5DFCA

Crystal structure of brd2(bd2) w370f mutant with ligand i-bet 762 bound
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
109
structure length
109
Chain Sequence
LSEQLKHCNGILKELLSKKHAAYAFPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Bromodomain-containing protein 2
publication title New Synthetic Routes to Triazolo-benzodiazepine Analogues: Expanding the Scope of the Bump-and-Hole Approach for Selective Bromo and Extra-Terminal (BET) Bromodomain Inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2015-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5dfcA00
4YYKA 5L98A 2GRCA 3LQIA 4A9FA 2RNXA 5FE6A 5FFVA 4YBSA 4QZSA 4XUAA 5FG5A 4J3IA 5HJCA 5FE1A 5F62A 2L84A 4NRBA 3UVWA 5IGNA 4QNSA 4YABA 5FFWA 4YYIA 5EISA 5CQ6A 5A5NA 5EV9A 3LQJA 4BW1A 5DKCA 5KTWA 5DBMA 2G4AA 5EI4A 5FE3A 5FH7A 4LYWA 5EWHA 3D7CA 3JVKA 5L96A 2YDWA 4PTBA 4UIVA 5I29A 5I40A 4N4FA 5CQ7A 4YYHA 4LDFA 5G4RA 4QSRA 4MR3A 4C66A 5E73A 4YYNA 4YYJA 4UYFA 4NS5A 5KTXA 1WUMA 4Q0OA 4UITA 5EQ1A 5CQ8A 4N4HA 4QEVA 5HQ7A 4A9IA 3P1FA 4BW3A 4Z1QA 5CGPA 5CY9A 5I83A 5ENGA 4AKNA 4J0SA 4YYDA 2DVRA 3SVGA 4NUCA 5D3LA 5FB1A 5C87A 5HM0A 4YBMA 2YQDA 5E9MA 4CFKA 5TB6A 4LZ2A 5D3NA 5D3JA 5CUDA 5CUGA 3O37A 4CUUA 4CL9A 4Q0NA 4UYEA 5CQTA 5CUEA 5EWVA 5F60A 5A81A 4A9KA 2MJVB 5C4QA 5CTLA 4TT4A 5A7CA 4Y03A 5AD2A 4QYLA 4A9JA 4PCEA 5D3HA 5E9IA 4YYGA 3HMEA 4O7FA 5IIDA 5E9VA 5FE2A 5A5RA 1JSPB 5KO4A 2N9GA 5EGUA 5CRZA 3DAIA 3MUKA 1ZS5A 3NXBA 3O36A 5EWCA 3S92A 4BHWA 5KU3A 5I89A 4IOQA 4TU4A 4O78A 4LR6A 5I7YA 4KCXA 4UIYA 5COIA 4UIZA 5LKXA 4O75A 2WP1A 4TTEA 4LZSA 5L8UA 4N4GA 4UIUA 5D26A 2DVQA 4ZW1A 4CUQA 4YBTA 4NYWA 4QSUA 5LVQA 2D9EA 4PCIA 3U5PA 5CQ4A 5FE4A 5LKUA 1EQFA 5EK9A 3ONIA 4MEPA 3U5NA 5DFDA 5K29A 4Z93A 4IORA 5IGKA 2NXBA 5CU8A 4NR8A 4QBMA 4MR6A 4QSXA 5BT3A 5CQ3A 2WP2A 5LJ1A 1E6IA 5HFQA 4RVRA 5AMFA 5KTUA 5A85A 3DWYA 3SVFA 4O7BA 4QC3A 2DVSA 5A82A 3MQMA 4HXOA 3UVDA 4XYAA 4Z6IA 3G0LA 2L5EA 4WIVA 3UV2A 4NYVA 4NR5A 2D82A 5C8GA 5DLXA 5EP7A 5LKTA 1N72A 4PS5A 4O77A 5CPEA 4XY9A 5IG6A 5HRWA 5C89A 5A5SA 2OUOA 4YY6A 5DFBA 5E9LA 5L8TA 4A9EA 2DATA 4NR9A 4KV4A 5LJ0A 4ALGA 5CQAA 5FE0A 4HBYA 5FG4A 5TCMA 5E3GA 4F3IA 5A5PA 5FE5A 5FBXA 3MULA 5D3RA 4CFLA 4IR4A 3SVHA 5L97A 4HBWA 4QB3A 4PY6A 2E3KA 4YATA 5F63A 5IGLA 5FH6A 4HXMA 5F1HA 5DW2A 5FFYA 4E96A 4QSVA 3MB4A 2F6JA 4Z1SA 4QSTA 4QYDA 4YH3A 3U5JA 4YH4A 3UV5A 3QZVA 4QC1A 5D7XA 4GPJA 3UV4A 4YYMA 3U5MA 2E7OA 1WUGA 4TYLA 4UIWA 4NUDA 5F1LA 3RCWA 4XY8A 5A83A 2DKWA 4IR6A 5CRMA 2R0SA 5I7XA 4O76A 4NQNA 2YYNA 2I8NA 4J1PA 4NR7A 4NR4A 4A9HA 3O35A 4FLPA 4LZRA 5D25A 3AQAA 3AADA 4QSWA 5D3SA 3P1EA 5DYUA 5JI8A 5ACYA 3LQHA 2RI7A 4BW2A 4A9OA 4UIXA 4TU6A 4LC2A 4HXRA 4YADA 4YC9A 5H85A 4O70A 2RO1A 5E9YA 4XUBA 3U5KA 5LKZA 3JVMA 3HMFA 4ZQLA 5EVAA 5CFWA 4QUTA 4A9NA 2RFJA 5F25A 3FKMX 5LUUA 5DX4A 5F5ZA 3Q2EA 4N4IA 5D3PA 5F3AA 2R10A 4KV1A 5A5OA 4A9LA 4MENA 5A5QA 3S91A 3O34A 3ZYUA 5ETDA 5EU1A 5HCLA 5D24A 4O71A 5HQ6A 3HMHA 2L85A 4NUEA 4WHUA 4QR3A 4YAXA 4UYFB 3IU6A 5HRVA 2E7NA 5ENFA 3JVLA 5CUAA 4PKLA 5DY7A 4Z6HA 5E3DA 5BT5A 4WHWA 4YK0A 5HQ5A 4CUSA 4QY4A 5E74A 5HFRA 5II2A 5EWWA 3G0JA 4TS8A 5H1VA 4MEQA 3UVXA 5IGMA 5JWMA 4HXNA 4YY4A 5HENA 5J0DA 3Q2FA 4HXKA 4MR4A 4OGIA 3U5OA 3K2JA 2LSPB 5H1TA 5D0CA 4NRAA 2YELA 1X0JA 4NRCA 5ENJA 4OGJA 4QSSA 4HXPA 4CURA 4NYXA 5I88A 4TZ8A 4BJXA 5ENHA 2DWWA 4CUPA 4NQMA 5HLSA 5FE7A 4A9MA 2YW5A 5C85A 1F68A 2RNWA 5LVRA 4IR5A 5DW1A 4LYIA 4ZC9A 4NXJA 5EWDA 4IR3A 5C7NA 4NR6A 3QZSA 4QR5A 5L99A 3MB3A 4HXSA 3P1DA 4X2IA 2RNYA 3JVJA 3P1CA 5EPRA 3P5OA 