5HRVA

Crystal structure of the fifth bromodomain of human pb1 in complex with 1-ethylisochromeno[3,4-c]pyrazol-5(2h)-one) compound
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
115
structure length
115
Chain Sequence
SKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein polybromo-1
publication title Discovery and Optimization of a Selective Ligand for the Switch/Sucrose Nonfermenting-Related Bromodomains of Polybromo Protein-1 by the Use of Virtual Screening and Hydration Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2016-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5hrvA00
1WUMA 2GRCA 3IU5A 5ENCA 4ZW1A 5ENIA 4N4HA 3UV2A 2RNYA 3UVDA 4CL9A 5A81A 4N4GA 4MR5A 4NUDA 5A85A 5DYXA 5CTLA 4QSXA 5IGKA 5EU1A 2DVSA 4IR4A 4A9FA 4YY4A 5HFRA 5AD3A 5IIDA 5L8UA 5LJ1A 5KTUA 4YBTA 5TB6A 4C66A 5E9LA 4A9MA 2LSPB 3O36A 1X0JA 4QY4A 4NXJA 4HBXA 4TU4A 5CQ8A 2DKWA 4N4FA 4O7EA 5C7NA 5KO4A 4O71A 4O7AA 5EPBA 4NR7A 3MULA 4LZSA 4MEQA 4XUBA 4CUUA 4O7FA 5FFVA 5CQAA 5DKHA 5D3JA 5FE9A 5FG4A 5LVRA 2YYNA 5C85A 4IORA 5EV9A 5FH6A 3G0JA 5E9VA 3HMFA 4HXNA 5ENJA 5DW2A 5L97A 5FE6A 2YDWA 5II1A 3JVKA 4CLBA 4NQNA 5CUBA 5FE3A 5HENA 2FSAA 4LRGA 5A83A 5CPEA 4UYEA 2RNWA 5F2PA 4QSWA 5F5ZA 5DYUA 3MUKA 5IGLA 1ZS5A 5ETDA 4Q0NA 5FB1A 2YELA 2R0VA 3MXFA 4NYWA 5D3SA 5F62A 5DBMA 4NUCA 4CUTA 3DWYA 5I89A 3AADA 3P1CA 5IG6A 3U5LA 4YY6A 2OSSA 4NR9A 4O7BA 4YC9A 3AQAA 5C87A 5CUGA 4TT2A 4X2IA 5EPRA 5EGUA 5EK9A 4HXMA 5EM3A 4PS5A 4XUAA 3IU6A 4UYHA 5LJ2A 3LXJA 4NUEA 5H1UA 2R0YA 2H60A 5FB0A 3UW9A 2DWWA 2WP1A 2MJVB 5F60A 5A7CA 2WP2A 5CQ3A 3HMHA 4UYFB 1N72A 5LKUA 4MR3A 4QEWA 3D7CA 4BJXA 2L84A 5FG6A 5DX4A 4J1PA 2RFJA 4PCIA 2DVQA 5EWDA 5HLSA 5LJ0A 5FE2A 5HQ6A 5J0DA 5CU8A 4LYIA 4A9LA 2DVRA 2RO1A 4QBMA 4UIXA 5E73A 5FH7A 4BW2A 5FE8A 4YH4A 5ENHA 5ACYA 4WIVA 5A82A 4O74A 4HBWA 4HXOA 4Z1SA 5A5QA 5CQTA 5FE5A 4LZRA 4YATA 4UYGA 4LYSA 4GPJA 3QZSA 4YYKA 4UITA 4TT6A 4QUUA 4TTEA 3U5OA 4IOOA 4O76A 5LVQA 3LQJA 4J0SA 5F63A 3QZVA 5IGNA 3U5NA 4Z6HA 4HXKA 5E0RA 5FFWA 3P1FA 4XY8A 4BW1A 5A5OA 4HBYA 5EWWA 3ONIA 4YH3A 4PY6A 3QZTA 3U5JA 5HRVA 4QR5A 5E9MA 4NR8A 5BT3A 5EWHA 4Z93A 5II2A 1JM4B 4QZSA 5I7XA 5F61A 3LQHA 5HELA 5HQ5A 5CUDA 3S92A 4QSPA 1F68A 4YK0A 4MENA 5HCLA 4WHWA 4Y03A 3GG3A 3JVLA 3HMEA 3UVXA 4YBSA 4QSQA 2L85A 4PTBA 5E9IA 2G4AA 5E9YA 3S91A 4HXPA 4TT4A 4UIWA 4OGIA 5E3GA 5DW1A 5EQ1A 4ZC9A 4YBMA 4N4IA 4NR6A 5CZGA 5FDZA 5I86A 4KCXA 4A9OA 5L8TA 5KHMA 4O7CA 5FE4A 4LYWA 4NR5A 5KTXA 5LKTA 5ENFA 5DFBA 4QSRA 4Z6IA 5FG5A 5C89A 4QSSA 1JSPB 4A9KA 5CRZA 4QB3A 4ALGA 4WHUA 3DAIA 5DYAA 4J0RA 4MEOA 4A9NA 4IR5A 3LJWA 5LKZA 5EP7A 4MR6A 5CUCA 5D3LA 5DY7A 3UVYA 4QR4A 5AMEA 5F1LA 5HRWA 4FLPA 3O35A 4CURA 4QNSA 5I1QA 5HQ7A 5COIA 4UIVA 3FKMX 4QR3A 2NXBA 5CUEA 5CS8A 4Z1QA 4HXRA 5F25A 3UV5A 2YEKA 4YYHA 4O77A 4YAXA 3JVJA 2N9GA 4A9EA 5H1TA 1WUGA 5CQ5A 5I80A 5D0CA 5HEMA 5D3TA 3SVGA 3ZYUA 5EA1A 4UIYA 5DKDA 5A5SA 2D9EA 4UYFA 4QYLA 2F6JA 3NXBA 4LDFA 5F36A 3U5KA 2OO1A 2YQDA 3O33A 5CUAA 4ZQLA 5CQ4A 5EWCA 5BT5A 2E7OA 5EISA 4NQMA 4J3IA 3U5PA 2RS9B 4UYDA 4C67A 5H85A 4A9HA 5CY9A 5D3NA 5JI8A 3Q2FA 4LZ2A 4BW3A 4O70A 5D25A 4MR4A 3RCWA 3MB3A 4IOQA 5DYCA 5IGMA 4LR6A 4O72A 5DFDA 5D3RA 5CRMA 4KV1A 5ENGA 5EICA 5H1VA 5D24A 5HRXA 4NS5A 5I29A 4ALHA 5DLXA 4CFKA 1EQFA 5F3AA 1E6IA 3JVMA 4HXSA 5I88A 4RVRA 4UIUA 5DKCA 3G0LA 3P1EA 4OUFA 4MEPA 3K2JA 5BT4A 5D3HA 4O75A 2YEMA 2OUOA 5C4QA 5CP5A 3SVHA 2KTBB 4YYGA 2E7NA 5E74A 4NRBA 3O37A 5A5PA 4XY9A 3UV4A 4YABA 5FH8A 5L96A 3UVWA 4BW4A 2R10A 5K29A 4NRCA 2E3KA 4F3IA 2I8NA 5EI4A 5HM0A 4A9JA 