5FG4A

Crystal structure of the bromodomain of human brpf1 in complex with of-1 chemical probe
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
113
structure length
113
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peregrin
publication title Crystal structure of the bromodomain of human BRPF1 in complex with OF-1 chemical probe
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 39
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fg4A00
4OUFA 4QSVA 3O37A 2F6NA 3LJWA 5EVAA 5FDZA 4YADA 3RCWA 5K29A 4NR4A 5FFYA 5LJ2A 4YYJA 2L84A 4NQNA 4LZ2A 5CY9A 2D9EA 5H85A 4YBSA 5E9VA 4UYGA 2DVRA 5CQ5A 5FH8A 4A9NA 5CU8A 5F2PA 5I80A 4A9LA 4CFLA 5LVRA 5DKHA 5I7XA 4XYAA 2R0VA 5FE3A 4UYHA 5D3NA 5L96A 3QZTA 4NYXA 3UVYA 5C89A 1JM4B 5CUEA 2L5EA 3P1EA 5DY7A 5A5QA 2I7KA 4HBVA 4QSWA 4RVRA 5A5SA 5AD3A 5ENIA 3UW9A 3O36A 4UIYA 5F25A 4BW4A 3S92A 4PKLA 4YBTA 3JVKA 3LXJA 5F1LA 1JSPB 1N72A 5E3DA 5IGNA 4X2IA 3LQIA 4HXRA 4QUUA 4CUSA 5E3GA 5HLSA 4IR4A 4HXNA 5E9MA 3P1DA 5CRMA 4F3IA 2YYNA 5HRWA 4QC1A 2E7NA 5KTUA 2MJVB 4YYHA 3LQJA 3SVFA 5JWMA 4QSUA 5F36A 4YH3A 4O74A 4N4GA 4QSTA 3S91A 4NR7A 5E0RA 5A85A 5CQ3A 5FE9A 5F62A 5CZGA 4NRCA 5CUGA 5H1TA 5ENBA 4UYEA 2RNYA 4OGIA 5EI4A 4YY6A 2WP1A 5CQTA 5CQ7A 4ZC9A 5HENA 3HMEA 4NXJA 4QC3A 5ENGA 4A9IA 5F60A 4NR8A 4OGJA 4UIWA 5C85A 4N4IA 3U5KA 4NR6A 4PS5A 1ZS5A 4YYGA 5H1UA 4UYDA 5BT4A 4A9JA 4XY9A 4Z6IA 2YQDA 4NRAA 1E6IA 4QZSA 3U5PA 3HMHA 5D3TA 5HCLA 2OUOA 5D3JA 4Q0OA 5EK9A 4MEQA 5D0CA 5EA1A 5HFQA 4YAXA 5L8UA 4QYLA 2DVVA 3MQMA 3JVMA 4MEOA 5FE0A 5EPRA 2FSAA 2NXBA 4QSXA 5EWWA 4QSPA 4BW2A 5CUAA 4LR6A 4QSRA 4YYDA 4QY4A 3U5JA 5KU3A 1WUMA 5F1HA 4TU6A 2KTBB 3DWYA 4UIXA 4BJXA 2DVSA 4MENA 3AQAA 4YATA 5G4SA 4O70A 5E73A 5CFWA 3P1CA 4MR4A 2OO1A 4NUCA 5FB1A 5BT5A 5HQ6A 5LJ1A 5CUCA 4BW1A 4TT4A 5FH6A 5EWVA 5II2A 4A9OA 4TU4A 5A82A 4NS5A 4O75A 5IG6A 5LJ0A 5KTWA 5ACYA 2WP2A 4TZ2A 3P5OA 5JI8A 3D7CA 5FE1A 4TT2A 5DX4A 4Z6HA 2R0YA 4UITA 3U5NA 5A5NA 4QEUA 4O7CA 3UVWA 4NRBA 4O78A 5DYXA 4BHWA 4TS8A 3K2JA 2RNXA 5LKZA 4IOQA 2RNWA 2LSPB 5ENHA 5TCMA 5A83A 3U5LA 5FBXA 2L85A 3UVXA 5F61A 4C66A 4MR6A 2GRCA 4NUEA 3MB3A 5IBNA 3QZVA 4N4HA 3MXFA 5CS8A 4YH4A 5F5ZA 3LQHA 2DATA 5L8TA 2OSSA 4N4FA 1F68A 4QNSA 5A7CA 1X0JA 3NXBA 5D24A 3FKMX 5FE2A 5KTXA 4GPJA 5HELA 4HBWA 4TYLA 4A9EA 5CQAA 5L98A 4WHWA 4KCXA 5CQ4A 4Q0NA 2RI7A 4QBMA 4PTBA 4YK0A 3DAIA 5HM0A 4DONA 4QYDA 4BW3A 5DKCA 5LVQA 4E96A 4CFKA 4QSSA 5HJCA 4NQMA 4FLPA 5CUDA 3MUKA 4KV4A 4LZSA 4NYVA 4CLBA 5D3PA 4UIVA 5FB0A 1WUGA 4HXSA 4LZRA 3UV2A 4CL9A 5FE5A 4TTEA 3GG3A 4WIVA 5FE6A 4HXOA 4TQNA 5HQ5A 5CP5A 5I83A 3UV4A 2F6JA 2RO1A 4QUTA 5KO4A 4HXLA 5EWHA 5TB6A 5A5PA 4LYSA 4LYIA 5DFBA 5E9LA 3UV5A 5EWDA 5II1A 4O7EA 5HRXA 5ETDA 5EPBA 5EWCA 4UIUA 4A9KA 5EISA 5HEMA 2DWWA 4HXKA 5DW1A 4TT6A 4YYKA 4J3IA 4MR3A 5LKUA 5FE4A 3UVDA 5FFVA 5G4RA 4MEPA 5BT3A 2YEKA 4HBYA 5J0DA 5DBMA 4O7FA 5D3SA 3SVGA 5C87A 5CQ6A 5ENJA 4J0RA 3SVHA 2E7OA 3JVLA 5IGKA 4QB3A 5EP7A 5FG4A 4ALGA 5DKDA 4LC2A 5IIDA 4QEVA 5ENEA 4IOOA 5AD2A 3G0LA 4A9HA 5CQ8A 5EICA 2YDWA 4NR5A 4NYWA 5ENCA 5I7YA 2YELA 5FG6A 5I86A 4PCIA 5ETBA 4UYFB 2DKWA 4Z93A 2R10A 4MR5A 5AMFA 5D26A 5DFCA 4PCEA 3Q2EA 5LUUA 3AADA 4YC9A 5DLXA 3U5MA 1EQFA 5EGUA 5E74A 4KV1A 5EV9A 4C67A 4YYIA 5D3HA 4QR3A 5DYAA 5DW2A 2YW5A 4YABA 5KHMA 4HBXA 5EQ1A 5C4QA 2N9GA 5L99A 5HFRA 3Q2FA 4O77A 5I29A 5HRVA 5D25A 3JVJA 5D3LA 4Z1SA 4QR5A 5DFDA 4NUDA 4TZ8A 4QEWA 5I40A 5D7XA 4ZW1A 5L97A 5CUBA 4CUQA 5IGLA 2R0SA 4XUAA 4A9MA 3U5OA 4CUPA 5EPSA 4PY6A 4HXPA 4O71A 4QR4A 4LDFA 3O34A 4Z1QA 5CTLA 