc - diamond i04-1 fragment screening)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords PH-interacting protein
publication title A poised fragment library enables rapid synthetic expansion yielding the first reported inhibitors of PHIP(2), an atypical bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5eneA00
4E96A 5L96A 4PS5A 4YAXA 5EWWA 4HBVA 2RNXA 5CUAA 4NYXA 3G0LA 1X0JA 4HXPA 4MEPA 5LKUA 4XY9A 5A7CA 4NR4A 4XUAA 4OGJA 3GG3A 5L99A 4YATA 5DYUA 4FLPA 5FH8A 4O70A 5E9KA 4LYSA 5LJ2A 2R0VA 3SVHA 2DVRA 2YELA 5CRMA 3FKMX 4IORA 5DW2A 4NUDA 5EPBA 5HENA 5CQAA 5CQ5A 3NXBA 5AD2A 5HM0A 5D7XA 5F60A 2RI7A 4PCIA 3U5LA 5A5PA 4J3IA 5CQ7A 5CTLA 4CUQA 2F6JA 2KTBB 5CGPA 5ACYA 3Q2EA 5L97A 5BT5A 4ZC9A 5EK9A 5F5ZA 5FE3A 5EPSA 5LJ1A 4MEQA 3LQHA 5CZGA 3MB4A 3ONIA 4QSTA 5EV9A 5HJCA 2E7OA 4TT4A 5ETBA 2L85A 3JVJA 4NXJA 4TU4A 5KTXA 5IGLA 5H1VA 4WIVA 5E7DA 4O7EA 4QUUA 4QSRA 5HELA 2MJVB 5CUDA 4KCXA 3Q2FA 4QEUA 4J0SA 4NRBA 4UYFA 4BW2A 4OGIA 5EWDA 4QEVA 5DKDA 5E9LA 4HBWA 5D26A 4YBTA 4TS8A 4YH3A 3RCWA 3I3JA 3O33A 3JVMA 5FE4A 4TYLA 5CQ8A 3P5OA 3QZVA 2DVSA 5HQ7A 5FE8A 4NYWA 5COIA 3SVGA 4MR5A 2I7KA 5L8UA 4UYDA 4N4HA 4LZSA 3HMHA 5EGUA 4A9IA 4TQNA 5DLZA 5D3PA 5DYAA 4XUBA 5F61A 3AQAA 2DVQA 4CFLA 5EU1A 3K2JA 4CURA 4QSXA 4Q0NA 5EI4A 5A5OA 4UYGA 4ZQLA 5CQ4A 5A81A 2GRCA 3U5PA 2G4AA 3U5KA 3MULA 3UVXA 4LZ2A 4UIXA 4QSUA 4PTBA 2DATA 5D24A 5I88A 5FG6A 5FB1A 4NR5A 5KU3A 4UIZA 4C67A 1WUGA 4LRGA 5CFWA 5CQTA 5L98A 4MENA 4NUEA 5II1A 5FE5A 5TB6A 5A5NA 3LQIA 5FFVA 5LKZA 4MR6A 5ENIA 5HCLA 4IR5A 2OO1A 4YABA 5D3RA 2OSSA 2YEKA 4N4GA 3LXJA 4ALGA 4QSQA 4YBMA 4O7BA 5FE9A 5H1UA 4YY6A 4YK0A 5DFCA 4A9FA 5EICA 5A82A 4YYGA 4ZW1A 4IOQA 3JVLA 5DFBA 5ENBA 5DFDA 4NR9A 5CPEA 4CFKA 5FBXA 4QSPA 5CUCA 2R10A 4HBXA 1E6IA 5LJ0A 4YBSA 3UV5A 3TLPA 2YYNA 4RVRA 4Y03A 5F25A 3JVKA 4CL9A 3O37A 5LKXA 4HXOA 3S92A 4LC2A 4LYWA 5DYCA 5CRZA 5I86A 4YC9A 5CUBA 5D25A 5D3SA 4NQNA 4TT6A 4TU6A 4YYJA 3P1DA 4IR3A 4DONA 3O35A 2L84A 4C66A 5D3JA 4UYHA 5G4RA 3O36A 4UIVA 4WHUA 2H60A 4CUUA 1JSPB 2WP1A 5DW1A 3IU6A 4NUCA 5EA1A 4UYEA 4XYAA 5I7XA 4O7CA 5F1LA 4PKLA 4HXLA 1F68A 5DLXA 4CUPA 5DX4A 4NYVA 4YYIA 3UW9A 4IR4A 5FFYA 4QB3A 5H85A 2WP2A 5D0CA 4UITA 4KV1A 4AKNA 5I1QA 5AMFA 4HXMA 2RNWA 5HRWA 4O72A 5HFQA 4IOOA 5E9VA 3IU5A 5EQ1A 4HXKA 2I8NA 5F1HA 4Z93A 3S91A 5C85A 5D3HA 2FSAA 5ENGA 4PCEA 3UVYA 5FE7A 4O7AA 5C8GA 2RS9B 3D7CA 3G0JA 4PY6A 2E3KA 4O71A 4BJXA 2RO1A 2RFJA 4Z6HA 1JM4B 4QNSA 2E7NA 5H1TA 4UIWA 5C89A 4YYMA 5C87A 4YYDA 5HFRA 5I83A 3P1CA 4KV4A 3LJWA 3HMFA 5I80A 2D82A 1WUMA 4O74A 4TT2A 5EP7A 2RNYA 5ENEA 5LUUA 4HXNA 5DBMA 5FE0A 4LDFA 5FG4A 5AMEA 5I7YA 2YDWA 5EVAA 5CQ3A 5EM3A 3SVFA 3U5OA 3UVDA 4QR5A 2YW5A 2OUOA 4F3IA 5FG5A 5FFWA 5AD3A 5CQ6A 4QYDA 5F63A 5ENCA 5TCMA 3U5JA 5L8TA 5ENFA 3UV2A 5CUGA 5FE2A 4NRCA 5D3TA 5D3NA 4Z1SA 5F62A 4O76A 5ENJA 4QBMA 1EQFA 5C7NA 4XY8A 3HMEA 4X2IA 4NR7A 5F36A 5FDZA 5LVQA 5EPRA 4UYFB 4YY4A 3LQJA 3MUKA 3AADA 5CY9A 5E9IA 5HLSA 4J0RA 5KO4A 4O78A 4J1PA 4A9MA 5JI8A 4MEOA 5EWHA 4QSSA 2F6NA 5I40A 5LKTA 4YADA 5A5SA 5HQ5A 4NR8A 4QC1A 4BHWA 5I29A 5E3DA 4QC3A 5F2PA 4QSVA 5II2A 3MXFA 2N9GA 3QZTA 5FE1A 4MR3A 4BW3A 2DKWA 5BT4A 1N72A 4NR6A 5FE6A 4UIYA 4NQMA 4CUSA 5CUEA 5F3AA 4YYHA 5EISA 2YEMA 4CLBA 4Q0OA 4QYLA 4NS5A 2NXBA 2DWWA 5KTUA 4OUFA 5HRVA 5DY7A 4N3WA 5D3LA 5E3GA 4YYNA 5IGKA 4TTEA 3DWYA 4WHWA 5DYXA 3P1FA 2R0SA 3P1EA 5HQ6A 5E9YA 5IBNA 2R0YA 4QY4A 4TZ8A 4IR6A 5FH7A 5G4SA 3ZYUA 4A9KA 4BW1A 5FB0A 4CUTA 4NRAA 3O34A 5K29A 3DAIA 1ZS5A 3UVWA 4QR4A 3QZSA 3UV4A 5E73A 4A9HA 4QUTA 3U5NA 4BW4A 5ETDA 5I89A 4GPJA 5E9MA 5HEMA 5CU8A 4HXSA 4A9NA 5KTWA 5DKCA 4UIUA 5E0RA 4LZRA 4O7FA 5CP5A 3MB3A 4A9JA 2DVVA 4O77A 5KHMA 5IGNA 3MQMA 2LSPB 4A9LA 5JWMA 5A85A 5IIDA 4HXRA 2L5EA 5A83A 4MR4A 4LYIA 4Z1QA 4Z6IA 5HRXA 5EWCA 4HBYA 4QZSA 4QR3A 4O75A 5CS8A 4LR6A 5IG6A 4N4IA 5DKHA 5FH6A 4A9EA 4A9OA 4ALHA 5IGMA 5C4QA 5LVRA 4QSWA 5E74A 5A5QA 4QEWA 3U5MA 2D9EA 4N4FA 4YH4A 5J0DA 5ENHA 2YQDA 5EWVA 4YYKA 4TZ2A 5A5RA 5BT3A