5ENEA 5ENBA 4QYDA 4XYAA 4BHWA 2YW5A 5CQ6A 5EPSA 5FFYA 5FE0A 5I83A 3Q2EA 4QSUA 5CGPA 5LUUA 4NYVA 4TS8A 5E3DA 2RNXA 2D82A 5I7YA 4YYDA 3MQMA 5LKXA 5CFWA 4QC1A 4OGJA 4QC3A 5FE1A 5HJCA 4YYIA 5L98A 3MB4A 5A5RA 5C8GA 3P5OA 4PKLA 5G4SA 5AMFA 4QUTA 4UIZA 5DLZA 4KV4A 4TU6A 3O34A 4TQNA 2I7KA 2L5EA 5D3PA 5D26A 4YADA 4YYMA 5FE7A 4QEVA 5E7DA 3SVFA 4IR6A 4CUPA 4QSTA 5E9KA 2RI7A 4O78A 5G4RA 4NRAA 2F6NA 4TZ8A 4AKNA 5I40A 4LC2A 5KU3A 4CUQA 2DATA 4NYXA 3P1DA 5D7XA 5F1HA 5TCMA 4CUSA 3LQIA 4N3WA 5DFCA 4QEUA 4A9IA 5CQ7A 3I3JA 5EVAA 4YYNA 5EWVA 4YYJA 5HFQA 4HBVA 5FBXA 4HXLA 5A5NA 4CFLA 2DVVA 4TZ2A 2R0SA 5IBNA 4Q0OA 5KTWA 3TLPA 4IR3A 4PCEA 5AD2A 4NR4A 5ETBA 5JWMA 3U5MA 4DONA 4TYLA 5L99A 4E96A 4QSVA
chains in the Genus database with same CATH superfamily
1WUMA 2GRCA 3IU5A 5ENCA 4ZW1A 5ENIA 4N4HA 3UV2A 2RNYA 3UVDA 4CL9A 5A81A 4N4GA 4MR5A 4NUDA 5A85A 5DYXA 5CTLA 4QSXA 5IGKA 5EU1A 2DVSA 4IR4A 4A9FA 4YY4A 5HFRA 5AD3A 5IIDA 5L8UA 5LJ1A 5KTUA 4YBTA 5TB6A 4C66A 5E9LA 4A9MA 2LSPB 3O36A 1X0JA 4QY4A 4NXJA 4HBXA 4TU4A 5CQ8A 2DKWA 4N4FA 4O7EA 5C7NA 5KO4A 4O71A 4O7AA 5EPBA 4NR7A 3MULA 4LZSA 4MEQA 4XUBA 4CUUA 4O7FA 5FFVA 5CQAA 5DKHA 5D3JA 5FE9A 5FG4A 5LVRA 2YYNA 5C85A 4IORA 5EV9A 5FH6A 3G0JA 5E9VA 3HMFA 4HXNA 5ENJA 5DW2A 5L97A 5FE6A 2YDWA 5II1A 3JVKA 4CLBA 4NQNA 5CUBA 5FE3A 5HENA 2FSAA 4LRGA 4AKGA 5A83A 5CPEA 4UYEA 2RNWA 5F2PA 4QSWA 5F5ZA 5DYUA 3MUKA 5IGLA 1ZS5A 5ETDA 4Q0NA 5FB1A 2YELA 2R0VA 3MXFA 4NYWA 5D3SA 5F62A 5DBMA 4NUCA 4CUTA 3DWYA 5I89A 3AADA 3P1CA 5IG6A 3U5LA 4YY6A 2OSSA 4NR9A 4O7BA 4YC9A 3AQAA 5C87A 5CUGA 4TT2A 4X2IA 5EPRA 5EGUA 5EK9A 4HXMA 5EM3A 3D1DA 4PS5A 4XUAA 3IU6A 4UYHA 3D1BA 5LJ2A 3LXJA 4NUEA 5H1UA 2R0YA 2H60A 5FB0A 3UW9A 2DWWA 2WP1A 2MJVB 5F60A 5A7CA 2WP2A 5CQ3A 3HMHA 4UYFB 1N72A 5LKUA 4MR3A 4QEWA 3D7CA 4BJXA 2L84A 5FG6A 5DX4A 4AI6A 4J1PA 2RFJA 4PCIA 2DVQA 5EWDA 5HLSA 3VKGA 5LJ0A 5FE2A 5HQ6A 5J0DA 5CU8A 4LYIA 4A9LA 2DVRA 2RO1A 4QBMA 4UIXA 5E73A 5FH7A 4BW2A 5FE8A 4YH4A 5ENHA 5ACYA 4WIVA 5A82A 4O74A 4HBWA 4HXOA 4Z1SA 5A5QA 5CQTA 5FE5A 4LZRA 4YATA 4UYGA 4LYSA 4GPJA 3QZSA 4YYKA 4UITA 4TT6A 4QUUA 4TTEA 3U5OA 4IOOA 4O76A 5LVQA 3LQJA 4J0SA 5F63A 3QZVA 5IGNA 3U5NA 4Z6HA 4HXKA 5E0RA 5FFWA 3P1FA 4XY8A 4BW1A 5A5OA 4HBYA 5EWWA 3ONIA 4YH3A 4PY6A 3QZTA 3U5JA 5HRVA 4QR5A 5E9MA 4NR8A 5BT3A 5EWHA 4Z93A 5II2A 1JM4B 4QZSA 5I7XA 5F61A 3LQHA 5HELA 5HQ5A 5CUDA 3S92A 4QSPA 1F68A 4YK0A 4MENA 5HCLA 4WHWA 4Y03A 3GG3A 3JVLA 3HMEA 3UVXA 4YBSA 4QSQA 2L85A 4PTBA 5E9IA 2G4AA 5E9YA 3S91A 4HXPA 4TT4A 4UIWA 4OGIA 5E3GA 5DW1A 5EQ1A 4ZC9A 4YBMA 3ERRA 4N4IA 4NR6A 5CZGA 5FDZA 5I86A 4KCXA 4A9OA 5L8TA 4AKIA 5KHMA 4O7CA 5FE4A 4LYWA 4NR5A 5KTXA 5LKTA 5ENFA 5DFBA 4QSRA 4Z6IA 5FG5A 5C89A 4QSSA 1JSPB 4A9KA 5CRZA 4QB3A 4ALGA 4WHUA 3DAIA 5DYAA 4J0RA 4MEOA 4A9NA 4IR5A 3LJWA 5LKZA 5EP7A 4MR6A 5CUCA 5D3LA 5DY7A 3UVYA 4QR4A 5AMEA 5F1LA 5HRWA 4FLPA 3O35A 4CURA 4QNSA 5I1QA 5HQ7A 5COIA 4UIVA 3FKMX 4QR3A 2NXBA 1PUOA 5CUEA 5CS8A 4Z1QA 4HXRA 5F25A 3UV5A 2YEKA 4YYHA 4O77A 4YAXA 3JVJA 2N9GA 4A9EA 5H1TA 1WUGA 5CQ5A 5I80A 5D0CA 5HEMA 5D3TA 3SVGA 3ZYUA 5EA1A 4UIYA 5DKDA 5A5SA 2D9EA 4UYFA 4QYLA 2EJNA 2F6JA 3NXBA 4LDFA 5F36A 3U5KA 2OO1A 2YQDA 3O33A 5CUAA 4ZQLA 5CQ4A 5EWCA 5BT5A 2E7OA 5EISA 4NQMA 4J3IA 3U5PA 2RS9B 4UYDA 4C67A 5H85A 4A9HA 5CY9A 5D3NA 5JI8A 3Q2FA 4LZ2A 4BW3A 4O70A 5D25A 4MR4A 3RCWA 3MB3A 4IOQA 5DYCA 5IGMA 4LR6A 4O72A 5D3RA 5DFDA 5CRMA 4KV1A 5ENGA 5EICA 5H1VA 5D24A 5HRXA 4NS5A 5I29A 4ALHA 5DLXA 4CFKA 1EQFA 5F3AA 1E6IA 3JVMA 4HXSA 5I88A 4RVRA 4UIUA 5DKCA 3G0LA 3P1EA 4OUFA 4MEPA 