2R0YA 3QZTA 4HBXA 2YEMA 3UW9A 3U5LA 4LRGA 4HBVA 4O7EA 5EM3A 5BT4A 5DFCA 5ENIA 5CQ5A 2RS9B 4QR4A 4QSPA 5CUCA 5HRXA 3GG3A 5FB0A 4CLBA 5HELA 4O7AA 4O7CA 5I80A 3I3JA 4HXLA 5ETBA 3MXFA 5EPBA 5AMEA 5CS8A 4MEOA 4OUFA 5EPSA 5HEMA 5E0RA 5ENBA 2H60A 2I7KA 5I86A 4CUTA 2OO1A 2YEKA 5FE9A 5F36A 5FH8A 5I1QA 5II1A 1JM4B 5F61A 3LJWA 4O74A 5EA1A 5LJ2A 4QSQA 5AD3A 5G4SA 2R0VA 5DLZA 4TZ2A 5DKDA 5FDZA 4ALHA 5DKHA 4UYHA 5CUBA 5DYAA 3TLPA 3IU5A 5DYCA 3UVYA 5DYXA 4LYSA 5EICA 4IOOA 4DONA 4N3WA 5D3TA 5CZGA 4TT2A 5F2PA 5KHMA 2F6NA 4TQNA 3LXJA 4UYGA 4MR5A 4UYDA 4J0RA 2OSSA 4BW4A 5E9KA 4QUUA 5FE8A 5ENEA 2DVVA 4TT6A 4O72A 5E7DA 5IBNA 2FSAA 5CP5A 4C67A 5FG6A 4QEUA 2KTBB 4QEWA 3O33A 5ENCA 5H1UA
chains in the Genus database with same CATH superfamily
4YYKA 5L98A 2GRCA 3LQIA 4A9FA 2RNXA 5FE6A 3VKGA 5FFVA 4YBSA 4QZSA 4XUAA 5FG5A 4J3IA 5HJCA 5FE1A 5F62A 2L84A 4NRBA 3UVWA 5IGNA 4QNSA 4YABA 5FFWA 4YYIA 5EISA 1PUOA 5CQ6A 5A5NA 5EV9A 3LQJA 4BW1A 5DKCA 5KTWA 5DBMA 2G4AA 5EI4A 5FE3A 5FH7A 4LYWA 5EWHA 3D7CA 3JVKA 5L96A 2YDWA 4PTBA 4UIVA 5I29A 5I40A 4N4FA 5CQ7A 4YYHA 4LDFA 5G4RA 4QSRA 4MR3A 4C66A 5E73A 4YYNA 4YYJA 4UYFA 4NS5A 4AKIA 3D1DA 5KTXA 1WUMA 4Q0OA 4UITA 5EQ1A 5CQ8A 4N4HA 4QEVA 5HQ7A 4A9IA 3P1FA 4BW3A 4Z1QA 5CGPA 5CY9A 5I83A 5ENGA 4AKNA 4J0SA 4YYDA 2DVRA 3SVGA 4NUCA 5D3LA 5FB1A 5C87A 5HM0A 4YBMA 2YQDA 5E9MA 4CFKA 5TB6A 4LZ2A 5D3NA 5D3JA 5CUDA 5CUGA 3O37A 4CUUA 4CL9A 4Q0NA 4UYEA 5CQTA 5CUEA 5EWVA 5F60A 5A81A 4A9KA 2MJVB 5C4QA 5CTLA 4TT4A 5A7CA 4Y03A 5AD2A 4QYLA 4A9JA 4PCEA 5D3HA 5E9IA 4YYGA 3HMEA 4O7FA 5IIDA 5E9VA 5FE2A 5A5RA 1JSPB 5KO4A 2N9GA 3ERRA 5EGUA 5CRZA 3DAIA 3MUKA 1ZS5A 3NXBA 3O36A 5EWCA 3S92A 4BHWA 5KU3A 5I89A 4IOQA 4TU4A 4O78A 4LR6A 5I7YA 2EJNA 4KCXA 4UIYA 5COIA 4UIZA 5LKXA 4O75A 2WP1A 4TTEA 4LZSA 5L8UA 4N4GA 4UIUA 5D26A 2DVQA 4ZW1A 4CUQA 4YBTA 4NYWA 4QSUA 5LVQA 2D9EA 4PCIA 3U5PA 5CQ4A 5FE4A 5LKUA 1EQFA 5EK9A 3ONIA 4MEPA 3U5NA 5DFDA 5K29A 4Z93A 4IORA 5IGKA 2NXBA 5CU8A 4NR8A 4QBMA 4MR6A 4QSXA 5BT3A 5CQ3A 2WP2A 5LJ1A 1E6IA 5HFQA 4RVRA 5AMFA 5KTUA 5A85A 3DWYA 3SVFA 4O7BA 4QC3A 2DVSA 5A82A 3MQMA 4HXOA 3UVDA 4XYAA 4Z6IA 3G0LA 2L5EA 4WIVA 3UV2A 4NYVA 4NR5A 2D82A 5C8GA 5DLXA 5EP7A 5LKTA 1N72A 4PS5A 4O77A 5CPEA 4XY9A 5IG6A 5HRWA 5C89A 5A5SA 2OUOA 4YY6A 5DFBA 5E9LA 5L8TA 4A9EA 2DATA 4NR9A 4KV4A 5LJ0A 4ALGA 5CQAA 5FE0A 4HBYA 5FG4A 5TCMA 5E3GA 4F3IA 5A5PA 5FE5A 5FBXA 3MULA 5D3RA 4CFLA 4IR4A 3SVHA 5L97A 4HBWA 4QB3A 4PY6A 2E3KA 4YATA 5F63A 5IGLA 5FH6A 4HXMA 5F1HA 5DW2A 5FFYA 4E96A 4QSVA 3MB4A 2F6JA 4Z1SA 4QSTA 4QYDA 4YH3A 3U5JA 4YH4A 3UV5A 3QZVA 4QC1A 5D7XA 4GPJA 3UV4A 4YYMA 3U5MA 2E7OA 1WUGA 4TYLA 4UIWA 4NUDA 5F1LA 3RCWA 4XY8A 5A83A 2DKWA 4IR6A 5CRMA 2R0SA 4AKGA 5I7XA 4O76A 4NQNA 2YYNA 2I8NA 4J1PA 4NR7A 4NR4A 4A9HA 3O35A 4FLPA 4LZRA 5D25A 3AQAA 3AADA 4QSWA 5D3SA 3P1EA 5DYUA 5JI8A 5ACYA 3LQHA 2RI7A 4BW2A 4A9OA 4UIXA 4TU6A 4LC2A 4HXRA 4YADA 4YC9A 5H85A 4O70A 2RO1A 5E9YA 4XUBA 3U5KA 5LKZA 3JVMA 3HMFA 4ZQLA 5EVAA 5CFWA 4QUTA 4A9NA 4AKHA 2RFJA 5F25A 3FKMX 5LUUA 5DX4A 5F5ZA 3Q2EA 4N4IA 5D3PA 5F3AA 2R10A 4KV1A 5A5OA 4A9LA 4MENA 5A5QA 3S91A 3O34A 3ZYUA 5ETDA 5EU1A 5HCLA 5D24A 4O71A 5HQ6A 3HMHA 4AI6A 2L85A 4NUEA 4WHUA 4QR3A 4YAXA 3D1BA 4UYFB 3IU6A 5HRVA 2E7NA 5ENFA 3JVLA 5CUAA 4PKLA 5DY7A 4Z6HA 5E3DA 5BT5A 4WHWA 3VKHA 4YK0A 5HQ5A 4CUSA 4QY4A 5E74A 5HFRA 5II2A 5EWWA 3G0JA 4TS8A 5H1VA 4MEQA 3UVXA 5IGMA 5JWMA 4HXNA 4YY4A 5HENA 5J0DA 3Q2FA 4HXKA 4MR4A 4OGIA 3U5OA 3K2JA 2LSPB 5H1TA 5D0CA 4NRAA 2YELA 1X0JA 4NRCA 5ENJA 4OGJA 4QSSA 4HXPA 4CURA 4NYXA 5I88A 4TZ8A 4BJXA 