4O7AA 5H1VA 4IR5A 5I1QA 4LRGA 5EU1A 5CRZA 4A9FA 5FFWA 4ZQLA 5FG5A 5A5RA 4YYNA 4ALHA 3O33A 2DVQA 4O72A 5FE7A 2YEMA 4HXMA 2E3KA 4IR6A 5A81A 5E9KA 5CPEA 5E9IA 4LYWA 2I8NA 3G0JA 4UIZA 5FH7A 4UYFA 5LKTA 4CUTA 3MULA 3TLPA 5IGMA 2H60A 4IORA 4Y03A 4YY4A 4AKNA 2G4AA 5I89A 4O76A 2RFJA 4YYMA 3IU6A 4N3WA 5DLZA 5FE8A 5C7NA 5HQ7A 5COIA 4J1PA 2D82A 4O7BA 4QSQA 5C8GA 4XY8A 3ONIA 5AMEA 5DYCA 5DYUA 2RS9B 4WHUA 3MB4A 4IR3A 5F3AA 4YBMA 5CGPA 4XUBA 5I88A 5EM3A 5E7DA 5A5OA 3IU5A 4CURA 4CUUA 5E9YA 3ZYUA 5LKXA 5D3RA 5ENFA 5F63A 3QZSA 3P1FA 4NR9A 3I3JA 3HMFA 4J0SA 3O35A
chains in the Genus database with same CATH superfamily
4OUFA 4QSVA 3O37A 2F6NA 3LJWA 5EVAA 5FDZA 4YADA 3RCWA 5K29A 4NR4A 5FFYA 5LJ2A 3VKHA 4YYJA 2L84A 4NQNA 4LZ2A 5CY9A 2D9EA 5H85A 4YBSA 5E9VA 4UYGA 2DVRA 5CQ5A 5FH8A 4A9NA 5CU8A 5F2PA 5I80A 4A9LA 4CFLA 5LVRA 5DKHA 5I7XA 4XYAA 2R0VA 5FE3A 4UYHA 5D3NA 5L96A 3QZTA 4NYXA 3UVYA 5C89A 1JM4B 5CUEA 2L5EA 3P1EA 5DY7A 5A5QA 3D1DA 2I7KA 4HBVA 4QSWA 4RVRA 5A5SA 5AD3A 5ENIA 3UW9A 3O36A 4UIYA 5F25A 4BW4A 3S92A 4PKLA 4YBTA 3JVKA 3LXJA 5F1LA 1JSPB 1N72A 5E3DA 5IGNA 4X2IA 3LQIA 4HXRA 4QUUA 4CUSA 5E3GA 5HLSA 4IR4A 4HXNA 5E9MA 3P1DA 5CRMA 4F3IA 2YYNA 5HRWA 4QC1A 2E7NA 5KTUA 2MJVB 4YYHA 3LQJA 3SVFA 5JWMA 4QSUA 5F36A 4YH3A 4O74A 4N4GA 4QSTA 3S91A 4NR7A 5E0RA 5A85A 5CQ3A 5FE9A 5F62A 5CZGA 4NRCA 5CUGA 5H1TA 4AI6A 5ENBA 2EJNA 4UYEA 2RNYA 4OGIA 5EI4A 4YY6A 2WP1A 5CQTA 5CQ7A 4ZC9A 5HENA 3HMEA 4NXJA 4QC3A 5ENGA 4A9IA 5F60A 4NR8A 4OGJA 4UIWA 5C85A 4N4IA 3U5KA 4NR6A 4PS5A 1ZS5A 4YYGA 5H1UA 4UYDA 5BT4A 4A9JA 4XY9A 4Z6IA 2YQDA 4NRAA 1E6IA 4QZSA 3U5PA 3HMHA 5D3TA 5HCLA 2OUOA 5D3JA 4Q0OA 5EK9A 4MEQA 5D0CA 5EA1A 5HFQA 4YAXA 5L8UA 4QYLA 2DVVA 3MQMA 3JVMA 4MEOA 5FE0A 5EPRA 2FSAA 2NXBA 4QSXA 5EWWA 4QSPA 4BW2A 5CUAA 4LR6A 4QSRA 4YYDA 4QY4A 3U5JA 5KU3A 1WUMA 5F1HA 4TU6A 2KTBB 3DWYA 4UIXA 4BJXA 2DVSA 4MENA 3AQAA 4YATA 5G4SA 4O70A 5E73A 5CFWA 3P1CA 4MR4A 2OO1A 4NUCA 5FB1A 5BT5A 5HQ6A 5LJ1A 5CUCA 4BW1A 4TT4A 5FH6A 5EWVA 5II2A 4A9OA 4TU4A 5A82A 4NS5A 4O75A 5IG6A 5LJ0A 5KTWA 5ACYA 2WP2A 4TZ2A 3P5OA 5JI8A 3D7CA 5FE1A 4TT2A 5DX4A 4Z6HA 2R0YA 4UITA 3U5NA 5A5NA 4QEUA 4O7CA 3UVWA 4NRBA 4O78A 5DYXA 4BHWA 4TS8A 3K2JA 2RNXA 5LKZA 4IOQA 2RNWA 2LSPB 5ENHA 5TCMA 5A83A 3U5LA 5FBXA 2L85A 3UVXA 5F61A 4C66A 4MR6A 2GRCA 4NUEA 3MB3A 5IBNA 4AKGA 3QZVA 4N4HA 3MXFA 5CS8A 4YH4A 5F5ZA 3LQHA 2DATA 5L8TA 2OSSA 4N4FA 1F68A 4QNSA 5A7CA 1X0JA 3NXBA 5D24A 3FKMX 5FE2A 5KTXA 4GPJA 5HELA 4HBWA 4TYLA 4A9EA 5CQAA 5L98A 4WHWA 4KCXA 5CQ4A 4Q0NA 2RI7A 4QBMA 4PTBA 4YK0A 3DAIA 5HM0A 4DONA 4QYDA 4BW3A 1PUOA 5DKCA 5LVQA 4E96A 4CFKA 4QSSA 5HJCA 4NQMA 4FLPA 5CUDA 3MUKA 4KV4A 4LZSA 4NYVA 4CLBA 5D3PA 4UIVA 5FB0A 1WUGA 4HXSA 4LZRA 3UV2A 4CL9A 5FE5A 4TTEA 3GG3A 4WIVA 5FE6A 4HXOA 4TQNA 5HQ5A 3D1BA 5CP5A 5I83A 3UV4A 2F6JA 2RO1A 4QUTA 5KO4A 4HXLA 5EWHA 5TB6A 5A5PA 4LYSA 4LYIA 5DFBA 5E9LA 3UV5A 5EWDA 5II1A 4O7EA 5HRXA 5ETDA 5EPBA 5EWCA 4UIUA 4AKHA 4A9KA 5EISA 5HEMA 2DWWA 4HXKA 5DW1A 4TT6A 4YYKA 4J3IA 4MR3A 5LKUA 5FE4A 3UVDA 5FFVA 5G4RA 4MEPA 5BT3A 2YEKA 4HBYA 5J0DA 5DBMA 4O7FA 5D3SA 3SVGA 5C87A 4AKIA 5CQ6A 5ENJA 4J0RA 3SVHA 2E7OA 3JVLA 5IGKA 4QB3A 5EP7A 5FG4A 4ALGA 5DKDA 4LC2A 5IIDA 4QEVA 5ENEA 4IOOA 5AD2A 3G0LA 4A9HA 5CQ8A 5EICA 2YDWA 4NR5A 4NYWA 5ENCA 5I7YA 2YELA 5FG6A 5I86A 4PCIA 5ETBA 4UYFB 2DKWA 4Z93A 2R10A 4MR5A 5AMFA 5D26A 5DFCA 4PCEA 3Q2EA 1ZKRA 3AADA 5LUUA 4YC9A 5DLXA 3U5MA 1EQFA 5EGUA 5E74A 4KV1A 5EV9A 4C67A 4YYIA 5D3HA 4QR3A 5DYAA 5DW2A 2YW5A 4YABA 5KHMA 4HBXA 5EQ1A 5C4QA 2N9GA 