3K2JA 5BT4A 5D3HA 4O75A 2YEMA 2OUOA 5C4QA 5CP5A 3SVHA 2KTBB 4YYGA 2E7NA 5E74A 4NRBA 3O37A 5A5PA 4XY9A 3UV4A 4YABA 5FH8A 5L96A 3UVWA 4BW4A 2R10A 5K29A 4NRCA 2E3KA 4F3IA 2I8NA 5EI4A 5HM0A 4A9JA 5ENEA 5ENBA 4QYDA 4XYAA 4BHWA 2YW5A 5CQ6A 5EPSA 5FFYA 5FE0A 5I83A 3Q2EA 4AKHA 4QSUA 5CGPA 5LUUA 4NYVA 4TS8A 5E3DA 2RNXA 2D82A 5I7YA 4YYDA 3MQMA 5LKXA 5CFWA 4QC1A 4OGJA 4QC3A 5FE1A 5HJCA 4YYIA 5L98A 3MB4A 5A5RA 5C8GA 3P5OA 4PKLA 5G4SA 5AMFA 4QUTA 4UIZA 5DLZA 4KV4A 4TU6A 3O34A 4TQNA 2I7KA 2L5EA 5D3PA 5D26A 4YADA 4YYMA 5FE7A 4QEVA 5E7DA 3SVFA 4IR6A 4CUPA 4QSTA 5E9KA 2RI7A 4O78A 5G4RA 4NRAA 2F6NA 4TZ8A 4AKNA 3VKHA 5I40A 4LC2A 5KU3A 4CUQA 2DATA 4NYXA 3P1DA 5D7XA 5F1HA 5TCMA 4CUSA 3LQIA 4N3WA 5DFCA 4QEUA 4A9IA 5CQ7A 3I3JA 5EVAA 4YYNA 5EWVA 4YYJA 5HFQA 4HBVA 5FBXA 4HXLA 5A5NA 4CFLA 2DVVA 4TZ2A 2R0SA 5IBNA 4Q0OA 5KTWA 3TLPA 1ZKRA 4IR3A 4PCEA 5AD2A 4NR4A 5ETBA 5JWMA 3U5MA 4DONA 4TYLA 5L99A 4E96A 4QSVA
chains in the Genus database with same CATH topology
1WUMA 2GRCA 3IU5A 5ENCA 4ZW1A 5ENIA 4N4HA 3UV2A 2RNYA 3UVDA 4CL9A 5A81A 4N4GA 4MR5A 4NUDA 5A85A 5DYXA 5CTLA 4QSXA 5IGKA 5EU1A 2DVSA 4IR4A 4A9FA 4YY4A 5HFRA 5AD3A 5IIDA 5L8UA 5LJ1A 5KTUA 4YBTA 5TB6A 4C66A 5E9LA 4A9MA 2LSPB 3O36A 1X0JA 4QY4A 4NXJA 4HBXA 4TU4A 5CQ8A 2DKWA 4N4FA 4O7EA 5C7NA 5KO4A 4O71A 4O7AA 5EPBA 4NR7A 3MULA 4LZSA 4MEQA 4XUBA 4CUUA 4O7FA 5FFVA 5CQAA 5DKHA 5D3JA 5FE9A 5FG4A 5LVRA 2YYNA 5C85A 4IORA 5EV9A 5FH6A 3G0JA 5E9VA 3HMFA 4HXNA 5ENJA 5DW2A 5L97A 5FE6A 2YDWA 5II1A 3JVKA 4CLBA 4NQNA 5CUBA 5FE3A 5HENA 2FSAA 4LRGA 5A83A 5CPEA 4UYEA 2RNWA 5F2PA 4QSWA 5F5ZA 5DYUA 3MUKA 5IGLA 1ZS5A 5ETDA 4Q0NA 5FB1A 2YELA 2R0VA 3MXFA 4NYWA 5D3SA 5F62A 5DBMA 4NUCA 4CUTA 3DWYA 5I89A 3AADA 3P1CA 5IG6A 3U5LA 4YY6A 2OSSA 4NR9A 4O7BA 4YC9A 3AQAA 5C87A 5CUGA 4TT2A 4X2IA 5EPRA 5EGUA 5EK9A 4HXMA 5EM3A 4PS5A 4XUAA 3IU6A 4UYHA 5LJ2A 3LXJA 4NUEA 5H1UA 2R0YA 2H60A 5FB0A 3UW9A 2DWWA 2WP1A 2MJVB 5F60A 5A7CA 2WP2A 5CQ3A 3HMHA 4UYFB 1N72A 5LKUA 4MR3A 4QEWA 3D7CA 4BJXA 2L84A 5FG6A 5DX4A 4J1PA 2RFJA 4PCIA 2DVQA 5EWDA 5HLSA 5LJ0A 5FE2A 5HQ6A 5J0DA 5CU8A 4LYIA 4A9LA 2DVRA 2RO1A 4QBMA 4UIXA 5E73A 5FH7A 4BW2A 5FE8A 4YH4A 5ENHA 5ACYA 4WIVA 5A82A 4O74A 4HBWA 4HXOA 4Z1SA 5A5QA 5CQTA 5FE5A 4LZRA 4YATA 4UYGA 4LYSA 4GPJA 3QZSA 4YYKA 4UITA 4TT6A 4QUUA 4TTEA 3U5OA 4IOOA 4O76A 5LVQA 3LQJA 4J0SA 5F63A 3QZVA 5IGNA 3U5NA 4Z6HA 4HXKA 5E0RA 5FFWA 3P1FA 4XY8A 4BW1A 5A5OA 4HBYA 5EWWA 3ONIA 4YH3A 4PY6A 3QZTA 3U5JA 5HRVA 4QR5A 5E9MA 4NR8A 5BT3A 5EWHA 4Z93A 5II2A 1JM4B 4QZSA 5I7XA 5F61A 3LQHA 5HELA 5HQ5A 5CUDA 3S92A 4QSPA 1F68A 4YK0A 4MENA 5HCLA 4WHWA 4Y03A 3GG3A 3JVLA 3HMEA 3UVXA 4YBSA 4QSQA 2L85A 4PTBA 5E9IA 2G4AA 5E9YA 3S91A 4HXPA 4TT4A 4UIWA 4OGIA 5E3GA 5DW1A 5EQ1A 4ZC9A 4YBMA 4N4IA 4NR6A 5CZGA 5FDZA 5I86A 4KCXA 4A9OA 5L8TA 5KHMA 4O7CA 5FE4A 4LYWA 4NR5A 5KTXA 5LKTA 5ENFA 5DFBA 4QSRA 4Z6IA 5FG5A 5C89A 4QSSA 1JSPB 4A9KA 5CRZA 4QB3A 4ALGA 4WHUA 3DAIA 5DYAA 4J0RA 4MEOA 4A9NA 4IR5A 3LJWA 5LKZA 5EP7A 4MR6A 5CUCA 5D3LA 5DY7A 3UVYA 4QR4A 5AMEA 5F1LA 5HRWA 4FLPA 3O35A 4CURA 4QNSA 5I1QA 5HQ7A 5COIA 4UIVA 3FKMX 4QR3A 2NXBA 5CUEA 5CS8A 4Z1QA 4HXRA 5F25A 3UV5A 2YEKA 4YYHA 4O77A 4YAXA 3JVJA 2N9GA 4A9EA 5H1TA 1WUGA 5CQ5A 5I80A 5D0CA 5HEMA 5D3TA 3SVGA 3ZYUA 5EA1A 4UIYA 5DKDA 5A5SA 2D9EA 4UYFA 4QYLA 2F6JA 3NXBA 4LDFA 5F36A 3U5KA 2OO1A 2YQDA 3O33A 5CUAA 4ZQLA 5CQ4A 5EWCA 5BT5A 2E7OA 5EISA 4NQMA 4J3IA 3U5PA 2RS9B 4UYDA 4C67A 5H85A 4A9HA 5CY9A 5D3NA 5JI8A 3Q2FA 4LZ2A 4BW3A 4O70A 5D25A 4MR4A 3RCWA 3MB3A 4IOQA 5DYCA 5IGMA 4LR6A 4O72A 5DFDA 5D3RA 5CRMA 