5ENHA 2DWWA 4CUPA 4NQMA 5HLSA 5FE7A 4A9MA 2YW5A 5C85A 1F68A 2RNWA 5LVRA 4IR5A 5DW1A 4LYIA 4ZC9A 4NXJA 5EWDA 4IR3A 5C7NA 4NR6A 3QZSA 4QR5A 5L99A 3MB3A 4HXSA 3P1DA 4X2IA 2RNYA 3JVJA 3P1CA 5EPRA 3P5OA 2R0YA 3QZTA 4HBXA 2YEMA 3UW9A 3U5LA 4LRGA 4HBVA 4O7EA 5EM3A 5BT4A 5DFCA 5ENIA 5CQ5A 2RS9B 4QR4A 4QSPA 5CUCA 5HRXA 3GG3A 5FB0A 4CLBA 5HELA 4O7AA 4O7CA 5I80A 3I3JA 4HXLA 5ETBA 3MXFA 5EPBA 5AMEA 5CS8A 4MEOA 4OUFA 5EPSA 5HEMA 5E0RA 5ENBA 2H60A 2I7KA 5I86A 4CUTA 2OO1A 2YEKA 5FE9A 5F36A 5FH8A 5I1QA 5II1A 1JM4B 5F61A 3LJWA 4O74A 5EA1A 5LJ2A 4QSQA 5AD3A 5G4SA 2R0VA 5DLZA 4TZ2A 5DKDA 5FDZA 4ALHA 5DKHA 4UYHA 5CUBA 5DYAA 3TLPA 3IU5A 5DYCA 3UVYA 5DYXA 4LYSA 5EICA 4IOOA 4DONA 4N3WA 5D3TA 5CZGA 4TT2A 5F2PA 5KHMA 2F6NA 4TQNA 3LXJA 4UYGA 4MR5A 4UYDA 4J0RA 2OSSA 4BW4A 5E9KA 1ZKRA 4QUUA 5FE8A 5ENEA 2DVVA 4TT6A 4O72A 5E7DA 5IBNA 2FSAA 5CP5A 4C67A 5FG6A 4QEUA 2KTBB 4QEWA 3O33A 5ENCA 5H1UA
chains in the Genus database with same CATH topology
4YYKA 5L98A 2GRCA 3LQIA 4A9FA 2RNXA 5FE6A 5FFVA 4YBSA 4QZSA 4XUAA 5FG5A 4J3IA 5HJCA 5FE1A 5F62A 2L84A 4NRBA 3UVWA 5IGNA 4QNSA 4YABA 5FFWA 4YYIA 5EISA 5CQ6A 5A5NA 5EV9A 3LQJA 4BW1A 5DKCA 5KTWA 5DBMA 2G4AA 5EI4A 5FE3A 5FH7A 4LYWA 5EWHA 3D7CA 3JVKA 5L96A 2YDWA 4PTBA 4UIVA 5I29A 5I40A 4N4FA 5CQ7A 4YYHA 4LDFA 5G4RA 4QSRA 4MR3A 4C66A 5E73A 4YYNA 4YYJA 4UYFA 4NS5A 5KTXA 1WUMA 4Q0OA 4UITA 5EQ1A 5CQ8A 4N4HA 4QEVA 5HQ7A 4A9IA 3P1FA 4BW3A 4Z1QA 5CGPA 5CY9A 5I83A 5ENGA 4AKNA 4J0SA 4YYDA 2DVRA 3SVGA 4NUCA 5D3LA 5FB1A 5C87A 5HM0A 4YBMA 2YQDA 5E9MA 4CFKA 5TB6A 4LZ2A 5D3NA 5D3JA 5CUDA 5CUGA 3O37A 4CUUA 4CL9A 4Q0NA 4UYEA 5CQTA 5CUEA 5EWVA 5F60A 5A81A 4A9KA 2MJVB 5C4QA 5CTLA 4TT4A 5A7CA 4Y03A 5AD2A 4QYLA 4A9JA 4PCEA 5D3HA 5E9IA 4YYGA 3HMEA 4O7FA 5IIDA 5E9VA 5FE2A 5A5RA 1JSPB 5KO4A 2N9GA 5EGUA 5CRZA 3DAIA 3MUKA 1ZS5A 3NXBA 3O36A 5EWCA 3S92A 4BHWA 5KU3A 5I89A 4IOQA 4TU4A 4O78A 4LR6A 5I7YA 4KCXA 4UIYA 5COIA 4UIZA 5LKXA 4O75A 2WP1A 4TTEA 4LZSA 5L8UA 4N4GA 4UIUA 5D26A 2DVQA 4ZW1A 4CUQA 4YBTA 4NYWA 4QSUA 5LVQA 2D9EA 4PCIA 3U5PA 5CQ4A 5FE4A 5LKUA 1EQFA 5EK9A 3ONIA 4MEPA 3U5NA 5DFDA 5K29A 4Z93A 4IORA 5IGKA 2NXBA 5CU8A 4NR8A 4QBMA 4MR6A 4QSXA 5BT3A 5CQ3A 2WP2A 5LJ1A 1E6IA 5HFQA 4RVRA 5AMFA 5KTUA 5A85A 3DWYA 3SVFA 4O7BA 4QC3A 2DVSA 5A82A 3MQMA 4HXOA 3UVDA 4XYAA 4Z6IA 3G0LA 2L5EA 4WIVA 3UV2A 4NYVA 4NR5A 2D82A 5C8GA 5DLXA 5EP7A 5LKTA 1N72A 4PS5A 4O77A 5CPEA 4XY9A 5IG6A 5HRWA 5C89A 5A5SA 2OUOA 4YY6A 5DFBA 5E9LA 5L8TA 4A9EA 2DATA 4NR9A 4KV4A 5LJ0A 4ALGA 5CQAA 5FE0A 4HBYA 5FG4A 5TCMA 5E3GA 4F3IA 5A5PA 5FE5A 5FBXA 3MULA 5D3RA 4CFLA 4IR4A 3SVHA 5L97A 4HBWA 4QB3A 4PY6A 2E3KA 4YATA 5F63A 5IGLA 5FH6A 4HXMA 5F1HA 5DW2A 5FFYA 4E96A 4QSVA 3MB4A 2F6JA 4Z1SA 4QSTA 4QYDA 4YH3A 3U5JA 4YH4A 3UV5A 3QZVA 4QC1A 5D7XA 4GPJA 3UV4A 4YYMA 3U5MA 2E7OA 1WUGA 4TYLA 4UIWA 4NUDA 5F1LA 3RCWA 4XY8A 5A83A 2DKWA 4IR6A 5CRMA 2R0SA 5I7XA 4O76A 4NQNA 2YYNA 2I8NA 4J1PA 4NR7A 4NR4A 4A9HA 3O35A 4FLPA 4LZRA 5D25A 3AQAA 3AADA 4QSWA 5D3SA 3P1EA 5DYUA 5JI8A 5ACYA 3LQHA 2RI7A 4BW2A 4A9OA 4UIXA 4TU6A 4LC2A 4HXRA 4YADA 4YC9A 5H85A 4O70A 2RO1A 5E9YA 4XUBA 3U5KA 5LKZA 3JVMA 3HMFA 4ZQLA 5EVAA 5CFWA 4QUTA 4A9NA 2RFJA 5F25A 3FKMX 5LUUA 5DX4A 5F5ZA 3Q2EA 4N4IA 5D3PA 5F3AA 2R10A 4KV1A 5A5OA 4A9LA 4MENA 5A5QA 3S91A 3O34A 3ZYUA 5ETDA 5EU1A 5HCLA 5D24A 4O71A 5HQ6A 3HMHA 2L85A 4NUEA 4WHUA 4QR3A 4YAXA 4UYFB 3IU6A 5HRVA 2E7NA 5ENFA 3JVLA 5CUAA 4PKLA 5DY7A 4Z6HA 5E3DA 5BT5A 4WHWA 4YK0A 5HQ5A 4CUSA 4QY4A 5E74A 5HFRA 5II2A 5EWWA 3G0JA 4TS8A 5H1VA 4MEQA 3UVXA 5IGMA 5JWMA 4HXNA 4YY4A 5HENA 