chains in the Genus database with same CATH superfamily
3VKHA 4E96A 5L96A 4PS5A 4YAXA 5EWWA 4HBVA 2RNXA 5CUAA 4NYXA 3G0LA 1X0JA 4HXPA 4MEPA 5LKUA 4XY9A 5A7CA 4NR4A 4XUAA 4OGJA 3GG3A 5L99A 4YATA 5DYUA 4FLPA 5FH8A 4O70A 5E9KA 4LYSA 5LJ2A 2R0VA 3SVHA 2DVRA 2YELA 5CRMA 3FKMX 4IORA 5DW2A 4NUDA 5EPBA 5HENA 5CQAA 5CQ5A 3NXBA 5AD2A 5HM0A 5D7XA 5F60A 2RI7A 4PCIA 3U5LA 5A5PA 4J3IA 5CQ7A 5CTLA 2EJNA 4CUQA 2F6JA 2KTBB 5CGPA 5ACYA 3Q2EA 5L97A 5BT5A 4ZC9A 5EK9A 5F5ZA 5FE3A 5EPSA 5LJ1A 4MEQA 3LQHA 5CZGA 3MB4A 3ONIA 4QSTA 5EV9A 5HJCA 2E7OA 4TT4A 5ETBA 2L85A 3JVJA 4NXJA 4TU4A 5KTXA 5IGLA 5H1VA 4WIVA 5E7DA 4O7EA 4QUUA 4QSRA 5HELA 2MJVB 5CUDA 4KCXA 3Q2FA 4QEUA 4J0SA 4NRBA 4UYFA 3D1DA 4BW2A 4OGIA 5EWDA 4QEVA 5DKDA 5E9LA 4HBWA 5D26A 4YBTA 4TS8A 4YH3A 3RCWA 3I3JA 3O33A 3JVMA 5FE4A 4TYLA 5CQ8A 3P5OA 3QZVA 2DVSA 5HQ7A 5FE8A 4NYWA 5COIA 3SVGA 4MR5A 2I7KA 5L8UA 4UYDA 4N4HA 4LZSA 3HMHA 5EGUA 4A9IA 4TQNA 5DLZA 5D3PA 5DYAA 4XUBA 5F61A 3AQAA 2DVQA 4CFLA 5EU1A 3K2JA 4CURA 4QSXA 4Q0NA 5EI4A 5A5OA 4UYGA 4ZQLA 5CQ4A 5A81A 2GRCA 3U5PA 2G4AA 3U5KA 3MULA 3UVXA 4LZ2A 4UIXA 4QSUA 4PTBA 2DATA 5D24A 5I88A 5FG6A 4AKIA 5FB1A 4NR5A 5KU3A 4UIZA 4C67A 3ERRA 1WUGA 4LRGA 5CFWA 5CQTA 5L98A 4MENA 4NUEA 5II1A 5FE5A 5TB6A 5A5NA 3LQIA 5FFVA 5LKZA 4MR6A 5ENIA 5HCLA 4IR5A 2OO1A 4YABA 5D3RA 2OSSA 2YEKA 4N4GA 3LXJA 4ALGA 4QSQA 4YBMA 4O7BA 5FE9A 5H1UA 4YY6A 4YK0A 5DFCA 4A9FA 5EICA 5A82A 4YYGA 4ZW1A 4IOQA 3JVLA 5DFBA 5ENBA 5DFDA 4NR9A 5CPEA 4CFKA 5FBXA 4QSPA 5CUCA 2R10A 4HBXA 1E6IA 5LJ0A 4YBSA 3UV5A 3TLPA 2YYNA 4RVRA 4Y03A 5F25A 3JVKA 4CL9A 3O37A 5LKXA 4HXOA 3S92A 4LC2A 4LYWA 5DYCA 5CRZA 5I86A 4YC9A 5CUBA 5D25A 5D3SA 4NQNA 4TT6A 4TU6A 4YYJA 3P1DA 4IR3A 4DONA 3O35A 2L84A 4C66A 5D3JA 4UYHA 5G4RA 3O36A 4UIVA 4WHUA 2H60A 4CUUA 1JSPB 2WP1A 5DW1A 3IU6A 4NUCA 5EA1A 4UYEA 4XYAA 5I7XA 4O7CA 5F1LA 4PKLA 4HXLA 1F68A 5DLXA 4CUPA 5DX4A 4NYVA 4YYIA 3UW9A 4IR4A 5FFYA 4QB3A 5H85A 2WP2A 5D0CA 4UITA 4KV1A 4AKNA 5I1QA 5AMFA 4HXMA 2RNWA 5HRWA 4O72A 5HFQA 4IOOA 5E9VA 3IU5A 5EQ1A 4HXKA 2I8NA 5F1HA 4Z93A 3S91A 5C85A 5D3HA 2FSAA 5ENGA 4PCEA 3UVYA 5FE7A 4O7AA 5C8GA 2RS9B 3D7CA 3G0JA 4PY6A 2E3KA 4O71A 4BJXA 2RO1A 2RFJA 4Z6HA 1JM4B 4QNSA 2E7NA 5H1TA 4UIWA 5C89A 4YYMA 5C87A 4YYDA 5HFRA 5I83A 3P1CA 4KV4A 3LJWA 3HMFA 5I80A 2D82A 1WUMA 4O74A 4TT2A 5EP7A 2RNYA 5ENEA 5LUUA 4HXNA 5DBMA 5FE0A 4LDFA 5FG4A 5AMEA 5I7YA 2YDWA 5EVAA 5CQ3A 5EM3A 3SVFA 3U5OA 3UVDA 4QR5A 2YW5A 2OUOA 4F3IA 5FG5A 5FFWA 5AD3A 5CQ6A 4QYDA 5F63A 5ENCA 5TCMA 3U5JA 5L8TA 5ENFA 3UV2A 5CUGA 5FE2A 4NRCA 5D3TA 5D3NA 4Z1SA 5F62A 4O76A 5ENJA 4QBMA 1EQFA 5C7NA 4XY8A 3HMEA 4X2IA 4NR7A 5F36A 5FDZA 5LVQA 5EPRA 4UYFB 4YY4A 3LQJA 3MUKA 3AADA 5CY9A 5E9IA 5HLSA 4J0RA 5KO4A 4O78A 4J1PA 4A9MA 5JI8A 4MEOA 4AI6A 5EWHA 4QSSA 2F6NA 5I40A 5LKTA 4YADA 5A5SA 5HQ5A 4NR8A 4QC1A 4BHWA 5I29A 5E3DA 4QC3A 5F2PA 4QSVA 5II2A 3MXFA 2N9GA 3QZTA 5FE1A 4MR3A 4BW3A 2DKWA 5BT4A 1N72A 4NR6A 5FE6A 3D1BA 4UIYA 4NQMA 4CUSA 5CUEA 5F3AA 4YYHA 5EISA 2YEMA 4CLBA 4Q0OA 4QYLA 4NS5A 2NXBA 2DWWA 5KTUA 4OUFA 5HRVA 5DY7A 