4KV1A 5ENGA 5EICA 5H1VA 5D24A 5HRXA 4NS5A 5I29A 4ALHA 5DLXA 4CFKA 1EQFA 5F3AA 1E6IA 3JVMA 4HXSA 5I88A 4RVRA 4UIUA 5DKCA 3G0LA 3P1EA 4OUFA 4MEPA 3K2JA 5BT4A 5D3HA 4O75A 2YEMA 2OUOA 5C4QA 5CP5A 3SVHA 2KTBB 4YYGA 2E7NA 5E74A 4NRBA 3O37A 5A5PA 4XY9A 3UV4A 4YABA 5FH8A 5L96A 3UVWA 4BW4A 2R10A 5K29A 4NRCA 2E3KA 4F3IA 2I8NA 5EI4A 5HM0A 4A9JA 5ENEA 5ENBA 4QYDA 4XYAA 4BHWA 2YW5A 5CQ6A 5EPSA 5FFYA 5FE0A 5I83A 3Q2EA 4QSUA 5CGPA 5LUUA 4NYVA 4TS8A 5E3DA 2RNXA 2D82A 5I7YA 4YYDA 3MQMA 5LKXA 5CFWA 4QC1A 4OGJA 4QC3A 5FE1A 5HJCA 4YYIA 5L98A 3MB4A 5A5RA 5C8GA 3P5OA 4PKLA 5G4SA 5AMFA 4QUTA 4UIZA 5DLZA 4KV4A 4TU6A 3O34A 4TQNA 2I7KA 2L5EA 5D3PA 5D26A 4YADA 4YYMA 5FE7A 4QEVA 5E7DA 3SVFA 4IR6A 4CUPA 4QSTA 5E9KA 2RI7A 4O78A 5G4RA 4NRAA 2F6NA 4TZ8A 4AKNA 5I40A 4LC2A 5KU3A 4CUQA 2DATA 4NYXA 3P1DA 5D7XA 5F1HA 5TCMA 4CUSA 3LQIA 4N3WA 5DFCA 4QEUA 4A9IA 5CQ7A 3I3JA 5EVAA 4YYNA 5EWVA 4YYJA 5HFQA 4HBVA 5FBXA 4HXLA 5A5NA 4CFLA 2DVVA 4TZ2A 2R0SA 5IBNA 4Q0OA 5KTWA 3TLPA 4IR3A 4PCEA 5AD2A 4NR4A 5ETBA 5JWMA 3U5MA 4DONA 4TYLA 5L99A 4E96A 4QSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WUM A;  2GRC A;  3IU5 A;  5ENC A;  4ZW1 A;  5ENI A;  4N4H A;  3UV2 A;  2RNY A;  3UVD A;  4CL9 A;  5A81 A;  4N4G A;  4MR5 A;  4NUD A;  5A85 A;  5DYX A;  5CTL A;  4QSX A;  5IGK A;  5EU1 A;  2DVS A;  4IR4 A;  4A9F A;  4YY4 A;  5HFR A;  5AD3 A;  5IID A;  5L8U A;  5LJ1 A;  5KTU A;  4YBT A;  5TB6 A;  4C66 A;  5E9L A;  4A9M A;  2LSP B;  3O36 A;  1X0J A;  4QY4 A;  4NXJ A;  4HBX A;  4TU4 A;  5CQ8 A;  2DKW A;  4N4F A;  4O7E A;  5C7N A;  5KO4 A;  4O71 A;  4O7A A;  5EPB A;  4NR7 A;  3MUL A;  4LZS A;  4MEQ A;  4XUB A;  4CUU A;  4O7F A;  5FFV A;  5CQA A;  5DKH A;  5D3J A;  5FE9 A;  5FG4 A;  5LVR A;  2YYN A;  5C85 A;  4IOR A;  5EV9 A;  5FH6 A;  3G0J A;  5E9V A;  3HMF A;  4HXN A;  5ENJ A;  5DW2 A;  5L97 A;  5FE6 A;  2YDW A;  5II1 A;  3JVK A;  4CLB A;  4NQN A;  5CUB A;  5FE3 A;  5HEN A;  2FSA A;  4LRG A;  5A83 A;  5CPE A;  4UYE A;  2RNW A;  5F2P A;  4QSW A;  5F5Z A;  5DYU A;  3MUK A;  5IGL A;  1ZS5 A;  5ETD A;  4Q0N A;  5FB1 A;  2YEL A;  2R0V A;  3MXF A;  4NYW A;  5D3S A;  5F62 A;  5DBM A;  4NUC A;  4CUT A;  3DWY A;  5I89 A;  3AAD A;  3P1C A;  5IG6 A;  3U5L A;  4YY6 A;  2OSS A;  4NR9 A;  4O7B A;  4YC9 A;  3AQA A;  5C87 A;  5CUG A;  4TT2 A;  4X2I A;  5EPR A;  5EGU A;  5EK9 A;  4HXM A;  5EM3 A;  4PS5 A;  4XUA A;  3IU6 A;  4UYH A;  5LJ2 A;  3LXJ A;  4NUE A;  5H1U A;  2R0Y A;  2H60 A;  5FB0 A;  3UW9 A;  2DWW A;  2WP1 A;  2MJV B;  5F60 A;  5A7C A;  2WP2 A;  5CQ3 A;  3HMH A;  4UYF B;  1N72 A;  5LKU A;  4MR3 A;  4QEW A;  3D7C A;  4BJX A;  2L84 A;  5FG6 A;  5DX4 A;  4J1P A;  2RFJ A;  4PCI A;  2DVQ A;  5EWD A;  5HLS A;  5LJ0 A;  5FE2 A;  5HQ6 A;  5J0D A;  5CU8 A;  4LYI A;  4A9L A;  2DVR A;  2RO1 A;  4QBM A;  4UIX A;  5E73 A;  5FH7 A;  4BW2 A;  5FE8 A;  4YH4 A;  5ENH A;  5ACY A;  4WIV A;  5A82 A;  4O74 A;  4HBW A;  4HXO A;  4Z1S A;  5A5Q A;  5CQT A;  5FE5 A;  4LZR A;  4YAT A;  4UYG A;  4LYS A;  4GPJ A;  3QZS A;  4YYK A;  4UIT A;  4TT6 A;  4QUU A;  4TTE A;  3U5O A;  4IOO A;  4O76 A;  5LVQ A;  3LQJ A;  4J0S A;  5F63 A;  3QZV A;  5IGN A;  3U5N A;  4Z6H A;  4HXK A;  5E0R A;  5FFW A;  3P1F A;  4XY8 A;  4BW1 A;  5A5O A;  4HBY A;  5EWW A;  3ONI A;  4YH3 A;  4PY6 A;  3QZT A;  3U5J A;  5HRV A;  4QR5 A;  5E9M A;  4NR8 A;  5BT3 A;  5EWH A;  4Z93 A;  5II2 A;  1JM4 B;  4QZS A;  5I7X A;  5F61 A;  3LQH A;  5HEL A;  5HQ5 A;  5CUD A;  3S92 A;  4QSP A;  1F68 A;  4YK0 A;  4MEN A;  5HCL A;  4WHW A;  4Y03 