5L99A 5HFRA 3Q2FA 4O77A 5I29A 5HRVA 5D25A 3JVJA 5D3LA 4Z1SA 4QR5A 5DFDA 4NUDA 4TZ8A 4QEWA 5I40A 5D7XA 4ZW1A 5L97A 5CUBA 4CUQA 5IGLA 2R0SA 4XUAA 4A9MA 3U5OA 4CUPA 3ERRA 5EPSA 4PY6A 4HXPA 4O71A 4QR4A 4LDFA 3O34A 4Z1QA 5CTLA 4O7AA 5H1VA 4IR5A 5I1QA 4LRGA 5EU1A 5CRZA 4A9FA 5FFWA 4ZQLA 5FG5A 5A5RA 3VKGA 4YYNA 4ALHA 3O33A 2DVQA 4O72A 5FE7A 2YEMA 4HXMA 2E3KA 4IR6A 5A81A 5E9KA 5CPEA 5E9IA 4LYWA 2I8NA 3G0JA 4UIZA 5FH7A 4UYFA 5LKTA 4CUTA 3MULA 3TLPA 5IGMA 2H60A 4IORA 4Y03A 4YY4A 4AKNA 2G4AA 5I89A 4O76A 2RFJA 4YYMA 3IU6A 4N3WA 5DLZA 5FE8A 5C7NA 5HQ7A 5COIA 4J1PA 2D82A 4O7BA 4QSQA 5C8GA 4XY8A 3ONIA 5AMEA 5DYCA 5DYUA 2RS9B 4WHUA 3MB4A 4IR3A 5F3AA 4YBMA 5CGPA 4XUBA 5I88A 5EM3A 5E7DA 5A5OA 3IU5A 4CURA 4CUUA 5E9YA 3ZYUA 5LKXA 5D3RA 5ENFA 5F63A 3QZSA 3P1FA 4NR9A 3I3JA 3HMFA 4J0SA 3O35A
chains in the Genus database with same CATH topology
4OUFA 4QSVA 3O37A 2F6NA 3LJWA 5EVAA 5FDZA 4YADA 3RCWA 5K29A 4NR4A 5FFYA 5LJ2A 4YYJA 2L84A 4NQNA 4LZ2A 5CY9A 2D9EA 5H85A 4YBSA 5E9VA 4UYGA 2DVRA 5CQ5A 5FH8A 4A9NA 5CU8A 5F2PA 5I80A 4A9LA 4CFLA 5LVRA 5DKHA 5I7XA 4XYAA 2R0VA 5FE3A 4UYHA 5D3NA 5L96A 3QZTA 4NYXA 3UVYA 5C89A 1JM4B 5CUEA 2L5EA 3P1EA 5DY7A 5A5QA 2I7KA 4HBVA 4QSWA 4RVRA 5A5SA 5AD3A 5ENIA 3UW9A 3O36A 4UIYA 5F25A 4BW4A 3S92A 4PKLA 4YBTA 3JVKA 3LXJA 5F1LA 1JSPB 1N72A 5E3DA 5IGNA 4X2IA 3LQIA 4HXRA 4QUUA 4CUSA 5E3GA 5HLSA 4IR4A 4HXNA 5E9MA 3P1DA 5CRMA 4F3IA 2YYNA 5HRWA 4QC1A 2E7NA 5KTUA 2MJVB 4YYHA 3LQJA 3SVFA 5JWMA 4QSUA 5F36A 4YH3A 4O74A 4N4GA 4QSTA 3S91A 4NR7A 5E0RA 5A85A 5CQ3A 5FE9A 5F62A 5CZGA 4NRCA 5CUGA 5H1TA 5ENBA 4UYEA 2RNYA 4OGIA 5EI4A 4YY6A 2WP1A 5CQTA 5CQ7A 4ZC9A 5HENA 3HMEA 4NXJA 4QC3A 5ENGA 4A9IA 5F60A 4NR8A 4OGJA 4UIWA 5C85A 4N4IA 3U5KA 4NR6A 4PS5A 1ZS5A 4YYGA 5H1UA 4UYDA 5BT4A 4A9JA 4XY9A 4Z6IA 2YQDA 4NRAA 1E6IA 4QZSA 3U5PA 3HMHA 5D3TA 5HCLA 2OUOA 5D3JA 4Q0OA 5EK9A 4MEQA 5D0CA 5EA1A 5HFQA 4YAXA 5L8UA 4QYLA 2DVVA 3MQMA 3JVMA 4MEOA 5FE0A 5EPRA 2FSAA 2NXBA 4QSXA 5EWWA 4QSPA 4BW2A 5CUAA 4LR6A 4QSRA 4YYDA 4QY4A 3U5JA 5KU3A 1WUMA 5F1HA 4TU6A 2KTBB 3DWYA 4UIXA 4BJXA 2DVSA 4MENA 3AQAA 4YATA 5G4SA 4O70A 5E73A 5CFWA 3P1CA 4MR4A 2OO1A 4NUCA 5FB1A 5BT5A 5HQ6A 5LJ1A 5CUCA 4BW1A 4TT4A 5FH6A 5EWVA 5II2A 4A9OA 4TU4A 5A82A 4NS5A 4O75A 5IG6A 5LJ0A 5KTWA 5ACYA 2WP2A 4TZ2A 3P5OA 5JI8A 3D7CA 5FE1A 4TT2A 5DX4A 4Z6HA 2R0YA 4UITA 3U5NA 5A5NA 4QEUA 4O7CA 3UVWA 4NRBA 4O78A 5DYXA 4BHWA 4TS8A 3K2JA 2RNXA 5LKZA 4IOQA 2RNWA 2LSPB 5ENHA 5TCMA 5A83A 3U5LA 5FBXA 2L85A 3UVXA 5F61A 4C66A 4MR6A 2GRCA 4NUEA 3MB3A 5IBNA 3QZVA 4N4HA 3MXFA 5CS8A 4YH4A 5F5ZA 3LQHA 2DATA 5L8TA 2OSSA 4N4FA 1F68A 4QNSA 5A7CA 1X0JA 3NXBA 5D24A 3FKMX 5FE2A 5KTXA 4GPJA 5HELA 4HBWA 4TYLA 4A9EA 5CQAA 5L98A 4WHWA 4KCXA 5CQ4A 4Q0NA 2RI7A 4QBMA 4PTBA 4YK0A 3DAIA 5HM0A 4DONA 4QYDA 4BW3A 5DKCA 5LVQA 4E96A 4CFKA 4QSSA 5HJCA 4NQMA 4FLPA 5CUDA 3MUKA 4KV4A 4LZSA 4NYVA 4CLBA 5D3PA 4UIVA 5FB0A 1WUGA 4HXSA 4LZRA 3UV2A 4CL9A 5FE5A 4TTEA 3GG3A 4WIVA 5FE6A 4HXOA 4TQNA 5HQ5A 5CP5A 5I83A 3UV4A 2F6JA 2RO1A 4QUTA 5KO4A 4HXLA 5EWHA 5TB6A 5A5PA 4LYSA 4LYIA 5DFBA 5E9LA 3UV5A 5EWDA 5II1A 4O7EA 5HRXA 5ETDA 5EPBA 5EWCA 4UIUA 4A9KA 5EISA 5HEMA 2DWWA 4HXKA 5DW1A 4TT6A 4YYKA 4J3IA 4MR3A 5LKUA 5FE4A 3UVDA 5FFVA 5G4RA 4MEPA 5BT3A 2YEKA 4HBYA 5J0DA 5DBMA 4O7FA 5D3SA 3SVGA 5C87A 5CQ6A 5ENJA 4J0RA 3SVHA 2E7OA 3JVLA 5IGKA 4QB3A 5EP7A 5FG4A 4ALGA 5DKDA 4LC2A 5IIDA 4QEVA 5ENEA 4IOOA 5AD2A 3G0LA 4A9HA 5CQ8A 5EICA 2YDWA 4NR5A 4NYWA 5ENCA 5I7YA 2YELA 5FG6A 5I86A 4PCIA 5ETBA 4UYFB 2DKWA 4Z93A 2R10A 4MR5A 5AMFA 