4N3WA 5D3LA 5E3GA 4YYNA 5IGKA 4TTEA 3DWYA 4WHWA 3VKGA 5DYXA 3P1FA 2R0SA 3P1EA 5HQ6A 5E9YA 5IBNA 2R0YA 4QY4A 4TZ8A 4IR6A 5FH7A 5G4SA 3ZYUA 4A9KA 4BW1A 4AKGA 5FB0A 4CUTA 4NRAA 3O34A 5K29A 3DAIA 1ZS5A 3UVWA 4QR4A 3QZSA 3UV4A 5E73A 4A9HA 4QUTA 3U5NA 4BW4A 1ZKRA 5ETDA 5I89A 4GPJA 5E9MA 5HEMA 5CU8A 4HXSA 4A9NA 5KTWA 5DKCA 4UIUA 5E0RA 4LZRA 4O7FA 5CP5A 4AKHA 3MB3A 4A9JA 2DVVA 4O77A 5KHMA 5IGNA 3MQMA 2LSPB 4A9LA 5JWMA 5A85A 5IIDA 4HXRA 2L5EA 5A83A 4MR4A 1PUOA 4LYIA 4Z1QA 4Z6IA 5HRXA 5EWCA 4HBYA 4QZSA 4QR3A 4O75A 5CS8A 4LR6A 5IG6A 4N4IA 5DKHA 5FH6A 4A9EA 4A9OA 4ALHA 5IGMA 5C4QA 5LVRA 4QSWA 5E74A 5A5QA 4QEWA 3U5MA 2D9EA 4N4FA 4YH4A 5J0DA 5ENHA 2YQDA 5EWVA 4YYKA 4TZ2A 5A5RA 5BT3A
chains in the Genus database with same CATH topology
4E96A 5L96A 4PS5A 4YAXA 5EWWA 4HBVA 2RNXA 5CUAA 4NYXA 3G0LA 1X0JA 4HXPA 4MEPA 5LKUA 4XY9A 5A7CA 4NR4A 4XUAA 4OGJA 3GG3A 5L99A 4YATA 5DYUA 4FLPA 5FH8A 4O70A 5E9KA 4LYSA 5LJ2A 2R0VA 3SVHA 2DVRA 2YELA 5CRMA 3FKMX 4IORA 5DW2A 4NUDA 5EPBA 5HENA 5CQAA 5CQ5A 3NXBA 5AD2A 5HM0A 5D7XA 5F60A 2RI7A 4PCIA 3U5LA 5A5PA 4J3IA 5CQ7A 5CTLA 4CUQA 2F6JA 2KTBB 5CGPA 5ACYA 3Q2EA 5L97A 5BT5A 4ZC9A 5EK9A 5F5ZA 5FE3A 5EPSA 5LJ1A 4MEQA 3LQHA 5CZGA 3MB4A 3ONIA 4QSTA 5EV9A 5HJCA 2E7OA 4TT4A 5ETBA 2L85A 3JVJA 4NXJA 4TU4A 5KTXA 5IGLA 5H1VA 4WIVA 5E7DA 4O7EA 4QUUA 4QSRA 5HELA 2MJVB 5CUDA 4KCXA 3Q2FA 4QEUA 4J0SA 4NRBA 4UYFA 4BW2A 4OGIA 5EWDA 4QEVA 5DKDA 5E9LA 4HBWA 5D26A 4YBTA 4TS8A 4YH3A 3RCWA 3I3JA 3O33A 3JVMA 5FE4A 4TYLA 5CQ8A 3P5OA 3QZVA 2DVSA 5HQ7A 5FE8A 4NYWA 5COIA 3SVGA 4MR5A 2I7KA 5L8UA 4UYDA 4N4HA 4LZSA 3HMHA 5EGUA 4A9IA 4TQNA 5DLZA 5D3PA 5DYAA 4XUBA 5F61A 3AQAA 2DVQA 4CFLA 5EU1A 3K2JA 4CURA 4QSXA 4Q0NA 5EI4A 5A5OA 4UYGA 4ZQLA 5CQ4A 5A81A 2GRCA 3U5PA 2G4AA 3U5KA 3MULA 3UVXA 4LZ2A 4UIXA 4QSUA 4PTBA 2DATA 5D24A 5I88A 5FG6A 5FB1A 4NR5A 5KU3A 4UIZA 4C67A 1WUGA 4LRGA 5CFWA 5CQTA 5L98A 4MENA 4NUEA 5II1A 5FE5A 5TB6A 5A5NA 3LQIA 5FFVA 5LKZA 4MR6A 5ENIA 5HCLA 4IR5A 2OO1A 4YABA 5D3RA 2OSSA 2YEKA 4N4GA 3LXJA 4ALGA 4QSQA 4YBMA 4O7BA 5FE9A 5H1UA 4YY6A 4YK0A 5DFCA 4A9FA 5EICA 5A82A 4YYGA 4ZW1A 4IOQA 3JVLA 5DFBA 5ENBA 5DFDA 4NR9A 5CPEA 4CFKA 5FBXA 4QSPA 5CUCA 2R10A 4HBXA 1E6IA 5LJ0A 4YBSA 3UV5A 3TLPA 2YYNA 4RVRA 4Y03A 5F25A 3JVKA 4CL9A 3O37A 5LKXA 4HXOA 3S92A 4LC2A 4LYWA 5DYCA 5CRZA 5I86A 4YC9A 5CUBA 5D25A 5D3SA 4NQNA 4TT6A 4TU6A 4YYJA 3P1DA 4IR3A 4DONA 3O35A 2L84A 4C66A 5D3JA 4UYHA 5G4RA 3O36A 4UIVA 4WHUA 2H60A 4CUUA 1JSPB 2WP1A 5DW1A 3IU6A 4NUCA 5EA1A 4UYEA 4XYAA 5I7XA 4O7CA 5F1LA 4PKLA 4HXLA 1F68A 5DLXA 4CUPA 5DX4A 4NYVA 4YYIA 3UW9A 4IR4A 5FFYA 4QB3A 5H85A 2WP2A 5D0CA 4UITA 4KV1A 4AKNA 5I1QA 5AMFA 4HXMA 2RNWA 5HRWA 4O72A 5HFQA 4IOOA 5E9VA 3IU5A 5EQ1A 4HXKA 2I8NA 5F1HA 4Z93A 3S91A 5C85A 5D3HA 2FSAA 5ENGA 4PCEA 3UVYA 5FE7A 4O7AA 5C8GA 2RS9B 3D7CA 3G0JA 4PY6A 2E3KA 4O71A 4BJXA 2RO1A 2RFJA 4Z6HA 1JM4B 4QNSA 2E7NA 5H1TA 4UIWA 5C89A 4YYMA 5C87A 4YYDA 5HFRA 5I83A 3P1CA 4KV4A 3LJWA 3HMFA 5I80A 2D82A 1WUMA 4O74A 4TT2A 5EP7A 2RNYA 5ENEA 5LUUA 4HXNA 5DBMA 5FE0A 4LDFA 5FG4A 5AMEA 5I7YA 2YDWA 5EVAA 5CQ3A 5EM3A 3SVFA 3U5OA 3UVDA 4QR5A 2YW5A 2OUOA 4F3IA 5FG5A 5FFWA 5AD3A 5CQ6A 4QYDA 5F63A 5ENCA 5TCMA 3U5JA 5L8TA 5ENFA 3UV2A 5CUGA 5FE2A 4NRCA 5D3TA 5D3NA 4Z1SA 5F62A 4O76A 5ENJA 4QBMA 1EQFA 5C7NA 4XY8A 3HMEA 4X2IA 4NR7A 5F36A 5FDZA 5LVQA 5EPRA 4UYFB 4YY4A 3LQJA 3MUKA 3AADA 5CY9A 5E9IA 5HLSA 4J0RA 5KO4A 4O78A 4J1PA 4A9MA 5JI8A 4MEOA 5EWHA 4QSSA 2F6NA 5I40A 5LKTA 4YADA 5A5SA 5HQ5A 4NR8A 4QC1A 4BHWA 5I29A 5E3DA 4QC3A 