5J0DA 3Q2FA 4HXKA 4MR4A 4OGIA 3U5OA 3K2JA 2LSPB 5H1TA 5D0CA 4NRAA 2YELA 1X0JA 4NRCA 5ENJA 4OGJA 4QSSA 4HXPA 4CURA 4NYXA 5I88A 4TZ8A 4BJXA 5ENHA 2DWWA 4CUPA 4NQMA 5HLSA 5FE7A 4A9MA 2YW5A 5C85A 1F68A 2RNWA 5LVRA 4IR5A 5DW1A 4LYIA 4ZC9A 4NXJA 5EWDA 4IR3A 5C7NA 4NR6A 3QZSA 4QR5A 5L99A 3MB3A 4HXSA 3P1DA 4X2IA 2RNYA 3JVJA 3P1CA 5EPRA 3P5OA 2R0YA 3QZTA 4HBXA 2YEMA 3UW9A 3U5LA 4LRGA 4HBVA 4O7EA 5EM3A 5BT4A 5DFCA 5ENIA 5CQ5A 2RS9B 4QR4A 4QSPA 5CUCA 5HRXA 3GG3A 5FB0A 4CLBA 5HELA 4O7AA 4O7CA 5I80A 3I3JA 4HXLA 5ETBA 3MXFA 5EPBA 5AMEA 5CS8A 4MEOA 4OUFA 5EPSA 5HEMA 5E0RA 5ENBA 2H60A 2I7KA 5I86A 4CUTA 2OO1A 2YEKA 5FE9A 5F36A 5FH8A 5I1QA 5II1A 1JM4B 5F61A 3LJWA 4O74A 5EA1A 5LJ2A 4QSQA 5AD3A 5G4SA 2R0VA 5DLZA 4TZ2A 5DKDA 5FDZA 4ALHA 5DKHA 4UYHA 5CUBA 5DYAA 3TLPA 3IU5A 5DYCA 3UVYA 5DYXA 4LYSA 5EICA 4IOOA 4DONA 4N3WA 5D3TA 5CZGA 4TT2A 5F2PA 5KHMA 2F6NA 4TQNA 3LXJA 4UYGA 4MR5A 4UYDA 4J0RA 2OSSA 4BW4A 5E9KA 4QUUA 5FE8A 5ENEA 2DVVA 4TT6A 4O72A 5E7DA 5IBNA 2FSAA 5CP5A 4C67A 5FG6A 4QEUA 2KTBB 4QEWA 3O33A 5ENCA 5H1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YYK A;  5L98 A;  2GRC A;  3LQI A;  4A9F A;  2RNX A;  5FE6 A;  5FFV A;  4YBS A;  4QZS A;  4XUA A;  5FG5 A;  4J3I A;  5HJC A;  5FE1 A;  5F62 A;  2L84 A;  4NRB A;  3UVW A;  5IGN A;  4QNS A;  4YAB A;  5FFW A;  4YYI A;  5EIS A;  5CQ6 A;  5A5N A;  5EV9 A;  3LQJ A;  4BW1 A;  5DKC A;  5KTW A;  5DBM A;  2G4A A;  5EI4 A;  5FE3 A;  5FH7 A;  4LYW A;  5EWH A;  3D7C A;  3JVK A;  5L96 A;  2YDW A;  4PTB A;  4UIV A;  5I29 A;  5I40 A;  4N4F A;  5CQ7 A;  4YYH A;  4LDF A;  5G4R A;  4QSR A;  4MR3 A;  4C66 A;  5E73 A;  4YYN A;  4YYJ A;  4UYF A;  4NS5 A;  5KTX A;  1WUM A;  4Q0O A;  4UIT A;  5EQ1 A;  5CQ8 A;  4N4H A;  4QEV A;  5HQ7 A;  4A9I A;  3P1F A;  4BW3 A;  4Z1Q A;  5CGP A;  5CY9 A;  5I83 A;  5ENG A;  4AKN A;  4J0S A;  4YYD A;  2DVR A;  3SVG A;  4NUC A;  5D3L A;  5FB1 A;  5C87 A;  5HM0 A;  4YBM A;  2YQD A;  5E9M A;  4CFK A;  5TB6 A;  4LZ2 A;  5D3N A;  5D3J A;  5CUD A;  5CUG A;  3O37 A;  4CUU A;  4CL9 A;  4Q0N A;  4UYE A;  5CQT A;  5CUE A;  5EWV A;  5F60 A;  5A81 A;  4A9K A;  2MJV B;  5C4Q A;  5CTL A;  4TT4 A;  5A7C A;  4Y03 A;  5AD2 A;  4QYL A;  4A9J A;  4PCE A;  5D3H A;  5E9I A;  4YYG A;  3HME A;  4O7F A;  5IID A;  5E9V A;  5FE2 A;  5A5R A;  1JSP B;  5KO4 A;  2N9G A;  5EGU A;  5CRZ A;  3DAI A;  3MUK A;  1ZS5 A;  3NXB A;  3O36 A;  5EWC A;  3S92 A;  4BHW A;  5KU3 A;  5I89 A;  4IOQ A;  4TU4 A;  4O78 A;  4LR6 A;  5I7Y A;  4KCX A;  4UIY A;  5COI A;  4UIZ A;  5LKX A;  4O75 A;  2WP1 A;  4TTE A;  4LZS A;  5L8U A;  4N4G A;  4UIU A;  5D26 A;  2DVQ A;  4ZW1 A;  4CUQ A;  4YBT A;  4NYW A;  4QSU A;  5LVQ A;  2D9E A;  4PCI A;  3U5P A;  5CQ4 A;  5FE4 A;  5LKU A;  1EQF A;  5EK9 A;  3ONI A;  4MEP A;  3U5N A;  5DFD A;  5K29 A;  4Z93 A;  4IOR A;  5IGK A;  2NXB A;  5CU8 A;  4NR8 A;  4QBM A;  4MR6 A;  4QSX A;  5BT3 A;  5CQ3 A;  2WP2 A;  5LJ1 A;  1E6I A;  5HFQ A;  4RVR A;  5AMF A;  5KTU A;  5A85 A;  3DWY A;  3SVF A;  4O7B A;  4QC3 A;  2DVS A;  5A82 A;  3MQM A;  4HXO A;  3UVD A;  4XYA A;  4Z6I A;  3G0L A;  2L5E A;  4WIV A;  3UV2 A;  4NYV A;  4NR5 A;  2D82 A;  5C8G A;  5DLX A;  5EP7 A;  5LKT A;  1N72 A;  4PS5 A;  4O77 A;  5CPE A;  4XY9 A;  5IG6 A;  5HRW A;  5C89 A;  5A5S A;  2OUO A;  4YY6 A;  5DFB A;  5E9L A;  5L8T A;  4A9E A;  2DAT A;  4NR9 A;  4KV4 A;  5LJ0 A;  4ALG A;  5CQA A;  5FE0 A;  4HBY A;  5FG4 A;  5TCM A;  5E3G A;  4F3I A;  5A5P A;  5FE5 A;  5FBX A;  3MUL A;  5D3R A;  4CFL A;  4IR4 A;  3SVH A;  5L97 A;  