5D26A 5DFCA 4PCEA 3Q2EA 5LUUA 3AADA 4YC9A 5DLXA 3U5MA 1EQFA 5EGUA 5E74A 4KV1A 5EV9A 4C67A 4YYIA 5D3HA 4QR3A 5DYAA 5DW2A 2YW5A 4YABA 5KHMA 4HBXA 5EQ1A 5C4QA 2N9GA 5L99A 5HFRA 3Q2FA 4O77A 5I29A 5HRVA 5D25A 3JVJA 5D3LA 4Z1SA 4QR5A 5DFDA 4NUDA 4TZ8A 4QEWA 5I40A 5D7XA 4ZW1A 5L97A 5CUBA 4CUQA 5IGLA 2R0SA 4XUAA 4A9MA 3U5OA 4CUPA 5EPSA 4PY6A 4HXPA 4O71A 4QR4A 4LDFA 3O34A 4Z1QA 5CTLA 4O7AA 5H1VA 4IR5A 5I1QA 4LRGA 5EU1A 5CRZA 4A9FA 5FFWA 4ZQLA 5FG5A 5A5RA 4YYNA 4ALHA 3O33A 2DVQA 4O72A 5FE7A 2YEMA 4HXMA 2E3KA 4IR6A 5A81A 5E9KA 5CPEA 5E9IA 4LYWA 2I8NA 3G0JA 4UIZA 5FH7A 4UYFA 5LKTA 4CUTA 3MULA 3TLPA 5IGMA 2H60A 4IORA 4Y03A 4YY4A 4AKNA 2G4AA 5I89A 4O76A 2RFJA 4YYMA 3IU6A 4N3WA 5DLZA 5FE8A 5C7NA 5HQ7A 5COIA 4J1PA 2D82A 4O7BA 4QSQA 5C8GA 4XY8A 3ONIA 5AMEA 5DYCA 5DYUA 2RS9B 4WHUA 3MB4A 4IR3A 5F3AA 4YBMA 5CGPA 4XUBA 5I88A 5EM3A 5E7DA 5A5OA 3IU5A 4CURA 4CUUA 5E9YA 3ZYUA 5LKXA 5D3RA 5ENFA 5F63A 3QZSA 3P1FA 4NR9A 3I3JA 3HMFA 4J0SA 3O35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OUF A;  4QSV A;  3O37 A;  2F6N A;  3LJW A;  5EVA A;  5FDZ A;  4YAD A;  3RCW A;  5K29 A;  4NR4 A;  5FFY A;  5LJ2 A;  4YYJ A;  2L84 A;  4NQN A;  4LZ2 A;  5CY9 A;  2D9E A;  5H85 A;  4YBS A;  5E9V A;  4UYG A;  2DVR A;  5CQ5 A;  5FH8 A;  4A9N A;  5CU8 A;  5F2P A;  5I80 A;  4A9L A;  4CFL A;  5LVR A;  5DKH A;  5I7X A;  4XYA A;  2R0V A;  5FE3 A;  4UYH A;  5D3N A;  5L96 A;  3QZT A;  4NYX A;  3UVY A;  5C89 A;  1JM4 B;  5CUE A;  2L5E A;  3P1E A;  5DY7 A;  5A5Q A;  2I7K A;  4HBV A;  4QSW A;  4RVR A;  5A5S A;  5AD3 A;  5ENI A;  3UW9 A;  3O36 A;  4UIY A;  5F25 A;  4BW4 A;  3S92 A;  4PKL A;  4YBT A;  3JVK A;  3LXJ A;  5F1L A;  1JSP B;  1N72 A;  5E3D A;  5IGN A;  4X2I A;  3LQI A;  4HXR A;  4QUU A;  4CUS A;  5E3G A;  5HLS A;  4IR4 A;  4HXN A;  5E9M A;  3P1D A;  5CRM A;  4F3I A;  2YYN A;  5HRW A;  4QC1 A;  2E7N A;  5KTU A;  2MJV B;  4YYH A;  3LQJ A;  3SVF A;  5JWM A;  4QSU A;  5F36 A;  4YH3 A;  4O74 A;  4N4G A;  4QST A;  3S91 A;  4NR7 A;  5E0R A;  5A85 A;  5CQ3 A;  5FE9 A;  5F62 A;  5CZG A;  4NRC A;  5CUG A;  5H1T A;  5ENB A;  4UYE A;  2RNY A;  4OGI A;  5EI4 A;  4YY6 A;  2WP1 A;  5CQT A;  5CQ7 A;  4ZC9 A;  5HEN A;  3HME A;  4NXJ A;  4QC3 A;  5ENG A;  4A9I A;  5F60 A;  4NR8 A;  4OGJ A;  4UIW A;  5C85 A;  4N4I A;  3U5K A;  4NR6 A;  4PS5 A;  1ZS5 A;  4YYG A;  5H1U A;  4UYD A;  5BT4 A;  4A9J A;  4XY9 A;  4Z6I A;  2YQD A;  4NRA A;  1E6I A;  4QZS A;  3U5P A;  3HMH A;  5D3T A;  5HCL A;  2OUO A;  5D3J A;  4Q0O A;  5EK9 A;  4MEQ A;  5D0C A;  5EA1 A;  5HFQ A;  4YAX A;  5L8U A;  4QYL A;  2DVV A;  3MQM A;  3JVM A;  4MEO A;  5FE0 A;  5EPR A;  2FSA A;  2NXB A;  4QSX A;  5EWW A;  4QSP A;  4BW2 A;  5CUA A;  4LR6 A;  4QSR A;  4YYD A;  4QY4 A;  3U5J A;  5KU3 A;  1WUM A;  5F1H A;  4TU6 A;  2KTB B;  3DWY A;  4UIX A;  4BJX A;  2DVS A;  4MEN A;  3AQA A;  4YAT A;  5G4S A;  4O70 A;  5E73 A;  5CFW A;  3P1C A;  4MR4 A;  2OO1 A;  4NUC A;  5FB1 A;  5BT5 A;  5HQ6 A;  5LJ1 A;  5CUC A;  4BW1 A;  4TT4 A;  5FH6 A;  5EWV A;  5II2 A;  4A9O A;  4TU4 A;  5A82 A;  4NS5 A;  4O75 A;  5IG6 A;  5LJ0 A;  5KTW A;  5ACY A;  2WP2 A;  4TZ2 A;  3P5O A;  5JI8 A;  3D7C A;  5FE1 A;  4TT2 A;  5DX4 A;  4Z6H A;  2R0Y A;  4UIT A;  3U5N A;  5A5N A;  4QEU A;  4O7C A;  3UVW A;  4NRB A;  4O78 A;  5DYX A;  4BHW A;  4TS8 A;  3K2J A;  2RNX A;  5LKZ A;  4IOQ A;  2RNW A;  2LSP B;  5ENH A;  5TCM A;  5A83 A;  3U5L A;  5FBX A;  2L85 A;  3UVX A;  5F61 A;  4C66 A;  4MR6 A;  2GRC A;  4NUE A;  3MB3 A;  5IBN A;  3QZV A;  