5F2PA 4QSVA 5II2A 3MXFA 2N9GA 3QZTA 5FE1A 4MR3A 4BW3A 2DKWA 5BT4A 1N72A 4NR6A 5FE6A 4UIYA 4NQMA 4CUSA 5CUEA 5F3AA 4YYHA 5EISA 2YEMA 4CLBA 4Q0OA 4QYLA 4NS5A 2NXBA 2DWWA 5KTUA 4OUFA 5HRVA 5DY7A 4N3WA 5D3LA 5E3GA 4YYNA 5IGKA 4TTEA 3DWYA 4WHWA 5DYXA 3P1FA 2R0SA 3P1EA 5HQ6A 5E9YA 5IBNA 2R0YA 4QY4A 4TZ8A 4IR6A 5FH7A 5G4SA 3ZYUA 4A9KA 4BW1A 5FB0A 4CUTA 4NRAA 3O34A 5K29A 3DAIA 1ZS5A 3UVWA 4QR4A 3QZSA 3UV4A 5E73A 4A9HA 4QUTA 3U5NA 4BW4A 5ETDA 5I89A 4GPJA 5E9MA 5HEMA 5CU8A 4HXSA 4A9NA 5KTWA 5DKCA 4UIUA 5E0RA 4LZRA 4O7FA 5CP5A 3MB3A 4A9JA 2DVVA 4O77A 5KHMA 5IGNA 3MQMA 2LSPB 4A9LA 5JWMA 5A85A 5IIDA 4HXRA 2L5EA 5A83A 4MR4A 4LYIA 4Z1QA 4Z6IA 5HRXA 5EWCA 4HBYA 4QZSA 4QR3A 4O75A 5CS8A 4LR6A 5IG6A 4N4IA 5DKHA 5FH6A 4A9EA 4A9OA 4ALHA 5IGMA 5C4QA 5LVRA 4QSWA 5E74A 5A5QA 4QEWA 3U5MA 2D9EA 4N4FA 4YH4A 5J0DA 5ENHA 2YQDA 5EWVA 4YYKA 4TZ2A 5A5RA 5BT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E96 A;  5L96 A;  4PS5 A;  4YAX A;  5EWW A;  4HBV A;  2RNX A;  5CUA A;  4NYX A;  3G0L A;  1X0J A;  4HXP A;  4MEP A;  5LKU A;  4XY9 A;  5A7C A;  4NR4 A;  4XUA A;  4OGJ A;  3GG3 A;  5L99 A;  4YAT A;  5DYU A;  4FLP A;  5FH8 A;  4O70 A;  5E9K A;  4LYS A;  5LJ2 A;  2R0V A;  3SVH A;  2DVR A;  2YEL A;  5CRM A;  3FKM X;  4IOR A;  5DW2 A;  4NUD A;  5EPB A;  5HEN A;  5CQA A;  5CQ5 A;  3NXB A;  5AD2 A;  5HM0 A;  5D7X A;  5F60 A;  2RI7 A;  4PCI A;  3U5L A;  5A5P A;  4J3I A;  5CQ7 A;  5CTL A;  4CUQ A;  2F6J A;  2KTB B;  5CGP A;  5ACY A;  3Q2E A;  5L97 A;  5BT5 A;  4ZC9 A;  5EK9 A;  5F5Z A;  5FE3 A;  5EPS A;  5LJ1 A;  4MEQ A;  3LQH A;  5CZG A;  3MB4 A;  3ONI A;  4QST A;  5EV9 A;  5HJC A;  2E7O A;  4TT4 A;  5ETB A;  2L85 A;  3JVJ A;  4NXJ A;  4TU4 A;  5KTX A;  5IGL A;  5H1V A;  4WIV A;  5E7D A;  4O7E A;  4QUU A;  4QSR A;  5HEL A;  2MJV B;  5CUD A;  4KCX A;  3Q2F A;  4QEU A;  4J0S A;  4NRB A;  4UYF A;  4BW2 A;  4OGI A;  5EWD A;  4QEV A;  5DKD A;  5E9L A;  4HBW A;  5D26 A;  4YBT A;  4TS8 A;  4YH3 A;  3RCW A;  3I3J A;  3O33 A;  3JVM A;  5FE4 A;  4TYL A;  5CQ8 A;  3P5O A;  3QZV A;  2DVS A;  5HQ7 A;  5FE8 A;  4NYW A;  5COI A;  3SVG A;  4MR5 A;  2I7K A;  5L8U A;  4UYD A;  4N4H A;  4LZS A;  3HMH A;  5EGU A;  4A9I A;  4TQN A;  5DLZ A;  5D3P A;  5DYA A;  4XUB A;  5F61 A;  3AQA A;  2DVQ A;  4CFL A;  5EU1 A;  3K2J A;  4CUR A;  4QSX A;  4Q0N A;  5EI4 A;  5A5O A;  4UYG A;  4ZQL A;  5CQ4 A;  5A81 A;  2GRC A;  3U5P A;  2G4A A;  3U5K A;  3MUL A;  3UVX A;  4LZ2 A;  4UIX A;  4QSU A;  4PTB A;  2DAT A;  5D24 A;  5I88 A;  5FG6 A;  5FB1 A;  4NR5 A;  5KU3 A;  4UIZ A;  4C67 A;  1WUG A;  4LRG A;  5CFW A;  5CQT A;  5L98 A;  4MEN A;  4NUE A;  5II1 A;  5FE5 A;  5TB6 A;  5A5N A;  3LQI A;  5FFV A;  5LKZ A;  4MR6 A;  5ENI A;  5HCL A;  4IR5 A;  2OO1 A;  4YAB A;  5D3R A;  2OSS A;  2YEK A;  4N4G A;  3LXJ A;  4ALG A;  4QSQ A;  4YBM A;  4O7B A;  5FE9 A;  5H1U A;  4YY6 A;  4YK0 A;  5DFC A;  4A9F A;  5EIC A;  5A82 A;  4YYG A;  4ZW1 A;  4IOQ A;  3JVL A;  5DFB A;  5ENB A;  5DFD A;  4NR9 A;  5CPE A;  4CFK A;  5FBX A;  4QSP A;  5CUC A;  2R10 A;  4HBX A;  1E6I A;  5LJ0 A;  4YBS A;  3UV5 A;  3TLP A;  2YYN A;  4RVR A;  4Y03 A;  5F25 A;  3JVK A;  4CL9 A;  3O37 A;  5LKX A;  4HXO A;  3S92 A;  4LC2 A;  4LYW A;  5DYC A;  5CRZ A;  5I86 A;  4YC9 A;  5CUB A;  5D25 A;  5D3S A;  4NQN A;  4TT6 A;  4TU6 A;  4YYJ A;  3P1D A;  4IR3 A;  4DON A;  3O35 A;  2L84 A;  4C66 A;  5D3J A;  4UYH A;  5G4R A;  3O36 A;  4UIV A;  4WHU A;  2H60 A;  4CUU A;  1JSP B;  2WP1 A;  5DW1 A;  3IU6 