4HBW A;  4QB3 A;  4PY6 A;  2E3K A;  4YAT A;  5F63 A;  5IGL A;  5FH6 A;  4HXM A;  5F1H A;  5DW2 A;  5FFY A;  4E96 A;  4QSV A;  3MB4 A;  2F6J A;  4Z1S A;  4QST A;  4QYD A;  4YH3 A;  3U5J A;  4YH4 A;  3UV5 A;  3QZV A;  4QC1 A;  5D7X A;  4GPJ A;  3UV4 A;  4YYM A;  3U5M A;  2E7O A;  1WUG A;  4TYL A;  4UIW A;  4NUD A;  5F1L A;  3RCW A;  4XY8 A;  5A83 A;  2DKW A;  4IR6 A;  5CRM A;  2R0S A;  5I7X A;  4O76 A;  4NQN A;  2YYN A;  2I8N A;  4J1P A;  4NR7 A;  4NR4 A;  4A9H A;  3O35 A;  4FLP A;  4LZR A;  5D25 A;  3AQA A;  3AAD A;  4QSW A;  5D3S A;  3P1E A;  5DYU A;  5JI8 A;  5ACY A;  3LQH A;  2RI7 A;  4BW2 A;  4A9O A;  4UIX A;  4TU6 A;  4LC2 A;  4HXR A;  4YAD A;  4YC9 A;  5H85 A;  4O70 A;  2RO1 A;  5E9Y A;  4XUB A;  3U5K A;  5LKZ A;  3JVM A;  3HMF A;  4ZQL A;  5EVA A;  5CFW A;  4QUT A;  4A9N A;  2RFJ A;  5F25 A;  3FKM X;  5LUU A;  5DX4 A;  5F5Z A;  3Q2E A;  4N4I A;  5D3P A;  5F3A A;  2R10 A;  4KV1 A;  5A5O A;  4A9L A;  4MEN A;  5A5Q A;  3S91 A;  3O34 A;  3ZYU A;  5ETD A;  5EU1 A;  5HCL A;  5D24 A;  4O71 A;  5HQ6 A;  3HMH A;  2L85 A;  4NUE A;  4WHU A;  4QR3 A;  4YAX A;  4UYF B;  3IU6 A;  5HRV A;  2E7N A;  5ENF A;  3JVL A;  5CUA A;  4PKL A;  5DY7 A;  4Z6H A;  5E3D A;  5BT5 A;  4WHW A;  4YK0 A;  5HQ5 A;  4CUS A;  4QY4 A;  5E74 A;  5HFR A;  5II2 A;  5EWW A;  3G0J A;  4TS8 A;  5H1V A;  4MEQ A;  3UVX A;  5IGM A;  5JWM A;  4HXN A;  4YY4 A;  5HEN A;  5J0D A;  3Q2F A;  4HXK A;  4MR4 A;  4OGI A;  3U5O A;  3K2J A;  2LSP B;  5H1T A;  5D0C A;  4NRA A;  2YEL A;  1X0J A;  4NRC A;  5ENJ A;  4OGJ A;  4QSS A;  4HXP A;  4CUR A;  4NYX A;  5I88 A;  4TZ8 A;  4BJX A;  5ENH A;  2DWW A;  4CUP A;  4NQM A;  5HLS A;  5FE7 A;  4A9M A;  2YW5 A;  5C85 A;  1F68 A;  2RNW A;  5LVR A;  4IR5 A;  5DW1 A;  4LYI A;  4ZC9 A;  4NXJ A;  5EWD A;  4IR3 A;  5C7N A;  4NR6 A;  3QZS A;  4QR5 A;  5L99 A;  3MB3 A;  4HXS A;  3P1D A;  4X2I A;  2RNY A;  3JVJ A;  3P1C A;  5EPR A;  3P5O A;  2R0Y A;  3QZT A;  4HBX A;  2YEM A;  3UW9 A;  3U5L A;  4LRG A;  4HBV A;  4O7E A;  5EM3 A;  5BT4 A;  5DFC A;  5ENI A;  5CQ5 A;  2RS9 B;  4QR4 A;  4QSP A;  5CUC A;  5HRX A;  3GG3 A;  5FB0 A;  4CLB A;  5HEL A;  4O7A A;  4O7C A;  5I80 A;  3I3J A;  4HXL A;  5ETB A;  3MXF A;  5EPB A;  5AME A;  5CS8 A;  4MEO A;  4OUF A;  5EPS A;  5HEM A;  5E0R A;  5ENB A;  2H60 A;  2I7K A;  5I86 A;  4CUT A;  2OO1 A;  2YEK A;  5FE9 A;  5F36 A;  5FH8 A;  5I1Q A;  5II1 A;  1JM4 B;  5F61 A;  3LJW A;  4O74 A;  5EA1 A;  5LJ2 A;  4QSQ A;  5AD3 A;  5G4S A;  2R0V A;  5DLZ A;  4TZ2 A;  5DKD A;  5FDZ A;  4ALH A;  5DKH A;  4UYH A;  5CUB A;  5DYA A;  3TLP A;  3IU5 A;  5DYC A;  3UVY A;  5DYX A;  4LYS A;  5EIC A;  4IOO A;  4DON A;  4N3W A;  5D3T A;  5CZG A;  4TT2 A;  5F2P A;  5KHM A;  2F6N A;  4TQN A;  3LXJ A;  4UYG A;  4MR5 A;  4UYD A;  4J0R A;  2OSS A;  4BW4 A;  5E9K A;  4QUU A;  5FE8 A;  5ENE A;  2DVV A;  4TT6 A;  4O72 A;  5E7D A;  5IBN A;  2FSA A;  5CP5 A;  4C67 A;  5FG6 A;  4QEU A;  2KTB B;  4QEW A;  3O33 A;  5ENC A;  5H1U A; 
#chains in the Genus database with same CATH topology