A;  3GG3 A;  3JVL A;  3HME A;  3UVX A;  4YBS A;  4QSQ A;  2L85 A;  4PTB A;  5E9I A;  2G4A A;  5E9Y A;  3S91 A;  4HXP A;  4TT4 A;  4UIW A;  4OGI A;  5E3G A;  5DW1 A;  5EQ1 A;  4ZC9 A;  4YBM A;  4N4I A;  4NR6 A;  5CZG A;  5FDZ A;  5I86 A;  4KCX A;  4A9O A;  5L8T A;  5KHM A;  4O7C A;  5FE4 A;  4LYW A;  4NR5 A;  5KTX A;  5LKT A;  5ENF A;  5DFB A;  4QSR A;  4Z6I A;  5FG5 A;  5C89 A;  4QSS A;  1JSP B;  4A9K A;  5CRZ A;  4QB3 A;  4ALG A;  4WHU A;  3DAI A;  5DYA A;  4J0R A;  4MEO A;  4A9N A;  4IR5 A;  3LJW A;  5LKZ A;  5EP7 A;  4MR6 A;  5CUC A;  5D3L A;  5DY7 A;  3UVY A;  4QR4 A;  5AME A;  5F1L A;  5HRW A;  4FLP A;  3O35 A;  4CUR A;  4QNS A;  5I1Q A;  5HQ7 A;  5COI A;  4UIV A;  3FKM X;  4QR3 A;  2NXB A;  5CUE A;  5CS8 A;  4Z1Q A;  4HXR A;  5F25 A;  3UV5 A;  2YEK A;  4YYH A;  4O77 A;  4YAX A;  3JVJ A;  2N9G A;  4A9E A;  5H1T A;  1WUG A;  5CQ5 A;  5I80 A;  5D0C A;  5HEM A;  5D3T A;  3SVG A;  3ZYU A;  5EA1 A;  4UIY A;  5DKD A;  5A5S A;  2D9E A;  4UYF A;  4QYL A;  2F6J A;  3NXB A;  4LDF A;  5F36 A;  3U5K A;  2OO1 A;  2YQD A;  3O33 A;  5CUA A;  4ZQL A;  5CQ4 A;  5EWC A;  5BT5 A;  2E7O A;  5EIS A;  4NQM A;  4J3I A;  3U5P A;  2RS9 B;  4UYD A;  4C67 A;  5H85 A;  4A9H A;  5CY9 A;  5D3N A;  5JI8 A;  3Q2F A;  4LZ2 A;  4BW3 A;  4O70 A;  5D25 A;  4MR4 A;  3RCW A;  3MB3 A;  4IOQ A;  5DYC A;  5IGM A;  4LR6 A;  4O72 A;  5DFD A;  5D3R A;  5CRM A;  4KV1 A;  5ENG A;  5EIC A;  5H1V A;  5D24 A;  5HRX A;  4NS5 A;  5I29 A;  4ALH A;  5DLX A;  4CFK A;  1EQF A;  5F3A A;  1E6I A;  3JVM A;  4HXS A;  5I88 A;  4RVR A;  4UIU A;  5DKC A;  3G0L A;  3P1E A;  4OUF A;  4MEP A;  3K2J A;  5BT4 A;  5D3H A;  4O75 A;  2YEM A;  2OUO A;  5C4Q A;  5CP5 A;  3SVH A;  2KTB B;  4YYG A;  2E7N A;  5E74 A;  4NRB A;  3O37 A;  5A5P A;  4XY9 A;  3UV4 A;  4YAB A;  5FH8 A;  5L96 A;  3UVW A;  4BW4 A;  2R10 A;  5K29 A;  4NRC A;  2E3K A;  4F3I A;  2I8N A;  5EI4 A;  5HM0 A;  4A9J A;  5ENE A;  5ENB A;  4QYD A;  4XYA A;  4BHW A;  2YW5 A;  5CQ6 A;  5EPS A;  5FFY A;  5FE0 A;  5I83 A;  3Q2E A;  4QSU A;  5CGP A;  5LUU A;  4NYV A;  4TS8 A;  5E3D A;  2RNX A;  2D82 A;  5I7Y A;  4YYD A;  3MQM A;  5LKX A;  5CFW A;  4QC1 A;  4OGJ A;  4QC3 A;  5FE1 A;  5HJC A;  4YYI A;  5L98 A;  3MB4 A;  5A5R A;  5C8G A;  3P5O A;  4PKL A;  5G4S A;  5AMF A;  4QUT A;  4UIZ A;  5DLZ A;  4KV4 A;  4TU6 A;  3O34 A;  4TQN A;  2I7K A;  2L5E A;  5D3P A;  5D26 A;  4YAD A;  4YYM A;  5FE7 A;  4QEV A;  5E7D A;  3SVF A;  4IR6 A;  4CUP A;  4QST A;  5E9K A;  2RI7 A;  4O78 A;  5G4R A;  4NRA A;  2F6N A;  4TZ8 A;  4AKN A;  5I40 A;  4LC2 A;  5KU3 A;  4CUQ A;  2DAT A;  4NYX A;  3P1D A;  5D7X A;  5F1H A;  5TCM A;  4CUS A;  3LQI A;  4N3W A;  5DFC A;  4QEU A;  4A9I A;  5CQ7 A;  3I3J A;  5EVA A;  4YYN A;  5EWV A;  4YYJ A;  5HFQ A;  4HBV A;  5FBX A;  4HXL A;  5A5N A;  4CFL A;  2DVV A;  4TZ2 A;  2R0S A;  5IBN A;  4Q0O A;  5KTW A;  3TLP A;  4IR3 A;  4PCE A;  5AD2 A;  4NR4 A;  5ETB A;  5JWM A;  3U5M A;  4DON A;  4TYL A;  5L99 A;  4E96 A;  4QSV A; 
#chains in the Genus database with same CATH topology