A;  4NUC A;  5EA1 A;  4UYE A;  4XYA A;  5I7X A;  4O7C A;  5F1L A;  4PKL A;  4HXL A;  1F68 A;  5DLX A;  4CUP A;  5DX4 A;  4NYV A;  4YYI A;  3UW9 A;  4IR4 A;  5FFY A;  4QB3 A;  5H85 A;  2WP2 A;  5D0C A;  4UIT A;  4KV1 A;  4AKN A;  5I1Q A;  5AMF A;  4HXM A;  2RNW A;  5HRW A;  4O72 A;  5HFQ A;  4IOO A;  5E9V A;  3IU5 A;  5EQ1 A;  4HXK A;  2I8N A;  5F1H A;  4Z93 A;  3S91 A;  5C85 A;  5D3H A;  2FSA A;  5ENG A;  4PCE A;  3UVY A;  5FE7 A;  4O7A A;  5C8G A;  2RS9 B;  3D7C A;  3G0J A;  4PY6 A;  2E3K A;  4O71 A;  4BJX A;  2RO1 A;  2RFJ A;  4Z6H A;  1JM4 B;  4QNS A;  2E7N A;  5H1T A;  4UIW A;  5C89 A;  4YYM A;  5C87 A;  4YYD A;  5HFR A;  5I83 A;  3P1C A;  4KV4 A;  3LJW A;  3HMF A;  5I80 A;  2D82 A;  1WUM A;  4O74 A;  4TT2 A;  5EP7 A;  2RNY A;  5ENE A;  5LUU A;  4HXN A;  5DBM A;  5FE0 A;  4LDF A;  5FG4 A;  5AME A;  5I7Y A;  2YDW A;  5EVA A;  5CQ3 A;  5EM3 A;  3SVF A;  3U5O A;  3UVD A;  4QR5 A;  2YW5 A;  2OUO A;  4F3I A;  5FG5 A;  5FFW A;  5AD3 A;  5CQ6 A;  4QYD A;  5F63 A;  5ENC A;  5TCM A;  3U5J A;  5L8T A;  5ENF A;  3UV2 A;  5CUG A;  5FE2 A;  4NRC A;  5D3T A;  5D3N A;  4Z1S A;  5F62 A;  4O76 A;  5ENJ A;  4QBM A;  1EQF A;  5C7N A;  4XY8 A;  3HME A;  4X2I A;  4NR7 A;  5F36 A;  5FDZ A;  5LVQ A;  5EPR A;  4UYF B;  4YY4 A;  3LQJ A;  3MUK A;  3AAD A;  5CY9 A;  5E9I A;  5HLS A;  4J0R A;  5KO4 A;  4O78 A;  4J1P A;  4A9M A;  5JI8 A;  4MEO A;  5EWH A;  4QSS A;  2F6N A;  5I40 A;  5LKT A;  4YAD A;  5A5S A;  5HQ5 A;  4NR8 A;  4QC1 A;  4BHW A;  5I29 A;  5E3D A;  4QC3 A;  5F2P A;  4QSV A;  5II2 A;  3MXF A;  2N9G A;  3QZT A;  5FE1 A;  4MR3 A;  4BW3 A;  2DKW A;  5BT4 A;  1N72 A;  4NR6 A;  5FE6 A;  4UIY A;  4NQM A;  4CUS A;  5CUE A;  5F3A A;  4YYH A;  5EIS A;  2YEM A;  4CLB A;  4Q0O A;  4QYL A;  4NS5 A;  2NXB A;  2DWW A;  5KTU A;  4OUF A;  5HRV A;  5DY7 A;  4N3W A;  5D3L A;  5E3G A;  4YYN A;  5IGK A;  4TTE A;  3DWY A;  4WHW A;  5DYX A;  3P1F A;  2R0S A;  3P1E A;  5HQ6 A;  5E9Y A;  5IBN A;  2R0Y A;  4QY4 A;  4TZ8 A;  4IR6 A;  5FH7 A;  5G4S A;  3ZYU A;  4A9K A;  4BW1 A;  5FB0 A;  4CUT A;  4NRA A;  3O34 A;  5K29 A;  3DAI A;  1ZS5 A;  3UVW A;  4QR4 A;  3QZS A;  3UV4 A;  5E73 A;  4A9H A;  4QUT A;  3U5N A;  4BW4 A;  5ETD A;  5I89 A;  4GPJ A;  5E9M A;  5HEM A;  5CU8 A;  4HXS A;  4A9N A;  5KTW A;  5DKC A;  4UIU A;  5E0R A;  4LZR A;  4O7F A;  5CP5 A;  3MB3 A;  4A9J A;  2DVV A;  4O77 A;  5KHM A;  5IGN A;  3MQM A;  2LSP B;  4A9L A;  5JWM A;  5A85 A;  5IID A;  4HXR A;  2L5E A;  5A83 A;  4MR4 A;  4LYI A;  4Z1Q A;  4Z6I A;  5HRX A;  5EWC A;  4HBY A;  4QZS A;  4QR3 A;  4O75 A;  5CS8 A;  4LR6 A;  5IG6 A;  4N4I A;  5DKH A;  5FH6 A;  4A9E A;  4A9O A;  4ALH A;  5IGM A;  5C4Q A;  5LVR A;  4QSW A;  5E74 A;  5A5Q A;  4QEW A;  3U5M A;  2D9E A;  4N4F A;  4YH4 A;  5J0D A;  5ENH A;  2YQD A;  5EWV A;  4YYK A;  4TZ2 A;  5A5R A;  5BT3 A; 
#chains in the Genus database with same CATH topology
 3VKH A;  4E96 A;  5L96 A;  4PS5 A;  4YAX A;  5EWW A;  4HBV A;  2RNX A;  5CUA A;  4NYX A;  3G0L A;  1X0J A;  4HXP A;  4MEP A;  5LKU A;  4XY9 A;  5A7C A;  4NR4 A;  4XUA A;  4OGJ A;  3GG3 A;  5L99 A;  4YAT A;  5DYU A;  4FLP A;  5FH8 A;  4O70 A;  5E9K A;  4LYS A;  5LJ2 A;  2R0V A;  3SVH A;  2DVR A;  2YEL A;  5CRM A;  3FKM X;  4IOR A;  5DW2 A;  4NUD A;  5EPB A;  5HEN A;  5CQA A;  5CQ5 A;  3NXB A;  5AD2 A;  5HM0 A;  5D7X A;  5F60 A;  2RI7 A;  4PCI A;  3U5L A;  5A5P A;  4J3I A;  5CQ7 A;  5CTL A;  2EJN A;  4CUQ A;  2F6J A;  2KTB B;  5CGP A;  5ACY A;  3Q2E