 4YYK A;  5L98 A;  2GRC A;  3LQI A;  4A9F A;  2RNX A;  5FE6 A;  3VKG A;  5FFV A;  4YBS A;  4QZS A;  4XUA A;  5FG5 A;  4J3I A;  5HJC A;  5FE1 A;  5F62 A;  2L84 A;  4NRB A;  3UVW A;  5IGN A;  4QNS A;  4YAB A;  5FFW A;  4YYI A;  5EIS A;  1PUO A;  5CQ6 A;  5A5N A;  5EV9 A;  3LQJ A;  4BW1 A;  5DKC A;  5KTW A;  5DBM A;  2G4A A;  5EI4 A;  5FE3 A;  5FH7 A;  4LYW A;  5EWH A;  3D7C A;  3JVK A;  5L96 A;  2YDW A;  4PTB A;  4UIV A;  5I29 A;  5I40 A;  4N4F A;  5CQ7 A;  4YYH A;  4LDF A;  5G4R A;  4QSR A;  4MR3 A;  4C66 A;  5E73 A;  4YYN A;  4YYJ A;  4UYF A;  4NS5 A;  4AKI A;  3D1D A;  5KTX A;  1WUM A;  4Q0O A;  4UIT A;  5EQ1 A;  5CQ8 A;  4N4H A;  4QEV A;  5HQ7 A;  4A9I A;  3P1F A;  4BW3 A;  4Z1Q A;  5CGP A;  5CY9 A;  5I83 A;  5ENG A;  4AKN A;  4J0S A;  4YYD A;  2DVR A;  3SVG A;  4NUC A;  5D3L A;  5FB1 A;  5C87 A;  5HM0 A;  4YBM A;  2YQD A;  5E9M A;  4CFK A;  5TB6 A;  4LZ2 A;  5D3N A;  5D3J A;  5CUD A;  5CUG A;  3O37 A;  4CUU A;  4CL9 A;  4Q0N A;  4UYE A;  5CQT A;  5CUE A;  5EWV A;  5F60 A;  5A81 A;  4A9K A;  2MJV B;  5C4Q A;  5CTL A;  4TT4 A;  5A7C A;  4Y03 A;  5AD2 A;  4QYL A;  4A9J A;  4PCE A;  5D3H A;  5E9I A;  4YYG A;  3HME A;  4O7F A;  5IID A;  5E9V A;  5FE2 A;  5A5R A;  1JSP B;  5KO4 A;  2N9G A;  3ERR A;  5EGU A;  5CRZ A;  3DAI A;  3MUK A;  1ZS5 A;  3NXB A;  3O36 A;  5EWC A;  3S92 A;  4BHW A;  5KU3 A;  5I89 A;  4IOQ A;  4TU4 A;  4O78 A;  4LR6 A;  5I7Y A;  2EJN A;  4KCX A;  4UIY A;  5COI A;  4UIZ A;  5LKX A;  4O75 A;  2WP1 A;  4TTE A;  4LZS A;  5L8U A;  4N4G A;  4UIU A;  5D26 A;  2DVQ A;  4ZW1 A;  4CUQ A;  4YBT A;  4NYW A;  4QSU A;  5LVQ A;  2D9E A;  4PCI A;  3U5P A;  5CQ4 A;  5FE4 A;  5LKU A;  1EQF A;  5EK9 A;  3ONI A;  4MEP A;  3U5N A;  5DFD A;  5K29 A;  4Z93 A;  4IOR A;  5IGK A;  2NXB A;  5CU8 A;  4NR8 A;  4QBM A;  4MR6 A;  4QSX A;  5BT3 A;  5CQ3 A;  2WP2 A;  5LJ1 A;  1E6I A;  5HFQ A;  4RVR A;  5AMF A;  5KTU A;  5A85 A;  3DWY A;  3SVF A;  4O7B A;  4QC3 A;  2DVS A;  5A82 A;  3MQM A;  4HXO A;  3UVD A;  4XYA A;  4Z6I A;  3G0L A;  2L5E A;  4WIV A;  3UV2 A;  4NYV A;  4NR5 A;  2D82 A;  5C8G A;  5DLX A;  5EP7 A;  5LKT A;  1N72 A;  4PS5 A;  4O77 A;  5CPE A;  4XY9 A;  5IG6 A;  5HRW A;  5C89 A;  5A5S A;  2OUO A;  4YY6 A;  5DFB A;  5E9L A;  5L8T A;  4A9E A;  2DAT A;  4NR9 A;  4KV4 A;  5LJ0 A;  4ALG A;  5CQA A;  5FE0 A;  4HBY A;  5FG4 A;  5TCM A;  5E3G A;  4F3I A;  5A5P A;  5FE5 A;  5FBX A;  3MUL A;  5D3R A;  4CFL A;  4IR4 A;  3SVH A;  5L97 A;  4HBW A;  4QB3 A;  4PY6 A;  2E3K A;  4YAT A;  5F63 A;  5IGL A;  5FH6 A;  4HXM A;  5F1H A;  5DW2 A;  5FFY A;  4E96 A;  4QSV A;  3MB4 A;  2F6J A;  4Z1S A;  4QST A;  4QYD A;  4YH3 A;  3U5J A;  4YH4 A;  3UV5 A;  3QZV A;  4QC1 A;  5D7X A;  4GPJ A;  3UV4 A;  4YYM A;  3U5M A;  2E7O A;  1WUG A;  4TYL A;  4UIW A;  4NUD A;  5F1L A;  3RCW A;  4XY8 A;  5A83 A;  2DKW A;  4IR6 A;  5CRM A;  2R0S A;  4AKG A;  5I7X A;  4O76 A;  4NQN A;  2YYN A;  2I8N A;  4J1P A;  4NR7 A;  4NR4 A;  4A9H A;  3O35 A;  4FLP A;  4LZR A;  5D25 A;  3AQA A;  3AAD A;  4QSW A;  5D3S A;  3P1E A;  5DYU A;  5JI8 A;  5ACY A;  3LQH A;  2RI7 A;  4BW2 A;  4A9O A;  4UIX A;  4TU6 A;  4LC2 A;  4HXR A;  4YAD A;  4YC9 A;  5H85 A;  4O70 A;  2RO1 A;  5E9Y A;  4XUB A;  3U5K A;  5LKZ A;  3JVM A;  3HMF A;  4ZQL A;  5EVA A;  5CFW A;  4QUT A;  4A9N A;  4AKH A;  2RFJ A;  5F25 A;  3FKM X;  5LUU A;  5DX4 A;  5F5Z A;  3Q2E A;  4N4I A;  5D3P A;  5F3A A;  2R10 A;  4KV1 A;  5A5O A;  4A9L A;  4MEN A;  5A5Q A;  3S91 A;  3O34 A;  3ZYU A;  5ETD A;  5EU1 A;  5HCL A;  5D24 A;  4O71 A;  5HQ6 A;  3HMH A;  4AI6 A;  2L85 A;  4NUE A;  4WHU A;  4QR3 A;  4YAX A;  3D1B A;  4UYF B;  3IU6 A;  5HRV A;  2E7N A;  5ENF A;  3JVL A;  5CUA A;  4PKL A;  5DY7 A;  4Z6H A;  5E3D A;  5BT5 A;  4WHW A;  3VKH A;  4YK0 A;  5HQ5 A;  4CUS A;  4QY4 A;  5E74 A;  5HFR A;  5II2 A;  5EWW A;  3G0J A;  4TS8 A;  5H1V A;  4MEQ A;  3UVX A;  5IGM A;  5JWM A;  4HXN A;  4YY4 A;  5HEN A;  5J0D A;  3Q2F A;  4HXK A;  4MR4 A;  4OGI A;  3U5O A;  3K2J