 1WUM A;  2GRC A;  3IU5 A;  5ENC A;  4ZW1 A;  5ENI A;  4N4H A;  3UV2 A;  2RNY A;  3UVD A;  4CL9 A;  5A81 A;  4N4G A;  4MR5 A;  4NUD A;  5A85 A;  5DYX A;  5CTL A;  4QSX A;  5IGK A;  5EU1 A;  2DVS A;  4IR4 A;  4A9F A;  4YY4 A;  5HFR A;  5AD3 A;  5IID A;  5L8U A;  5LJ1 A;  5KTU A;  4YBT A;  5TB6 A;  4C66 A;  5E9L A;  4A9M A;  2LSP B;  3O36 A;  1X0J A;  4QY4 A;  4NXJ A;  4HBX A;  4TU4 A;  5CQ8 A;  2DKW A;  4N4F A;  4O7E A;  5C7N A;  5KO4 A;  4O71 A;  4O7A A;  5EPB A;  4NR7 A;  3MUL A;  4LZS A;  4MEQ A;  4XUB A;  4CUU A;  4O7F A;  5FFV A;  5CQA A;  5DKH A;  5D3J A;  5FE9 A;  5FG4 A;  5LVR A;  2YYN A;  5C85 A;  4IOR A;  5EV9 A;  5FH6 A;  3G0J A;  5E9V A;  3HMF A;  4HXN A;  5ENJ A;  5DW2 A;  5L97 A;  5FE6 A;  2YDW A;  5II1 A;  3JVK A;  4CLB A;  4NQN A;  5CUB A;  5FE3 A;  5HEN A;  2FSA A;  4LRG A;  4AKG A;  5A83 A;  5CPE A;  4UYE A;  2RNW A;  5F2P A;  4QSW A;  5F5Z A;  5DYU A;  3MUK A;  5IGL A;  1ZS5 A;  5ETD A;  4Q0N A;  5FB1 A;  2YEL A;  2R0V A;  3MXF A;  4NYW A;  5D3S A;  5F62 A;  5DBM A;  4NUC A;  4CUT A;  3DWY A;  5I89 A;  3AAD A;  3P1C A;  5IG6 A;  3U5L A;  4YY6 A;  2OSS A;  4NR9 A;  4O7B A;  4YC9 A;  3AQA A;  5C87 A;  5CUG A;  4TT2 A;  4X2I A;  5EPR A;  5EGU A;  5EK9 A;  4HXM A;  5EM3 A;  3D1D A;  4PS5 A;  4XUA A;  3IU6 A;  4UYH A;  3D1B A;  5LJ2 A;  3LXJ A;  4NUE A;  5H1U A;  2R0Y A;  2H60 A;  5FB0 A;  3UW9 A;  2DWW A;  2WP1 A;  2MJV B;  5F60 A;  5A7C A;  2WP2 A;  5CQ3 A;  3HMH A;  4UYF B;  1N72 A;  5LKU A;  4MR3 A;  4QEW A;  3D7C A;  4BJX A;  2L84 A;  5FG6 A;  5DX4 A;  4AI6 A;  4J1P A;  2RFJ A;  4PCI A;  2DVQ A;  5EWD A;  5HLS A;  3VKG A;  5LJ0 A;  5FE2 A;  5HQ6 A;  5J0D A;  5CU8 A;  4LYI A;  4A9L A;  2DVR A;  2RO1 A;  4QBM A;  4UIX A;  5E73 A;  5FH7 A;  4BW2 A;  5FE8 A;  4YH4 A;  5ENH A;  5ACY A;  4WIV A;  5A82 A;  4O74 A;  4HBW A;  4HXO A;  4Z1S A;  5A5Q A;  5CQT A;  5FE5 A;  4LZR A;  4YAT A;  4UYG A;  4LYS A;  4GPJ A;  3QZS A;  4YYK A;  4UIT A;  4TT6 A;  4QUU A;  4TTE A;  3U5O A;  4IOO A;  4O76 A;  5LVQ A;  3LQJ A;  4J0S A;  5F63 A;  3QZV A;  5IGN A;  3U5N A;  4Z6H A;  4HXK A;  5E0R A;  5FFW A;  3P1F A;  4XY8 A;  4BW1 A;  5A5O A;  4HBY A;  5EWW A;  3ONI A;  4YH3 A;  4PY6 A;  3QZT A;  3U5J A;  5HRV A;  4QR5 A;  5E9M A;  4NR8 A;  5BT3 A;  5EWH A;  4Z93 A;  5II2 A;  1JM4 B;  4QZS A;  5I7X A;  5F61 A;  3LQH A;  5HEL A;  5HQ5 A;  5CUD A;  3S92 A;  4QSP A;  1F68 A;  4YK0 A;  4MEN A;  5HCL A;  4WHW A;  4Y03 A;  3GG3 A;  3JVL A;  3HME A;  3UVX A;  4YBS A;  4QSQ A;  2L85 A;  4PTB A;  5E9I A;  2G4A A;  5E9Y A;  3S91 A;  4HXP A;  4TT4 A;  4UIW A;  4OGI A;  5E3G A;  5DW1 A;  5EQ1 A;  4ZC9 A;  4YBM A;  3ERR A;  4N4I A;  4NR6 A;  5CZG A;  5FDZ A;  5I86 A;  4KCX A;  4A9O A;  5L8T A;  4AKI A;  5KHM A;  4O7C A;  5FE4 A;  4LYW A;  4NR5 A;  5KTX A;  5LKT A;  5ENF A;  5DFB A;  4QSR A;  4Z6I A;  5FG5 A;  5C89 A;  4QSS A;  1JSP B;  4A9K A;  5CRZ A;  4QB3 A;  4ALG A;  4WHU A;  3DAI A;  5DYA A;  4J0R A;  4MEO A;  4A9N A;  4IR5 A;  3LJW A;  5LKZ A;  5EP7 A;  4MR6 A;  5CUC A;  5D3L A;  5DY7 A;  3UVY A;  4QR4 A;  5AME A;  5F1L A;  5HRW A;  4FLP A;  3O35 A;  4CUR A;  4QNS A;  5I1Q A;  5HQ7 A;  5COI A;  4UIV A;  3FKM X;  4QR3 A;  2NXB A;  1PUO A;  5CUE A;  5CS8 A;  4Z1Q A;  4HXR A;  5F25 A;  3UV5 A;  2YEK A;  4YYH A;  4O77 A;  4YAX A;  3JVJ A;  2N9G A;  4A9E A;  5H1T A;  1WUG A;  5CQ5 A;  5I80 A;  5D0C A;  5HEM A;  5D3T A;  3SVG A;  3ZYU A;  5EA1 A;  4UIY A;  5DKD A;  5A5S A;  2D9E A;  4UYF A;  4QYL A;  2EJN A;  2F6J A;  3NXB A;  4LDF A;  5F36 A;  3U5K A;  2OO1 A;  2YQD A;  3O33 A;  5CUA A;  4ZQL A;  5CQ4 A;  5EWC A;  5BT5 A;  2E7O A;  5EIS A;  4NQM A;  4J3I A;  3U5P A;  2RS9 B;  4UYD A;  4C67 A;  5H85 A;  4A9H A;  5CY9 A;  5D3N A;  5JI8 A;  3Q2F A;  4LZ2 A;  4BW3 A;  4O70 A;  5D25 A;  4MR4 A;  3RCW A;  3MB3 A;  4IOQ A;  5DYC A;  5IGM A;  4LR6 A;  4O72 A;  5D3R A;  5DFD A;  5CRM A;  4KV1 A;  5ENG A;  5EIC A;  5H1V A;  5D24 A;  5HRX A;  4NS5 A;  5I29 A;  4ALH A;  5DLX A;  