A;  5L97 A;  5BT5 A;  4ZC9 A;  5EK9 A;  5F5Z A;  5FE3 A;  5EPS A;  5LJ1 A;  4MEQ A;  3LQH A;  5CZG A;  3MB4 A;  3ONI A;  4QST A;  5EV9 A;  5HJC A;  2E7O A;  4TT4 A;  5ETB A;  2L85 A;  3JVJ A;  4NXJ A;  4TU4 A;  5KTX A;  5IGL A;  5H1V A;  4WIV A;  5E7D A;  4O7E A;  4QUU A;  4QSR A;  5HEL A;  2MJV B;  5CUD A;  4KCX A;  3Q2F A;  4QEU A;  4J0S A;  4NRB A;  4UYF A;  3D1D A;  4BW2 A;  4OGI A;  5EWD A;  4QEV A;  5DKD A;  5E9L A;  4HBW A;  5D26 A;  4YBT A;  4TS8 A;  4YH3 A;  3RCW A;  3I3J A;  3O33 A;  3JVM A;  5FE4 A;  4TYL A;  5CQ8 A;  3P5O A;  3QZV A;  2DVS A;  5HQ7 A;  5FE8 A;  4NYW A;  5COI A;  3SVG A;  4MR5 A;  2I7K A;  5L8U A;  4UYD A;  4N4H A;  4LZS A;  3HMH A;  5EGU A;  4A9I A;  4TQN A;  5DLZ A;  5D3P A;  5DYA A;  4XUB A;  5F61 A;  3AQA A;  2DVQ A;  4CFL A;  5EU1 A;  3K2J A;  4CUR A;  4QSX A;  4Q0N A;  5EI4 A;  5A5O A;  4UYG A;  4ZQL A;  5CQ4 A;  5A81 A;  2GRC A;  3U5P A;  2G4A A;  3U5K A;  3MUL A;  3UVX A;  4LZ2 A;  4UIX A;  4QSU A;  4PTB A;  2DAT A;  5D24 A;  5I88 A;  5FG6 A;  4AKI A;  5FB1 A;  4NR5 A;  5KU3 A;  4UIZ A;  4C67 A;  3ERR A;  1WUG A;  4LRG A;  5CFW A;  5CQT A;  5L98 A;  4MEN A;  4NUE A;  5II1 A;  5FE5 A;  5TB6 A;  5A5N A;  3LQI A;  5FFV A;  5LKZ A;  4MR6 A;  5ENI A;  5HCL A;  4IR5 A;  2OO1 A;  4YAB A;  5D3R A;  2OSS A;  2YEK A;  4N4G A;  3LXJ A;  4ALG A;  4QSQ A;  4YBM A;  4O7B A;  5FE9 A;  5H1U A;  4YY6 A;  4YK0 A;  5DFC A;  4A9F A;  5EIC A;  5A82 A;  4YYG A;  4ZW1 A;  4IOQ A;  3JVL A;  5DFB A;  5ENB A;  5DFD A;  4NR9 A;  5CPE A;  4CFK A;  5FBX A;  4QSP A;  5CUC A;  2R10 A;  4HBX A;  1E6I A;  5LJ0 A;  4YBS A;  3UV5 A;  3TLP A;  2YYN A;  4RVR A;  4Y03 A;  5F25 A;  3JVK A;  4CL9 A;  3O37 A;  5LKX A;  4HXO A;  3S92 A;  4LC2 A;  4LYW A;  5DYC A;  5CRZ A;  5I86 A;  4YC9 A;  5CUB A;  5D25 A;  5D3S A;  4NQN A;  4TT6 A;  4TU6 A;  4YYJ A;  3P1D A;  4IR3 A;  4DON A;  3O35 A;  2L84 A;  4C66 A;  5D3J A;  4UYH A;  5G4R A;  3O36 A;  4UIV A;  4WHU A;  2H60 A;  4CUU A;  1JSP B;  2WP1 A;  5DW1 A;  3IU6 A;  4NUC A;  5EA1 A;  4UYE A;  4XYA A;  5I7X A;  4O7C A;  5F1L A;  4PKL A;  4HXL A;  1F68 A;  5DLX A;  4CUP A;  5DX4 A;  4NYV A;  4YYI A;  3UW9 A;  4IR4 A;  5FFY A;  4QB3 A;  5H85 A;  2WP2 A;  5D0C A;  4UIT A;  4KV1 A;  4AKN A;  5I1Q A;  5AMF A;  4HXM A;  2RNW A;  5HRW A;  4O72 A;  5HFQ A;  4IOO A;  5E9V A;  3IU5 A;  5EQ1 A;  4HXK A;  2I8N A;  5F1H A;  4Z93 A;  3S91 A;  5C85 A;  5D3H A;  2FSA A;  5ENG A;  4PCE A;  3UVY A;  5FE7 A;  4O7A A;  5C8G A;  2RS9 B;  3D7C A;  3G0J A;  4PY6 A;  2E3K A;  4O71 A;  4BJX A;  2RO1 A;  2RFJ A;  4Z6H A;  1JM4 B;  4QNS A;  2E7N A;  5H1T A;  4UIW A;  5C89 A;  4YYM A;  5C87 A;  4YYD A;  5HFR A;  5I83 A;  3P1C A;  4KV4 A;  3LJW A;  3HMF A;  5I80 A;  2D82 A;  1WUM A;  4O74 A;  4TT2 A;  5EP7 A;  2RNY A;  5ENE A;  5LUU A;  4HXN A;  5DBM A;  5FE0 A;  4LDF A;  5FG4 A;  5AME A;  5I7Y A;  2YDW A;  5EVA A;  5CQ3 A;  5EM3 A;  3SVF A;  3U5O A;  3UVD A;  4QR5 A;  2YW5 A;  2OUO A;  4F3I A;  5FG5 A;  5FFW A;  5AD3 A;  5CQ6 A;  4QYD A;  5F63 A;  5ENC A;  5TCM A;  3U5J A;  5L8T A;  5ENF A;  3UV2 A;  5CUG A;  5FE2 A;  4NRC A;  5D3T A;  5D3N A;  4Z1S A;  5F62 A;  4O76 A;  5ENJ A;  4QBM A;  1EQF A;  5C7N A;  4XY8 A;  3HME A;  4X2I A;  4NR7 A;  5F36 A;  5FDZ A;  5LVQ A;  5EPR A;  4UYF B;  4YY4 A;  3LQJ A;  3MUK A;  3AAD A;  5CY9 A;  5E9I A;  5HLS A;  4J0R A;  5KO4 A;  4O78 A;  4J1P A;  4A9M A;  5JI8 A;  4MEO A;  4AI6 A;  5EWH A;  4QSS A;  2F6N A;  5I40 A;  5LKT A;  