4N4H A;  3MXF A;  5CS8 A;  4YH4 A;  5F5Z A;  3LQH A;  2DAT A;  5L8T A;  2OSS A;  4N4F A;  1F68 A;  4QNS A;  5A7C A;  1X0J A;  3NXB A;  5D24 A;  3FKM X;  5FE2 A;  5KTX A;  4GPJ A;  5HEL A;  4HBW A;  4TYL A;  4A9E A;  5CQA A;  5L98 A;  4WHW A;  4KCX A;  5CQ4 A;  4Q0N A;  2RI7 A;  4QBM A;  4PTB A;  4YK0 A;  3DAI A;  5HM0 A;  4DON A;  4QYD A;  4BW3 A;  5DKC A;  5LVQ A;  4E96 A;  4CFK A;  4QSS A;  5HJC A;  4NQM A;  4FLP A;  5CUD A;  3MUK A;  4KV4 A;  4LZS A;  4NYV A;  4CLB A;  5D3P A;  4UIV A;  5FB0 A;  1WUG A;  4HXS A;  4LZR A;  3UV2 A;  4CL9 A;  5FE5 A;  4TTE A;  3GG3 A;  4WIV A;  5FE6 A;  4HXO A;  4TQN A;  5HQ5 A;  5CP5 A;  5I83 A;  3UV4 A;  2F6J A;  2RO1 A;  4QUT A;  5KO4 A;  4HXL A;  5EWH A;  5TB6 A;  5A5P A;  4LYS A;  4LYI A;  5DFB A;  5E9L A;  3UV5 A;  5EWD A;  5II1 A;  4O7E A;  5HRX A;  5ETD A;  5EPB A;  5EWC A;  4UIU A;  4A9K A;  5EIS A;  5HEM A;  2DWW A;  4HXK A;  5DW1 A;  4TT6 A;  4YYK A;  4J3I A;  4MR3 A;  5LKU A;  5FE4 A;  3UVD A;  5FFV A;  5G4R A;  4MEP A;  5BT3 A;  2YEK A;  4HBY A;  5J0D A;  5DBM A;  4O7F A;  5D3S A;  3SVG A;  5C87 A;  5CQ6 A;  5ENJ A;  4J0R A;  3SVH A;  2E7O A;  3JVL A;  5IGK A;  4QB3 A;  5EP7 A;  5FG4 A;  4ALG A;  5DKD A;  4LC2 A;  5IID A;  4QEV A;  5ENE A;  4IOO A;  5AD2 A;  3G0L A;  4A9H A;  5CQ8 A;  5EIC A;  2YDW A;  4NR5 A;  4NYW A;  5ENC A;  5I7Y A;  2YEL A;  5FG6 A;  5I86 A;  4PCI A;  5ETB A;  4UYF B;  2DKW A;  4Z93 A;  2R10 A;  4MR5 A;  5AMF A;  5D26 A;  5DFC A;  4PCE A;  3Q2E A;  5LUU A;  3AAD A;  4YC9 A;  5DLX A;  3U5M A;  1EQF A;  5EGU A;  5E74 A;  4KV1 A;  5EV9 A;  4C67 A;  4YYI A;  5D3H A;  4QR3 A;  5DYA A;  5DW2 A;  2YW5 A;  4YAB A;  5KHM A;  4HBX A;  5EQ1 A;  5C4Q A;  2N9G A;  5L99 A;  5HFR A;  3Q2F A;  4O77 A;  5I29 A;  5HRV A;  5D25 A;  3JVJ A;  5D3L A;  4Z1S A;  4QR5 A;  5DFD A;  4NUD A;  4TZ8 A;  4QEW A;  5I40 A;  5D7X A;  4ZW1 A;  5L97 A;  5CUB A;  4CUQ A;  5IGL A;  2R0S A;  4XUA A;  4A9M A;  3U5O A;  4CUP A;  5EPS A;  4PY6 A;  4HXP A;  4O71 A;  4QR4 A;  4LDF A;  3O34 A;  4Z1Q A;  5CTL A;  4O7A A;  5H1V A;  4IR5 A;  5I1Q A;  4LRG A;  5EU1 A;  5CRZ A;  4A9F A;  5FFW A;  4ZQL A;  5FG5 A;  5A5R A;  4YYN A;  4ALH A;  3O33 A;  2DVQ A;  4O72 A;  5FE7 A;  2YEM A;  4HXM A;  2E3K A;  4IR6 A;  5A81 A;  5E9K A;  5CPE A;  5E9I A;  4LYW A;  2I8N A;  3G0J A;  4UIZ A;  5FH7 A;  4UYF A;  5LKT A;  4CUT A;  3MUL A;  3TLP A;  5IGM A;  2H60 A;  4IOR A;  4Y03 A;  4YY4 A;  4AKN A;  2G4A A;  5I89 A;  4O76 A;  2RFJ A;  4YYM A;  3IU6 A;  4N3W A;  5DLZ A;  5FE8 A;  5C7N A;  5HQ7 A;  5COI A;  4J1P A;  2D82 A;  4O7B A;  4QSQ A;  5C8G A;  4XY8 A;  3ONI A;  5AME A;  5DYC A;  5DYU A;  2RS9 B;  4WHU A;  3MB4 A;  4IR3 A;  5F3A A;  4YBM A;  5CGP A;  4XUB A;  5I88 A;  5EM3 A;  5E7D A;  5A5O A;  3IU5 A;  4CUR A;  4CUU A;  5E9Y A;  3ZYU A;  5LKX A;  5D3R A;  5ENF A;  5F63 A;  3QZS A;  3P1F A;  4NR9 A;  3I3J A;  3HMF A;  4J0S A;  3O35 A; 
#chains in the Genus database with same CATH topology