4CFK A;  1EQF A;  5F3A A;  1E6I A;  3JVM A;  4HXS A;  5I88 A;  4RVR A;  4UIU A;  5DKC A;  3G0L A;  3P1E A;  4OUF A;  4MEP A;  3K2J A;  5BT4 A;  5D3H A;  4O75 A;  2YEM A;  2OUO A;  5C4Q A;  5CP5 A;  3SVH A;  2KTB B;  4YYG A;  2E7N A;  5E74 A;  4NRB A;  3O37 A;  5A5P A;  4XY9 A;  3UV4 A;  4YAB A;  5FH8 A;  5L96 A;  3UVW A;  4BW4 A;  2R10 A;  5K29 A;  4NRC A;  2E3K A;  4F3I A;  2I8N A;  5EI4 A;  5HM0 A;  4A9J A;  5ENE A;  5ENB A;  4QYD A;  4XYA A;  4BHW A;  2YW5 A;  5CQ6 A;  5EPS A;  5FFY A;  5FE0 A;  5I83 A;  3Q2E A;  4AKH A;  4QSU A;  5CGP A;  5LUU A;  4NYV A;  4TS8 A;  5E3D A;  2RNX A;  2D82 A;  5I7Y A;  4YYD A;  3MQM A;  5LKX A;  5CFW A;  4QC1 A;  4OGJ A;  4QC3 A;  5FE1 A;  5HJC A;  4YYI A;  5L98 A;  3MB4 A;  5A5R A;  5C8G A;  3P5O A;  4PKL A;  5G4S A;  5AMF A;  4QUT A;  4UIZ A;  5DLZ A;  4KV4 A;  4TU6 A;  3O34 A;  4TQN A;  2I7K A;  2L5E A;  5D3P A;  5D26 A;  4YAD A;  4YYM A;  5FE7 A;  4QEV A;  5E7D A;  3SVF A;  4IR6 A;  4CUP A;  4QST A;  5E9K A;  2RI7 A;  4O78 A;  5G4R A;  4NRA A;  2F6N A;  4TZ8 A;  4AKN A;  3VKH A;  5I40 A;  4LC2 A;  5KU3 A;  4CUQ A;  2DAT A;  4NYX A;  3P1D A;  5D7X A;  5F1H A;  5TCM A;  4CUS A;  3LQI A;  4N3W A;  5DFC A;  4QEU A;  4A9I A;  5CQ7 A;  3I3J A;  5EVA A;  4YYN A;  5EWV A;  4YYJ A;  5HFQ A;  4HBV A;  5FBX A;  4HXL A;  5A5N A;  4CFL A;  2DVV A;  4TZ2 A;  2R0S A;  5IBN A;  4Q0O A;  5KTW A;  3TLP A;  1ZKR A;  4IR3 A;  4PCE A;  5AD2 A;  4NR4 A;  5ETB A;  5JWM A;  3U5M A;  4DON A;  4TYL A;  5L99 A;  4E96 A;  4QSV A; 
#chains in the Genus database with same CATH homology
 1WUM A;  2GRC A;  3IU5 A;  5ENC A;  4ZW1 A;  5ENI A;  4N4H A;  3UV2 A;  2RNY A;  3UVD A;  4CL9 A;  5A81 A;  4N4G A;  4MR5 A;  4NUD A;  5A85 A;  5DYX A;  5CTL A;  4QSX A;  5IGK A;  5EU1 A;  2DVS A;  4IR4 A;  4A9F A;  4YY4 A;  5HFR A;  5AD3 A;  5IID A;  5L8U A;  5LJ1 A;  5KTU A;  4YBT A;  5TB6 A;  4C66 A;  5E9L A;  4A9M A;  2LSP B;  3O36 A;  1X0J A;  4QY4 A;  4NXJ A;  4HBX A;  4TU4 A;  5CQ8 A;  2DKW A;  4N4F A;  4O7E A;  5C7N A;  5KO4 A;  4O71 A;  4O7A A;  5EPB A;  4NR7 A;  3MUL A;  4LZS A;  4MEQ A;  4XUB A;  4CUU A;  4O7F A;  5FFV A;  5CQA A;  5DKH A;  5D3J A;  5FE9 A;  5FG4 A;  5LVR A;  2YYN A;  5C85 A;  4IOR A;  5EV9 A;  5FH6 A;  3G0J A;  5E9V A;  3HMF A;  4HXN A;  5ENJ A;  5DW2 A;  5L97 A;  5FE6 A;  2YDW A;  5II1 A;  3JVK A;  4CLB A;  4NQN A;  5CUB A;  5FE3 A;  5HEN A;  2FSA A;  4LRG A;  5A83 A;  5CPE A;  4UYE A;  2RNW A;  5F2P A;  4QSW A;  5F5Z A;  5DYU A;  3MUK A;  5IGL A;  1ZS5 A;  5ETD A;  4Q0N A;  5FB1 A;  2YEL A;  2R0V A;  3MXF A;  4NYW A;  5D3S A;  5F62 A;  5DBM A;  4NUC A;  4CUT A;  3DWY A;  5I89 A;  3AAD A;  3P1C A;  5IG6 A;  3U5L A;  4YY6 A;  2OSS A;  4NR9 A;  4O7B A;  4YC9 A;  3AQA A;  5C87 A;  5CUG A;  4TT2 A;  4X2I A;  5EPR A;  5EGU A;  5EK9 A;  4HXM A;  5EM3 A;  4PS5 A;  4XUA A;  3IU6 A;  4UYH A;  5LJ2 A;  3LXJ A;  4NUE A;  5H1U A;  2R0Y A;  2H60 A;  5FB0 A;  3UW9 A;  2DWW A;  2WP1 A;  2MJV B;  5F60 A;  5A7C A;  2WP2 A;  5CQ3 A;  3HMH A;  4UYF B;  1N72 A;  5LKU A;  4MR3 A;  4QEW A;  3D7C A;  4BJX A;  2L84 A;  5FG6 A;  5DX4 A;  4J1P A;  2RFJ A;  4PCI A;  2DVQ A;  5EWD A;  5HLS A;  5LJ0 A;  5FE2 A;  5HQ6 A;  5J0D A;  5CU8 A;  4LYI A;  4A9L A;  2DVR A;  2RO1 A;  4QBM A;  4UIX A;  5E73 A;  5FH7 A;  4BW2 A;  5FE8 A;  4YH4 A;  5ENH A;  5ACY A;  4WIV A;  5A82 A;  4O74 A;  4HBW A;  4HXO A;  4Z1S A;  5A5Q A;  5CQT A;  5FE5 A;  4LZR A;  4YAT A;  4UYG A;  4LYS A;  4GPJ A;  3QZS A;  4YYK A;  4UIT A;  4TT6 A;  4QUU A;  