4YAD A;  5A5S A;  5HQ5 A;  4NR8 A;  4QC1 A;  4BHW A;  5I29 A;  5E3D A;  4QC3 A;  5F2P A;  4QSV A;  5II2 A;  3MXF A;  2N9G A;  3QZT A;  5FE1 A;  4MR3 A;  4BW3 A;  2DKW A;  5BT4 A;  1N72 A;  4NR6 A;  5FE6 A;  3D1B A;  4UIY A;  4NQM A;  4CUS A;  5CUE A;  5F3A A;  4YYH A;  5EIS A;  2YEM A;  4CLB A;  4Q0O A;  4QYL A;  4NS5 A;  2NXB A;  2DWW A;  5KTU A;  4OUF A;  5HRV A;  5DY7 A;  4N3W A;  5D3L A;  5E3G A;  4YYN A;  5IGK A;  4TTE A;  3DWY A;  4WHW A;  3VKG A;  5DYX A;  3P1F A;  2R0S A;  3P1E A;  5HQ6 A;  5E9Y A;  5IBN A;  2R0Y A;  4QY4 A;  4TZ8 A;  4IR6 A;  5FH7 A;  5G4S A;  3ZYU A;  4A9K A;  4BW1 A;  4AKG A;  5FB0 A;  4CUT A;  4NRA A;  3O34 A;  5K29 A;  3DAI A;  1ZS5 A;  3UVW A;  4QR4 A;  3QZS A;  3UV4 A;  5E73 A;  4A9H A;  4QUT A;  3U5N A;  4BW4 A;  1ZKR A;  5ETD A;  5I89 A;  4GPJ A;  5E9M A;  5HEM A;  5CU8 A;  4HXS A;  4A9N A;  5KTW A;  5DKC A;  4UIU A;  5E0R A;  4LZR A;  4O7F A;  5CP5 A;  4AKH A;  3MB3 A;  4A9J A;  2DVV A;  4O77 A;  5KHM A;  5IGN A;  3MQM A;  2LSP B;  4A9L A;  5JWM A;  5A85 A;  5IID A;  4HXR A;  2L5E A;  5A83 A;  4MR4 A;  1PUO A;  4LYI A;  4Z1Q A;  4Z6I A;  5HRX A;  5EWC A;  4HBY A;  4QZS A;  4QR3 A;  4O75 A;  5CS8 A;  4LR6 A;  5IG6 A;  4N4I A;  5DKH A;  5FH6 A;  4A9E A;  4A9O A;  4ALH A;  5IGM A;  5C4Q A;  5LVR A;  4QSW A;  5E74 A;  5A5Q A;  4QEW A;  3U5M A;  2D9E A;  4N4F A;  4YH4 A;  5J0D A;  5ENH A;  2YQD A;  5EWV A;  4YYK A;  4TZ2 A;  5A5R A;  5BT3 A; 
#chains in the Genus database with same CATH homology
 4E96 A;  5L96 A;  4PS5 A;  4YAX A;  5EWW A;  4HBV A;  2RNX A;  5CUA A;  4NYX A;  3G0L A;  1X0J A;  4HXP A;  4MEP A;  5LKU A;  4XY9 A;  5A7C A;  4NR4 A;  4XUA A;  4OGJ A;  3GG3 A;  5L99 A;  4YAT A;  5DYU A;  4FLP A;  5FH8 A;  4O70 A;  5E9K A;  4LYS A;  5LJ2 A;  2R0V A;  3SVH A;  2DVR A;  2YEL A;  5CRM A;  3FKM X;  4IOR A;  5DW2 A;  4NUD A;  5EPB A;  5HEN A;  5CQA A;  5CQ5 A;  3NXB A;  5AD2 A;  5HM0 A;  5D7X A;  5F60 A;  2RI7 A;  4PCI A;  3U5L A;  5A5P A;  4J3I A;  5CQ7 A;  5CTL A;  4CUQ A;  2F6J A;  2KTB B;  5CGP A;  5ACY A;  3Q2E A;  5L97 A;  5BT5 A;  4ZC9 A;  5EK9 A;  5F5Z A;  5FE3 A;  5EPS A;  5LJ1 A;  4MEQ A;  3LQH A;  5CZG A;  3MB4 A;  3ONI A;  4QST A;  5EV9 A;  5HJC A;  2E7O A;  4TT4 A;  5ETB A;  2L85 A;  3JVJ A;  4NXJ A;  4TU4 A;  5KTX A;  5IGL A;  5H1V A;  4WIV A;  5E7D A;  4O7E A;  4QUU A;  4QSR A;  5HEL A;  2MJV B;  5CUD A;  4KCX A;  3Q2F A;  4QEU A;  4J0S A;  4NRB A;  4UYF A;  4BW2 A;  4OGI A;  5EWD A;  4QEV A;  5DKD A;  5E9L A;  4HBW A;  5D26 A;  4YBT A;  4TS8 A;  4YH3 A;  3RCW A;  3I3J A;  3O33 A;  3JVM A;  5FE4 A;  4TYL A;  5CQ8 A;  3P5O A;  3QZV A;  2DVS A;  5HQ7 A;  5FE8 A;  4NYW A;  5COI A;  3SVG A;  4MR5 A;  2I7K A;  5L8U A;  4UYD A;  4N4H A;  4LZS A;  3HMH A;  5EGU A;  4A9I A;  4TQN A;  5DLZ A;  5D3P A;  5DYA A;  4XUB A;  5F61 A;  3AQA A;  2DVQ A;  4CFL A;  5EU1 A;  3K2J A;  4CUR A;  4QSX A;  4Q0N A;  5EI4 A;  5A5O A;  4UYG A;  4ZQL A;  5CQ4 A;  5A81 A;  2GRC A;  3U5P A;  2G4A A;  3U5K A;  3MUL A;  3UVX A;  4LZ2 A;  4UIX A;  4QSU A;  4PTB A;  2DAT A;  5D24 A;  5I88 A;  5FG6 A;  5FB1 A;  4NR5 A;  5KU3 A;  4UIZ A;  4C67 A;  1WUG A;  4LRG A;  5CFW A;  5CQT A;  5L98 A;  4MEN A;  4NUE A;  5II1 A;  5FE5 A;  5TB6 A;  5A5N A;  3LQI A;  5FFV A;  5LKZ A;  4MR6 A;  5ENI A;  5HCL A;  4IR5 A;  2OO1 A;  4YAB A;  5D3R A;  2OSS A;  2YEK A;  4N4G A;  3LXJ A;  4ALG A;  4QSQ A;  4YBM A;  4O7B A;  5FE9 A;  5H1U A;  4YY6 A;  4YK0 A;  5DFC A;  4A9F A;  5EIC A;  