 4OUF A;  4QSV A;  3O37 A;  2F6N A;  3LJW A;  5EVA A;  5FDZ A;  4YAD A;  3RCW A;  5K29 A;  4NR4 A;  5FFY A;  5LJ2 A;  3VKH A;  4YYJ A;  2L84 A;  4NQN A;  4LZ2 A;  5CY9 A;  2D9E A;  5H85 A;  4YBS A;  5E9V A;  4UYG A;  2DVR A;  5CQ5 A;  5FH8 A;  4A9N A;  5CU8 A;  5F2P A;  5I80 A;  4A9L A;  4CFL A;  5LVR A;  5DKH A;  5I7X A;  4XYA A;  2R0V A;  5FE3 A;  4UYH A;  5D3N A;  5L96 A;  3QZT A;  4NYX A;  3UVY A;  5C89 A;  1JM4 B;  5CUE A;  2L5E A;  3P1E A;  5DY7 A;  5A5Q A;  3D1D A;  2I7K A;  4HBV A;  4QSW A;  4RVR A;  5A5S A;  5AD3 A;  5ENI A;  3UW9 A;  3O36 A;  4UIY A;  5F25 A;  4BW4 A;  3S92 A;  4PKL A;  4YBT A;  3JVK A;  3LXJ A;  5F1L A;  1JSP B;  1N72 A;  5E3D A;  5IGN A;  4X2I A;  3LQI A;  4HXR A;  4QUU A;  4CUS A;  5E3G A;  5HLS A;  4IR4 A;  4HXN A;  5E9M A;  3P1D A;  5CRM A;  4F3I A;  2YYN A;  5HRW A;  4QC1 A;  2E7N A;  5KTU A;  2MJV B;  4YYH A;  3LQJ A;  3SVF A;  5JWM A;  4QSU A;  5F36 A;  4YH3 A;  4O74 A;  4N4G A;  4QST A;  3S91 A;  4NR7 A;  5E0R A;  5A85 A;  5CQ3 A;  5FE9 A;  5F62 A;  5CZG A;  4NRC A;  5CUG A;  5H1T A;  4AI6 A;  5ENB A;  2EJN A;  4UYE A;  2RNY A;  4OGI A;  5EI4 A;  4YY6 A;  2WP1 A;  5CQT A;  5CQ7 A;  4ZC9 A;  5HEN A;  3HME A;  4NXJ A;  4QC3 A;  5ENG A;  4A9I A;  5F60 A;  4NR8 A;  4OGJ A;  4UIW A;  5C85 A;  4N4I A;  3U5K A;  4NR6 A;  4PS5 A;  1ZS5 A;  4YYG A;  5H1U A;  4UYD A;  5BT4 A;  4A9J A;  4XY9 A;  4Z6I A;  2YQD A;  4NRA A;  1E6I A;  4QZS A;  3U5P A;  3HMH A;  5D3T A;  5HCL A;  2OUO A;  5D3J A;  4Q0O A;  5EK9 A;  4MEQ A;  5D0C A;  5EA1 A;  5HFQ A;  4YAX A;  5L8U A;  4QYL A;  2DVV A;  3MQM A;  3JVM A;  4MEO A;  5FE0 A;  5EPR A;  2FSA A;  2NXB A;  4QSX A;  5EWW A;  4QSP A;  4BW2 A;  5CUA A;  4LR6 A;  4QSR A;  4YYD A;  4QY4 A;  3U5J A;  5KU3 A;  1WUM A;  5F1H A;  4TU6 A;  2KTB B;  3DWY A;  4UIX A;  4BJX A;  2DVS A;  4MEN A;  3AQA A;  4YAT A;  5G4S A;  4O70 A;  5E73 A;  5CFW A;  3P1C A;  4MR4 A;  2OO1 A;  4NUC A;  5FB1 A;  5BT5 A;  5HQ6 A;  5LJ1 A;  5CUC A;  4BW1 A;  4TT4 A;  5FH6 A;  5EWV A;  5II2 A;  4A9O A;  4TU4 A;  5A82 A;  4NS5 A;  4O75 A;  5IG6 A;  5LJ0 A;  5KTW A;  5ACY A;  2WP2 A;  4TZ2 A;  3P5O A;  5JI8 A;  3D7C A;  5FE1 A;  4TT2 A;  5DX4 A;  4Z6H A;  2R0Y A;  4UIT A;  3U5N A;  5A5N A;  4QEU A;  4O7C A;  3UVW A;  4NRB A;  4O78 A;  5DYX A;  4BHW A;  4TS8 A;  3K2J A;  2RNX A;  5LKZ A;  4IOQ A;  2RNW A;  2LSP B;  5ENH A;  5TCM A;  5A83 A;  3U5L A;  5FBX A;  2L85 A;  3UVX A;  5F61 A;  4C66 A;  4MR6 A;  2GRC A;  4NUE A;  3MB3 A;  5IBN A;  4AKG A;  3QZV A;  4N4H A;  3MXF A;  5CS8 A;  4YH4 A;  5F5Z A;  3LQH A;  2DAT A;  5L8T A;  2OSS A;  4N4F A;  1F68 A;  4QNS A;  5A7C A;  1X0J A;  3NXB A;  5D24 A;  3FKM X;  5FE2 A;  5KTX A;  4GPJ A;  5HEL A;  4HBW A;  4TYL A;  4A9E A;  5CQA A;  5L98 A;  4WHW A;  4KCX A;  5CQ4 A;  4Q0N A;  2RI7 A;  4QBM A;  4PTB A;  4YK0 A;  3DAI A;  5HM0 A;  4DON A;  4QYD A;  4BW3 A;  1PUO A;  5DKC A;  5LVQ A;  4E96 A;  4CFK A;  4QSS A;  5HJC A;  4NQM A;  4FLP A;  5CUD A;  3MUK A;  4KV4 A;  4LZS A;  4NYV A;  4CLB A;  5D3P A;  4UIV A;  5FB0 A;  1WUG A;  4HXS A;  4LZR A;  3UV2 A;  4CL9 A;  5FE5 A;  4TTE A;  3GG3 A;  4WIV A;  5FE6 A;  4HXO A;  4TQN A;  5HQ5 A;  3D1B A;  5CP5 A;  5I83 A;  3UV4 A;  2F6J A;  2RO1 A;  4QUT A;  5KO4 A;  4HXL A;  5EWH A;  5TB6 A;  5A5P A;  4LYS A;  4LYI A;  5DFB A;  5E9L A;  3UV5 A;  5EWD A;  5II1 A;  4O7E A;  5HRX A;  5ETD A;  5EPB A;  5EWC A;  4UIU A;  4AKH A;  4A9K A;  5EIS A;  5HEM A;  2DWW A;  4HXK A;  5DW1 A;  4TT6 A;  4YYK A;  4J3I A;  4MR3 A;  5LKU A;  5FE4 A;  3UVD A;  5FFV A;  5G4R A;  4MEP A;  5BT3 A;  2YEK A;  4HBY A;  5J0D A;  5DBM A;  4O7F A;  5D3S A;  3SVG A;  5C87 A;  4AKI A;  5CQ6 A;  5ENJ A;  4J0R A;  3SVH A;  2E7O A;  3JVL A;  5IGK A;  4QB3 A;  5EP7 A;  5FG4 A;  4ALG A;  5DKD A;  4LC2 A;  5IID A;  4QEV A;  5ENE A;  4IOO A;  5AD2 A;  3G0L A;  4A9H A;  5CQ8 A;  5EIC A;  2YDW A;  4NR5 A;  4NYW A;  5ENC A;  5I7Y A;  2YEL A;  5FG6 A;  5I86 A;  4PCI A;  5ETB A;  4UYF B;  2DKW A;  4Z93 A;  2R10 A;  4MR5 A;  5AMF