A;  2LSP B;  5H1T A;  5D0C A;  4NRA A;  2YEL A;  1X0J A;  4NRC A;  5ENJ A;  4OGJ A;  4QSS A;  4HXP A;  4CUR A;  4NYX A;  5I88 A;  4TZ8 A;  4BJX A;  5ENH A;  2DWW A;  4CUP A;  4NQM A;  5HLS A;  5FE7 A;  4A9M A;  2YW5 A;  5C85 A;  1F68 A;  2RNW A;  5LVR A;  4IR5 A;  5DW1 A;  4LYI A;  4ZC9 A;  4NXJ A;  5EWD A;  4IR3 A;  5C7N A;  4NR6 A;  3QZS A;  4QR5 A;  5L99 A;  3MB3 A;  4HXS A;  3P1D A;  4X2I A;  2RNY A;  3JVJ A;  3P1C A;  5EPR A;  3P5O A;  2R0Y A;  3QZT A;  4HBX A;  2YEM A;  3UW9 A;  3U5L A;  4LRG A;  4HBV A;  4O7E A;  5EM3 A;  5BT4 A;  5DFC A;  5ENI A;  5CQ5 A;  2RS9 B;  4QR4 A;  4QSP A;  5CUC A;  5HRX A;  3GG3 A;  5FB0 A;  4CLB A;  5HEL A;  4O7A A;  4O7C A;  5I80 A;  3I3J A;  4HXL A;  5ETB A;  3MXF A;  5EPB A;  5AME A;  5CS8 A;  4MEO A;  4OUF A;  5EPS A;  5HEM A;  5E0R A;  5ENB A;  2H60 A;  2I7K A;  5I86 A;  4CUT A;  2OO1 A;  2YEK A;  5FE9 A;  5F36 A;  5FH8 A;  5I1Q A;  5II1 A;  1JM4 B;  5F61 A;  3LJW A;  4O74 A;  5EA1 A;  5LJ2 A;  4QSQ A;  5AD3 A;  5G4S A;  2R0V A;  5DLZ A;  4TZ2 A;  5DKD A;  5FDZ A;  4ALH A;  5DKH A;  4UYH A;  5CUB A;  5DYA A;  3TLP A;  3IU5 A;  5DYC A;  3UVY A;  5DYX A;  4LYS A;  5EIC A;  4IOO A;  4DON A;  4N3W A;  5D3T A;  5CZG A;  4TT2 A;  5F2P A;  5KHM A;  2F6N A;  4TQN A;  3LXJ A;  4UYG A;  4MR5 A;  4UYD A;  4J0R A;  2OSS A;  4BW4 A;  5E9K A;  1ZKR A;  4QUU A;  5FE8 A;  5ENE A;  2DVV A;  4TT6 A;  4O72 A;  5E7D A;  5IBN A;  2FSA A;  5CP5 A;  4C67 A;  5FG6 A;  4QEU A;  2KTB B;  4QEW A;  3O33 A;  5ENC A;  5H1U A; 
#chains in the Genus database with same CATH homology
 4YYK A;  5L98 A;  2GRC A;  3LQI A;  4A9F A;  2RNX A;  5FE6 A;  5FFV A;  4YBS A;  4QZS A;  4XUA A;  5FG5 A;  4J3I A;  5HJC A;  5FE1 A;  5F62 A;  2L84 A;  4NRB A;  3UVW A;  5IGN A;  4QNS A;  4YAB A;  5FFW A;  4YYI A;  5EIS A;  5CQ6 A;  5A5N A;  5EV9 A;  3LQJ A;  4BW1 A;  5DKC A;  5KTW A;  5DBM A;  2G4A A;  5EI4 A;  5FE3 A;  5FH7 A;  4LYW A;  5EWH A;  3D7C A;  3JVK A;  5L96 A;  2YDW A;  4PTB A;  4UIV A;  5I29 A;  5I40 A;  4N4F A;  5CQ7 A;  4YYH A;  4LDF A;  5G4R A;  4QSR A;  4MR3 A;  4C66 A;  5E73 A;  4YYN A;  4YYJ A;  4UYF A;  4NS5 A;  5KTX A;  1WUM A;  4Q0O A;  4UIT A;  5EQ1 A;  5CQ8 A;  4N4H A;  4QEV A;  5HQ7 A;  4A9I A;  3P1F A;  4BW3 A;  4Z1Q A;  5CGP A;  5CY9 A;  5I83 A;  5ENG A;  4AKN A;  4J0S A;  4YYD A;  2DVR A;  3SVG A;  4NUC A;  5D3L A;  5FB1 A;  5C87 A;  5HM0 A;  4YBM A;  2YQD A;  5E9M A;  4CFK A;  5TB6 A;  4LZ2 A;  5D3N A;  5D3J A;  5CUD A;  5CUG A;  3O37 A;  4CUU A;  4CL9 A;  4Q0N A;  4UYE A;  5CQT A;  5CUE A;  5EWV A;  5F60 A;  5A81 A;  4A9K A;  2MJV B;  5C4Q A;  5CTL A;  4TT4 A;  5A7C A;  4Y03 A;  5AD2 A;  4QYL A;  4A9J A;  4PCE A;  5D3H A;  5E9I A;  4YYG A;  3HME A;  4O7F A;  5IID A;  5E9V A;  5FE2 A;  5A5R A;  1JSP B;  5KO4 A;  2N9G A;  5EGU A;  5CRZ A;  3DAI A;  3MUK A;  1ZS5 A;  3NXB A;  3O36 A;  5EWC A;  3S92 A;  4BHW A;  5KU3 A;  5I89 A;  4IOQ A;  4TU4 A;  4O78 A;  4LR6 A;  5I7Y A;  4KCX A;  4UIY A;  5COI A;  4UIZ A;  5LKX A;  4O75 A;  2WP1 A;  4TTE A;  4LZS A;  5L8U A;  4N4G A;  4UIU A;  5D26 A;  2DVQ A;  4ZW1 A;  4CUQ A;  4YBT A;  4NYW A;  4QSU A;  5LVQ A;  2D9E A;  4PCI A;  3U5P A;  5CQ4 A;  5FE4 A;  5LKU A;  1EQF A;  5EK9 A;  3ONI A;  4MEP A;  3U5N A;  5DFD A;  5K29 A;  4Z93 A;  4IOR A;  5IGK A;  2NXB A;  5CU8 A;  4NR8 A;  4QBM A;  4MR6 A;  4QSX A;  5BT3 A;  5CQ3 A;  2WP2 A;  5LJ1 A;  1E6I A;  5HFQ A;  4RVR A;  5AMF A;  5KTU A;  5A85 A;  3DWY A;  3SVF A;  4O7B A;  4QC3 A;  2DVS A;  5A82 A;  3MQM A;  