5A82 A;  4YYG A;  4ZW1 A;  4IOQ A;  3JVL A;  5DFB A;  5ENB A;  5DFD A;  4NR9 A;  5CPE A;  4CFK A;  5FBX A;  4QSP A;  5CUC A;  2R10 A;  4HBX A;  1E6I A;  5LJ0 A;  4YBS A;  3UV5 A;  3TLP A;  2YYN A;  4RVR A;  4Y03 A;  5F25 A;  3JVK A;  4CL9 A;  3O37 A;  5LKX A;  4HXO A;  3S92 A;  4LC2 A;  4LYW A;  5DYC A;  5CRZ A;  5I86 A;  4YC9 A;  5CUB A;  5D25 A;  5D3S A;  4NQN A;  4TT6 A;  4TU6 A;  4YYJ A;  3P1D A;  4IR3 A;  4DON A;  3O35 A;  2L84 A;  4C66 A;  5D3J A;  4UYH A;  5G4R A;  3O36 A;  4UIV A;  4WHU A;  2H60 A;  4CUU A;  1JSP B;  2WP1 A;  5DW1 A;  3IU6 A;  4NUC A;  5EA1 A;  4UYE A;  4XYA A;  5I7X A;  4O7C A;  5F1L A;  4PKL A;  4HXL A;  1F68 A;  5DLX A;  4CUP A;  5DX4 A;  4NYV A;  4YYI A;  3UW9 A;  4IR4 A;  5FFY A;  4QB3 A;  5H85 A;  2WP2 A;  5D0C A;  4UIT A;  4KV1 A;  4AKN A;  5I1Q A;  5AMF A;  4HXM A;  2RNW A;  5HRW A;  4O72 A;  5HFQ A;  4IOO A;  5E9V A;  3IU5 A;  5EQ1 A;  4HXK A;  2I8N A;  5F1H A;  4Z93 A;  3S91 A;  5C85 A;  5D3H A;  2FSA A;  5ENG A;  4PCE A;  3UVY A;  5FE7 A;  4O7A A;  5C8G A;  2RS9 B;  3D7C A;  3G0J A;  4PY6 A;  2E3K A;  4O71 A;  4BJX A;  2RO1 A;  2RFJ A;  4Z6H A;  1JM4 B;  4QNS A;  2E7N A;  5H1T A;  4UIW A;  5C89 A;  4YYM A;  5C87 A;  4YYD A;  5HFR A;  5I83 A;  3P1C A;  4KV4 A;  3LJW A;  3HMF A;  5I80 A;  2D82 A;  1WUM A;  4O74 A;  4TT2 A;  5EP7 A;  2RNY A;  5ENE A;  5LUU A;  4HXN A;  5DBM A;  5FE0 A;  4LDF A;  5FG4 A;  5AME A;  5I7Y A;  2YDW A;  5EVA A;  5CQ3 A;  5EM3 A;  3SVF A;  3U5O A;  3UVD A;  4QR5 A;  2YW5 A;  2OUO A;  4F3I A;  5FG5 A;  5FFW A;  5AD3 A;  5CQ6 A;  4QYD A;  5F63 A;  5ENC A;  5TCM A;  3U5J A;  5L8T A;  5ENF A;  3UV2 A;  5CUG A;  5FE2 A;  4NRC A;  5D3T A;  5D3N A;  4Z1S A;  5F62 A;  4O76 A;  5ENJ A;  4QBM A;  1EQF A;  5C7N A;  4XY8 A;  3HME A;  4X2I A;  4NR7 A;  5F36 A;  5FDZ A;  5LVQ A;  5EPR A;  4UYF B;  4YY4 A;  3LQJ A;  3MUK A;  3AAD A;  5CY9 A;  5E9I A;  5HLS A;  4J0R A;  5KO4 A;  4O78 A;  4J1P A;  4A9M A;  5JI8 A;  4MEO A;  5EWH A;  4QSS A;  2F6N A;  5I40 A;  5LKT A;  4YAD A;  5A5S A;  5HQ5 A;  4NR8 A;  4QC1 A;  4BHW A;  5I29 A;  5E3D A;  4QC3 A;  5F2P A;  4QSV A;  5II2 A;  3MXF A;  2N9G A;  3QZT A;  5FE1 A;  4MR3 A;  4BW3 A;  2DKW A;  5BT4 A;  1N72 A;  4NR6 A;  5FE6 A;  4UIY A;  4NQM A;  4CUS A;  5CUE A;  5F3A A;  4YYH A;  5EIS A;  2YEM A;  4CLB A;  4Q0O A;  4QYL A;  4NS5 A;  2NXB A;  2DWW A;  5KTU A;  4OUF A;  5HRV A;  5DY7 A;  4N3W A;  5D3L A;  5E3G A;  4YYN A;  5IGK A;  4TTE A;  3DWY A;  4WHW A;  5DYX A;  3P1F A;  2R0S A;  3P1E A;  5HQ6 A;  5E9Y A;  5IBN A;  2R0Y A;  4QY4 A;  4TZ8 A;  4IR6 A;  5FH7 A;  5G4S A;  3ZYU A;  4A9K A;  4BW1 A;  5FB0 A;  4CUT A;  4NRA A;  3O34 A;  5K29 A;  3DAI A;  1ZS5 A;  3UVW A;  4QR4 A;  3QZS A;  3UV4 A;  5E73 A;  4A9H A;  4QUT A;  3U5N A;  4BW4 A;  5ETD A;  5I89 A;  4GPJ A;  5E9M A;  5HEM A;  5CU8 A;  4HXS A;  4A9N A;  5KTW A;  5DKC A;  4UIU A;  5E0R A;  4LZR A;  4O7F A;  5CP5 A;  3MB3 A;  4A9J A;  2DVV A;  4O77 A;  5KHM A;  5IGN A;  3MQM A;  2LSP B;  4A9L A;  5JWM A;  5A85 A;  5IID A;  4HXR A;  2L5E A;  5A83 A;  4MR4 A;  4LYI A;  4Z1Q A;  4Z6I A;  5HRX A;  5EWC A;  4HBY A;  4QZS A;  4QR3 A;  4O75 A;  5CS8 A;  4LR6 A;  5IG6 A;  4N4I A;  5DKH A;  5FH6 A;  4A9E A;  4A9O A;  4ALH A;  5IGM A;  5C4Q A;  5LVR A;  4QSW A;  5E74 A;  5A5Q A;  4QEW A;  3U5M A;  2D9E A;  4N4F A;  4YH4 A;  5J0D A;  5ENH A;  2YQD A;  5EWV A;  4YYK A;  4TZ2 A;  5A5R A;  5BT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...