A;  5D26 A;  5DFC A;  4PCE A;  3Q2E A;  1ZKR A;  3AAD A;  5LUU A;  4YC9 A;  5DLX A;  3U5M A;  1EQF A;  5EGU A;  5E74 A;  4KV1 A;  5EV9 A;  4C67 A;  4YYI A;  5D3H A;  4QR3 A;  5DYA A;  5DW2 A;  2YW5 A;  4YAB A;  5KHM A;  4HBX A;  5EQ1 A;  5C4Q A;  2N9G A;  5L99 A;  5HFR A;  3Q2F A;  4O77 A;  5I29 A;  5HRV A;  5D25 A;  3JVJ A;  5D3L A;  4Z1S A;  4QR5 A;  5DFD A;  4NUD A;  4TZ8 A;  4QEW A;  5I40 A;  5D7X A;  4ZW1 A;  5L97 A;  5CUB A;  4CUQ A;  5IGL A;  2R0S A;  4XUA A;  4A9M A;  3U5O A;  4CUP A;  3ERR A;  5EPS A;  4PY6 A;  4HXP A;  4O71 A;  4QR4 A;  4LDF A;  3O34 A;  4Z1Q A;  5CTL A;  4O7A A;  5H1V A;  4IR5 A;  5I1Q A;  4LRG A;  5EU1 A;  5CRZ A;  4A9F A;  5FFW A;  4ZQL A;  5FG5 A;  5A5R A;  3VKG A;  4YYN A;  4ALH A;  3O33 A;  2DVQ A;  4O72 A;  5FE7 A;  2YEM A;  4HXM A;  2E3K A;  4IR6 A;  5A81 A;  5E9K A;  5CPE A;  5E9I A;  4LYW A;  2I8N A;  3G0J A;  4UIZ A;  5FH7 A;  4UYF A;  5LKT A;  4CUT A;  3MUL A;  3TLP A;  5IGM A;  2H60 A;  4IOR A;  4Y03 A;  4YY4 A;  4AKN A;  2G4A A;  5I89 A;  4O76 A;  2RFJ A;  4YYM A;  3IU6 A;  4N3W A;  5DLZ A;  5FE8 A;  5C7N A;  5HQ7 A;  5COI A;  4J1P A;  2D82 A;  4O7B A;  4QSQ A;  5C8G A;  4XY8 A;  3ONI A;  5AME A;  5DYC A;  5DYU A;  2RS9 B;  4WHU A;  3MB4 A;  4IR3 A;  5F3A A;  4YBM A;  5CGP A;  4XUB A;  5I88 A;  5EM3 A;  5E7D A;  5A5O A;  3IU5 A;  4CUR A;  4CUU A;  5E9Y A;  3ZYU A;  5LKX A;  5D3R A;  5ENF A;  5F63 A;  3QZS A;  3P1F A;  4NR9 A;  3I3J A;  3HMF A;  4J0S A;  3O35 A; 
#chains in the Genus database with same CATH homology
 4OUF A;  4QSV A;  3O37 A;  2F6N A;  3LJW A;  5EVA A;  5FDZ A;  4YAD A;  3RCW A;  5K29 A;  4NR4 A;  5FFY A;  5LJ2 A;  4YYJ A;  2L84 A;  4NQN A;  4LZ2 A;  5CY9 A;  2D9E A;  5H85 A;  4YBS A;  5E9V A;  4UYG A;  2DVR A;  5CQ5 A;  5FH8 A;  4A9N A;  5CU8 A;  5F2P A;  5I80 A;  4A9L A;  4CFL A;  5LVR A;  5DKH A;  5I7X A;  4XYA A;  2R0V A;  5FE3 A;  4UYH A;  5D3N A;  5L96 A;  3QZT A;  4NYX A;  3UVY A;  5C89 A;  1JM4 B;  5CUE A;  2L5E A;  3P1E A;  5DY7 A;  5A5Q A;  2I7K A;  4HBV A;  4QSW A;  4RVR A;  5A5S A;  5AD3 A;  5ENI A;  3UW9 A;  3O36 A;  4UIY A;  5F25 A;  4BW4 A;  3S92 A;  4PKL A;  4YBT A;  3JVK A;  3LXJ A;  5F1L A;  1JSP B;  1N72 A;  5E3D A;  5IGN A;  4X2I A;  3LQI A;  4HXR A;  4QUU A;  4CUS A;  5E3G A;  5HLS A;  4IR4 A;  4HXN A;  5E9M A;  3P1D A;  5CRM A;  4F3I A;  2YYN A;  5HRW A;  4QC1 A;  2E7N A;  5KTU A;  2MJV B;  4YYH A;  3LQJ A;  3SVF A;  5JWM A;  4QSU A;  5F36 A;  4YH3 A;  4O74 A;  4N4G A;  4QST A;  3S91 A;  4NR7 A;  5E0R A;  5A85 A;  5CQ3 A;  5FE9 A;  5F62 A;  5CZG A;  4NRC A;  5CUG A;  5H1T A;  5ENB A;  4UYE A;  2RNY A;  4OGI A;  5EI4 A;  4YY6 A;  2WP1 A;  5CQT A;  5CQ7 A;  4ZC9 A;  5HEN A;  3HME A;  4NXJ A;  4QC3 A;  5ENG A;  4A9I A;  5F60 A;  4NR8 A;  4OGJ A;  4UIW A;  5C85 A;  4N4I A;  3U5K A;  4NR6 A;  4PS5 A;  1ZS5 A;  4YYG A;  5H1U A;  4UYD A;  5BT4 A;  4A9J A;  4XY9 A;  4Z6I A;  2YQD A;  4NRA A;  1E6I A;  4QZS A;  3U5P A;  3HMH A;  5D3T A;  5HCL A;  2OUO A;  5D3J A;  4Q0O A;  5EK9 A;  4MEQ A;  5D0C A;  5EA1 A;  5HFQ A;  4YAX A;  5L8U A;  4QYL A;  2DVV A;  3MQM A;  3JVM A;  4MEO A;  5FE0 A;  5EPR A;  2FSA A;  2NXB A;  4QSX A;  5EWW A;  4QSP A;  4BW2 A;  5CUA A;  4LR6 A;  4QSR A;  4YYD A;  4QY4 A;  3U5J A;  5KU3 A;  1WUM A;  5F1H A;  4TU6 A;  2KTB B;  3DWY A;  4UIX A;  4BJX A;  2DVS A;  4MEN A;  3AQA A;  4YAT A;  5G4S A;  4O70 A;  5E73 A;  5CFW A;  3P1C A;  4MR4 A;  2OO1 A;  4NUC A;  5FB1 A;  5BT5 A;  5HQ6 A;  5LJ1 A;  5CUC A;  