4TTE A;  3U5O A;  4IOO A;  4O76 A;  5LVQ A;  3LQJ A;  4J0S A;  5F63 A;  3QZV A;  5IGN A;  3U5N A;  4Z6H A;  4HXK A;  5E0R A;  5FFW A;  3P1F A;  4XY8 A;  4BW1 A;  5A5O A;  4HBY A;  5EWW A;  3ONI A;  4YH3 A;  4PY6 A;  3QZT A;  3U5J A;  5HRV A;  4QR5 A;  5E9M A;  4NR8 A;  5BT3 A;  5EWH A;  4Z93 A;  5II2 A;  1JM4 B;  4QZS A;  5I7X A;  5F61 A;  3LQH A;  5HEL A;  5HQ5 A;  5CUD A;  3S92 A;  4QSP A;  1F68 A;  4YK0 A;  4MEN A;  5HCL A;  4WHW A;  4Y03 A;  3GG3 A;  3JVL A;  3HME A;  3UVX A;  4YBS A;  4QSQ A;  2L85 A;  4PTB A;  5E9I A;  2G4A A;  5E9Y A;  3S91 A;  4HXP A;  4TT4 A;  4UIW A;  4OGI A;  5E3G A;  5DW1 A;  5EQ1 A;  4ZC9 A;  4YBM A;  4N4I A;  4NR6 A;  5CZG A;  5FDZ A;  5I86 A;  4KCX A;  4A9O A;  5L8T A;  5KHM A;  4O7C A;  5FE4 A;  4LYW A;  4NR5 A;  5KTX A;  5LKT A;  5ENF A;  5DFB A;  4QSR A;  4Z6I A;  5FG5 A;  5C89 A;  4QSS A;  1JSP B;  4A9K A;  5CRZ A;  4QB3 A;  4ALG A;  4WHU A;  3DAI A;  5DYA A;  4J0R A;  4MEO A;  4A9N A;  4IR5 A;  3LJW A;  5LKZ A;  5EP7 A;  4MR6 A;  5CUC A;  5D3L A;  5DY7 A;  3UVY A;  4QR4 A;  5AME A;  5F1L A;  5HRW A;  4FLP A;  3O35 A;  4CUR A;  4QNS A;  5I1Q A;  5HQ7 A;  5COI A;  4UIV A;  3FKM X;  4QR3 A;  2NXB A;  5CUE A;  5CS8 A;  4Z1Q A;  4HXR A;  5F25 A;  3UV5 A;  2YEK A;  4YYH A;  4O77 A;  4YAX A;  3JVJ A;  2N9G A;  4A9E A;  5H1T A;  1WUG A;  5CQ5 A;  5I80 A;  5D0C A;  5HEM A;  5D3T A;  3SVG A;  3ZYU A;  5EA1 A;  4UIY A;  5DKD A;  5A5S A;  2D9E A;  4UYF A;  4QYL A;  2F6J A;  3NXB A;  4LDF A;  5F36 A;  3U5K A;  2OO1 A;  2YQD A;  3O33 A;  5CUA A;  4ZQL A;  5CQ4 A;  5EWC A;  5BT5 A;  2E7O A;  5EIS A;  4NQM A;  4J3I A;  3U5P A;  2RS9 B;  4UYD A;  4C67 A;  5H85 A;  4A9H A;  5CY9 A;  5D3N A;  5JI8 A;  3Q2F A;  4LZ2 A;  4BW3 A;  4O70 A;  5D25 A;  4MR4 A;  3RCW A;  3MB3 A;  4IOQ A;  5DYC A;  5IGM A;  4LR6 A;  4O72 A;  5DFD A;  5D3R A;  5CRM A;  4KV1 A;  5ENG A;  5EIC A;  5H1V A;  5D24 A;  5HRX A;  4NS5 A;  5I29 A;  4ALH A;  5DLX A;  4CFK A;  1EQF A;  5F3A A;  1E6I A;  3JVM A;  4HXS A;  5I88 A;  4RVR A;  4UIU A;  5DKC A;  3G0L A;  3P1E A;  4OUF A;  4MEP A;  3K2J A;  5BT4 A;  5D3H A;  4O75 A;  2YEM A;  2OUO A;  5C4Q A;  5CP5 A;  3SVH A;  2KTB B;  4YYG A;  2E7N A;  5E74 A;  4NRB A;  3O37 A;  5A5P A;  4XY9 A;  3UV4 A;  4YAB A;  5FH8 A;  5L96 A;  3UVW A;  4BW4 A;  2R10 A;  5K29 A;  4NRC A;  2E3K A;  4F3I A;  2I8N A;  5EI4 A;  5HM0 A;  4A9J A;  5ENE A;  5ENB A;  4QYD A;  4XYA A;  4BHW A;  2YW5 A;  5CQ6 A;  5EPS A;  5FFY A;  5FE0 A;  5I83 A;  3Q2E A;  4QSU A;  5CGP A;  5LUU A;  4NYV A;  4TS8 A;  5E3D A;  2RNX A;  2D82 A;  5I7Y A;  4YYD A;  3MQM A;  5LKX A;  5CFW A;  4QC1 A;  4OGJ A;  4QC3 A;  5FE1 A;  5HJC A;  4YYI A;  5L98 A;  3MB4 A;  5A5R A;  5C8G A;  3P5O A;  4PKL A;  5G4S A;  5AMF A;  4QUT A;  4UIZ A;  5DLZ A;  4KV4 A;  4TU6 A;  3O34 A;  4TQN A;  2I7K A;  2L5E A;  5D3P A;  5D26 A;  4YAD A;  4YYM A;  5FE7 A;  4QEV A;  5E7D A;  3SVF A;  4IR6 A;  4CUP A;  4QST A;  5E9K A;  2RI7 A;  4O78 A;  5G4R A;  4NRA A;  2F6N A;  4TZ8 A;  4AKN A;  5I40 A;  4LC2 A;  5KU3 A;  4CUQ A;  2DAT A;  4NYX A;  3P1D A;  5D7X A;  5F1H A;  5TCM A;  4CUS A;  3LQI A;  4N3W A;  5DFC A;  4QEU A;  4A9I A;  5CQ7 A;  3I3J A;  5EVA A;  4YYN A;  5EWV A;  4YYJ A;  5HFQ A;  4HBV A;  5FBX A;  4HXL A;  5A5N A;  4CFL A;  2DVV A;  4TZ2 A;  2R0S A;  5IBN A;  4Q0O A;  5KTW A;  3TLP A;  4IR3 A;  4PCE A;  5AD2 A;  4NR4 A;  5ETB A;  5JWM A;  3U5M A;  4DON A;  4TYL A;  5L99 A;  4E96 A;  4QSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...