4HXO A;  3UVD A;  4XYA A;  4Z6I A;  3G0L A;  2L5E A;  4WIV A;  3UV2 A;  4NYV A;  4NR5 A;  2D82 A;  5C8G A;  5DLX A;  5EP7 A;  5LKT A;  1N72 A;  4PS5 A;  4O77 A;  5CPE A;  4XY9 A;  5IG6 A;  5HRW A;  5C89 A;  5A5S A;  2OUO A;  4YY6 A;  5DFB A;  5E9L A;  5L8T A;  4A9E A;  2DAT A;  4NR9 A;  4KV4 A;  5LJ0 A;  4ALG A;  5CQA A;  5FE0 A;  4HBY A;  5FG4 A;  5TCM A;  5E3G A;  4F3I A;  5A5P A;  5FE5 A;  5FBX A;  3MUL A;  5D3R A;  4CFL A;  4IR4 A;  3SVH A;  5L97 A;  4HBW A;  4QB3 A;  4PY6 A;  2E3K A;  4YAT A;  5F63 A;  5IGL A;  5FH6 A;  4HXM A;  5F1H A;  5DW2 A;  5FFY A;  4E96 A;  4QSV A;  3MB4 A;  2F6J A;  4Z1S A;  4QST A;  4QYD A;  4YH3 A;  3U5J A;  4YH4 A;  3UV5 A;  3QZV A;  4QC1 A;  5D7X A;  4GPJ A;  3UV4 A;  4YYM A;  3U5M A;  2E7O A;  1WUG A;  4TYL A;  4UIW A;  4NUD A;  5F1L A;  3RCW A;  4XY8 A;  5A83 A;  2DKW A;  4IR6 A;  5CRM A;  2R0S A;  5I7X A;  4O76 A;  4NQN A;  2YYN A;  2I8N A;  4J1P A;  4NR7 A;  4NR4 A;  4A9H A;  3O35 A;  4FLP A;  4LZR A;  5D25 A;  3AQA A;  3AAD A;  4QSW A;  5D3S A;  3P1E A;  5DYU A;  5JI8 A;  5ACY A;  3LQH A;  2RI7 A;  4BW2 A;  4A9O A;  4UIX A;  4TU6 A;  4LC2 A;  4HXR A;  4YAD A;  4YC9 A;  5H85 A;  4O70 A;  2RO1 A;  5E9Y A;  4XUB A;  3U5K A;  5LKZ A;  3JVM A;  3HMF A;  4ZQL A;  5EVA A;  5CFW A;  4QUT A;  4A9N A;  2RFJ A;  5F25 A;  3FKM X;  5LUU A;  5DX4 A;  5F5Z A;  3Q2E A;  4N4I A;  5D3P A;  5F3A A;  2R10 A;  4KV1 A;  5A5O A;  4A9L A;  4MEN A;  5A5Q A;  3S91 A;  3O34 A;  3ZYU A;  5ETD A;  5EU1 A;  5HCL A;  5D24 A;  4O71 A;  5HQ6 A;  3HMH A;  2L85 A;  4NUE A;  4WHU A;  4QR3 A;  4YAX A;  4UYF B;  3IU6 A;  5HRV A;  2E7N A;  5ENF A;  3JVL A;  5CUA A;  4PKL A;  5DY7 A;  4Z6H A;  5E3D A;  5BT5 A;  4WHW A;  4YK0 A;  5HQ5 A;  4CUS A;  4QY4 A;  5E74 A;  5HFR A;  5II2 A;  5EWW A;  3G0J A;  4TS8 A;  5H1V A;  4MEQ A;  3UVX A;  5IGM A;  5JWM A;  4HXN A;  4YY4 A;  5HEN A;  5J0D A;  3Q2F A;  4HXK A;  4MR4 A;  4OGI A;  3U5O A;  3K2J A;  2LSP B;  5H1T A;  5D0C A;  4NRA A;  2YEL A;  1X0J A;  4NRC A;  5ENJ A;  4OGJ A;  4QSS A;  4HXP A;  4CUR A;  4NYX A;  5I88 A;  4TZ8 A;  4BJX A;  5ENH A;  2DWW A;  4CUP A;  4NQM A;  5HLS A;  5FE7 A;  4A9M A;  2YW5 A;  5C85 A;  1F68 A;  2RNW A;  5LVR A;  4IR5 A;  5DW1 A;  4LYI A;  4ZC9 A;  4NXJ A;  5EWD A;  4IR3 A;  5C7N A;  4NR6 A;  3QZS A;  4QR5 A;  5L99 A;  3MB3 A;  4HXS A;  3P1D A;  4X2I A;  2RNY A;  3JVJ A;  3P1C A;  5EPR A;  3P5O A;  2R0Y A;  3QZT A;  4HBX A;  2YEM A;  3UW9 A;  3U5L A;  4LRG A;  4HBV A;  4O7E A;  5EM3 A;  5BT4 A;  5DFC A;  5ENI A;  5CQ5 A;  2RS9 B;  4QR4 A;  4QSP A;  5CUC A;  5HRX A;  3GG3 A;  5FB0 A;  4CLB A;  5HEL A;  4O7A A;  4O7C A;  5I80 A;  3I3J A;  4HXL A;  5ETB A;  3MXF A;  5EPB A;  5AME A;  5CS8 A;  4MEO A;  4OUF A;  5EPS A;  5HEM A;  5E0R A;  5ENB A;  2H60 A;  2I7K A;  5I86 A;  4CUT A;  2OO1 A;  2YEK A;  5FE9 A;  5F36 A;  5FH8 A;  5I1Q A;  5II1 A;  1JM4 B;  5F61 A;  3LJW A;  4O74 A;  5EA1 A;  5LJ2 A;  4QSQ A;  5AD3 A;  5G4S A;  2R0V A;  5DLZ A;  4TZ2 A;  5DKD A;  5FDZ A;  4ALH A;  5DKH A;  4UYH A;  5CUB A;  5DYA A;  3TLP A;  3IU5 A;  5DYC A;  3UVY A;  5DYX A;  4LYS A;  5EIC A;  4IOO A;  4DON A;  4N3W A;  5D3T A;  5CZG A;  4TT2 A;  5F2P A;  5KHM A;  2F6N A;  4TQN A;  3LXJ A;  4UYG A;  4MR5 A;  4UYD A;  4J0R A;  2OSS A;  4BW4 A;  5E9K A;  4QUU A;  5FE8 A;  5ENE A;  2DVV A;  4TT6 A;  4O72 A;  5E7D A;  5IBN A;  2FSA A;  5CP5 A;  4C67 A;  5FG6 A;  4QEU A;  2KTB B;  4QEW A;  3O33 A;  5ENC A;  5H1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...