4BW1 A;  4TT4 A;  5FH6 A;  5EWV A;  5II2 A;  4A9O A;  4TU4 A;  5A82 A;  4NS5 A;  4O75 A;  5IG6 A;  5LJ0 A;  5KTW A;  5ACY A;  2WP2 A;  4TZ2 A;  3P5O A;  5JI8 A;  3D7C A;  5FE1 A;  4TT2 A;  5DX4 A;  4Z6H A;  2R0Y A;  4UIT A;  3U5N A;  5A5N A;  4QEU A;  4O7C A;  3UVW A;  4NRB A;  4O78 A;  5DYX A;  4BHW A;  4TS8 A;  3K2J A;  2RNX A;  5LKZ A;  4IOQ A;  2RNW A;  2LSP B;  5ENH A;  5TCM A;  5A83 A;  3U5L A;  5FBX A;  2L85 A;  3UVX A;  5F61 A;  4C66 A;  4MR6 A;  2GRC A;  4NUE A;  3MB3 A;  5IBN A;  3QZV A;  4N4H A;  3MXF A;  5CS8 A;  4YH4 A;  5F5Z A;  3LQH A;  2DAT A;  5L8T A;  2OSS A;  4N4F A;  1F68 A;  4QNS A;  5A7C A;  1X0J A;  3NXB A;  5D24 A;  3FKM X;  5FE2 A;  5KTX A;  4GPJ A;  5HEL A;  4HBW A;  4TYL A;  4A9E A;  5CQA A;  5L98 A;  4WHW A;  4KCX A;  5CQ4 A;  4Q0N A;  2RI7 A;  4QBM A;  4PTB A;  4YK0 A;  3DAI A;  5HM0 A;  4DON A;  4QYD A;  4BW3 A;  5DKC A;  5LVQ A;  4E96 A;  4CFK A;  4QSS A;  5HJC A;  4NQM A;  4FLP A;  5CUD A;  3MUK A;  4KV4 A;  4LZS A;  4NYV A;  4CLB A;  5D3P A;  4UIV A;  5FB0 A;  1WUG A;  4HXS A;  4LZR A;  3UV2 A;  4CL9 A;  5FE5 A;  4TTE A;  3GG3 A;  4WIV A;  5FE6 A;  4HXO A;  4TQN A;  5HQ5 A;  5CP5 A;  5I83 A;  3UV4 A;  2F6J A;  2RO1 A;  4QUT A;  5KO4 A;  4HXL A;  5EWH A;  5TB6 A;  5A5P A;  4LYS A;  4LYI A;  5DFB A;  5E9L A;  3UV5 A;  5EWD A;  5II1 A;  4O7E A;  5HRX A;  5ETD A;  5EPB A;  5EWC A;  4UIU A;  4A9K A;  5EIS A;  5HEM A;  2DWW A;  4HXK A;  5DW1 A;  4TT6 A;  4YYK A;  4J3I A;  4MR3 A;  5LKU A;  5FE4 A;  3UVD A;  5FFV A;  5G4R A;  4MEP A;  5BT3 A;  2YEK A;  4HBY A;  5J0D A;  5DBM A;  4O7F A;  5D3S A;  3SVG A;  5C87 A;  5CQ6 A;  5ENJ A;  4J0R A;  3SVH A;  2E7O A;  3JVL A;  5IGK A;  4QB3 A;  5EP7 A;  5FG4 A;  4ALG A;  5DKD A;  4LC2 A;  5IID A;  4QEV A;  5ENE A;  4IOO A;  5AD2 A;  3G0L A;  4A9H A;  5CQ8 A;  5EIC A;  2YDW A;  4NR5 A;  4NYW A;  5ENC A;  5I7Y A;  2YEL A;  5FG6 A;  5I86 A;  4PCI A;  5ETB A;  4UYF B;  2DKW A;  4Z93 A;  2R10 A;  4MR5 A;  5AMF A;  5D26 A;  5DFC A;  4PCE A;  3Q2E A;  5LUU A;  3AAD A;  4YC9 A;  5DLX A;  3U5M A;  1EQF A;  5EGU A;  5E74 A;  4KV1 A;  5EV9 A;  4C67 A;  4YYI A;  5D3H A;  4QR3 A;  5DYA A;  5DW2 A;  2YW5 A;  4YAB A;  5KHM A;  4HBX A;  5EQ1 A;  5C4Q A;  2N9G A;  5L99 A;  5HFR A;  3Q2F A;  4O77 A;  5I29 A;  5HRV A;  5D25 A;  3JVJ A;  5D3L A;  4Z1S A;  4QR5 A;  5DFD A;  4NUD A;  4TZ8 A;  4QEW A;  5I40 A;  5D7X A;  4ZW1 A;  5L97 A;  5CUB A;  4CUQ A;  5IGL A;  2R0S A;  4XUA A;  4A9M A;  3U5O A;  4CUP A;  5EPS A;  4PY6 A;  4HXP A;  4O71 A;  4QR4 A;  4LDF A;  3O34 A;  4Z1Q A;  5CTL A;  4O7A A;  5H1V A;  4IR5 A;  5I1Q A;  4LRG A;  5EU1 A;  5CRZ A;  4A9F A;  5FFW A;  4ZQL A;  5FG5 A;  5A5R A;  4YYN A;  4ALH A;  3O33 A;  2DVQ A;  4O72 A;  5FE7 A;  2YEM A;  4HXM A;  2E3K A;  4IR6 A;  5A81 A;  5E9K A;  5CPE A;  5E9I A;  4LYW A;  2I8N A;  3G0J A;  4UIZ A;  5FH7 A;  4UYF A;  5LKT A;  4CUT A;  3MUL A;  3TLP A;  5IGM A;  2H60 A;  4IOR A;  4Y03 A;  4YY4 A;  4AKN A;  2G4A A;  5I89 A;  4O76 A;  2RFJ A;  4YYM A;  3IU6 A;  4N3W A;  5DLZ A;  5FE8 A;  5C7N A;  5HQ7 A;  5COI A;  4J1P A;  2D82 A;  4O7B A;  4QSQ A;  5C8G A;  4XY8 A;  3ONI A;  5AME A;  5DYC A;  5DYU A;  2RS9 B;  4WHU A;  3MB4 A;  4IR3 A;  5F3A A;  4YBM A;  5CGP A;  4XUB A;  5I88 A;  5EM3 A;  5E7D A;  5A5O A;  3IU5 A;  4CUR A;  4CUU A;  5E9Y A;  3ZYU A;  5LKX A;  5D3R A;  5ENF A;  5F63 A;  3QZS A;  3P1F A;  4NR9 A;  3I3J A;  3HMF A;  4J0S A;  3O35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...