5FG4A

Crystal structure of the bromodomain of human brpf1 in complex with of-1 chemical probe
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
113
structure length
113
Chain Sequence
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Peregrin
publication title Crystal structure of the bromodomain of human BRPF1 in complex with OF-1 chemical probe
rcsb
source organism Homo sapiens
total genus 39
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2015-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fg4A00
4NR7A 5DYAA 5E7DA 3K2JA 4UYGA 5FE5A 4LZSA 1WUGA 4O78A 3U5LA 4HXMA 5FE0A 5HRWA 5E9LA 3S92A 5C85A 4N4GA 5ETDA 3AQAA 4QEWA 4Z1SA 5HLSA 5HFRA 4UIUA 5E9KA 4QYLA 5E0RA 5HQ7A 3UVYA 5CGPA 1JM4B 5EWCA 4AKNA 4WHUA 4ALGA 1JSPB 5F63A 5DFDA 3UV4A 4LDFA 4MR3A 4QC1A 5FH7A 3U5MA 2RFJA 4PKLA 5FFYA 5CUGA 1F68A 4NUDA 3UVXA 1EQFA 4C67A 4A9IA 4QEVA 5CQ7A 5HCLA 2GRCA 4E96A 4Z1QA 5LJ1A 5AMFA 4O7EA 5CQ8A 2OSSA 5HEMA 4A9JA 4CL9A 4NRCA 2RNWA 4QR5A 4O7FA 4O74A 3U5JA 5KTWA 4YK0A 4IR4A 5TB6A 5LKZA 5FH8A 4LYIA 4O7BA 5E3GA 4YYNA 3UVWA 3G0LA 4CUQA 5CS8A 5EWVA 5FE2A 3IU5A 4BW3A 4QUUA 5EWWA 5DFCA 5FDZA 2H60A 4HXOA 2OO1A 5EQ1A 4UIYA 4Z6IA 2I8NA 4UIXA 4PY6A 3QZVA 5CUAA 5FE4A 4YAXA 5D3LA 2YQDA 5EPSA 5I40A 4QZSA 5IGNA 4QSUA 5LKTA 4IR6A 3HMEA 3Q2EA 4A9FA 5D3HA 4UIZA 2L85A 4IOOA 5DW2A 4UYFA 4O76A 3Q2FA 4MEPA 5D3NA 3U5PA 4N4IA 2DVRA 5F3AA 4QSRA 4TQNA 4NYXA 5KHMA 3U5OA 5A5SA 4UYFB 5CQ5A 2E7OA 4IR3A 2DVQA 5DW1A 4YBTA 5C7NA 5HM0A 1ZS5A 4A9LA 5CUEA 4O77A 5LJ2A 4NR9A 2WP2A 5TCMA 4O75A 5C4QA 5I86A 4J3IA 5L97A 3SVGA 4PTBA 2RS9B 5F1HA 3MB4A 4QR3A 4YBMA 5IGLA 3JVJA 5J0DA 4QSTA 5II2A 5CQTA 4F3IA 2R10A 4YC9A 4C66A 2DKWA 2DVVA 2YYNA 4NRAA 4KV1A 4N4FA 4QC3A 2R0YA 5A5QA 4O70A 4CFKA 4O7CA 4XUAA 5E3DA 3O33A 5EU1A 5FG4A 2RO1A 4ALHA 4A9OA 5EM3A 4LR6A 4TU4A 5FG5A 2D9EA 5HELA 2F6JA 5D3PA 4N4HA 5LKUA 3JVMA 5D3SA 5A5RA 3O34A 5CY9A 5I83A 5HENA 2DVSA 5H85A 4BJXA 3UVDA 5DKDA 5FB1A 5L8TA 4UYHA 4ZQLA 2L5EA 5E9IA 5F36A 5DLXA 5FFWA 5HQ5A 4DONA 3UV5A 5CUDA 5E9VA 3MUKA 3G0JA 5IIDA 4HXLA 5EK9A 5H1TA 5I88A 2F6NA 4IOQA 5D24A 5KU3A 4QSQA 4IORA 2OUOA 5HJCA 3QZTA 2MJVB 3UV2A 5FBXA 5H1UA 5DYCA 1E6IA 2E7NA 4QB3A 5CPEA 4QEUA 4Q0OA 4QUTA 3ZYUA 5CQ4A 4LC2A 2YDWA 4ZW1A 4OGIA 5BT3A 4UIVA 4QR4A 5FE9A 4TT4A 5L98A 5F2PA 4HXKA 5FE3A 1WUMA 5EI4A 4RVRA 5CQAA 5HFQA 4YYJA 5E73A 5II1A 2RI7A 5D3JA 5AD3A 5I80A 2R0VA 4HBYA 5F60A 5ACYA 5I1QA 4TT2A 4LYWA 5A7CA 5CFWA 5LVQA 5F1LA 4CLBA 4NR5A 5H1VA 5BT4A 3UW9A 4X2IA 5IGMA 3LJWA 3LQHA 4QSPA 2KTBB 4WHWA 5EISA 5A81A 4J0SA 4CFLA 3ONIA 4CUPA 4HBWA 3IU6A 4BW2A 5F5ZA 2DATA 3O37A 4HXNA 4GPJA 5E9YA 4BW1A 4CURA 5EP7A 5D25A 2N9GA 4O7AA 4FLPA 4YH4A 4TZ2A 3P5OA 5C87A 5FE8A 1X0JA 5IG6A 5D0CA 5C89A 2LSPB 5L8UA 4OUFA 5I7YA 4UYDA 5DX4A 3SVFA 3QZSA 3DWYA 5AMEA 4QNSA 4QSVA 4A9MA 4Q0NA 5D7XA 3U5NA 4TTEA 4CUUA 3LQIA 4O71A 2YW5A 3MXFA 3AADA 4A9EA 4NYWA 3O35A 4HXSA 5LVRA 2RNXA 5DYXA 5DY7A 4CUTA 5EPRA 5G4SA 5ENHA 5A83A 5G4RA 4NR6A 4BW4A 3JVLA 4YATA 5EPBA 4WIVA 5IBNA 4BHWA 5EGUA 5ENCA 5I89A 5CTLA 4TU6A 2RNYA 4LZRA 4MEQA 3HMFA 4NQNA 4PCIA 4MEOA 5FFVA 2YEKA 5LJ0A 3P1FA 5ENJA 4YYMA 3MB3A 3MQMA 4J0RA 4YYKA 4UITA 4TS8A 5ENBA 2DWWA 4YY4A 5LKXA 4XY8A 5CUCA 4QY4A 5CRZA 3S91A 3I3JA 3LXJA 4QYDA 5FB0A 5JI8A 5JWMA 4PCEA 5CQ3A 4UYEA 2FSAA 5ENFA 5CQ6A 4LYSA 5CP5A 5IGKA 5E74A 5ETBA 5I7XA 4NRBA 3P1DA 5EVAA 5F62A 5HRXA 4KCXA 3FKMX 4IR5A 4YYIA 4Y03A 5C8GA 5EWHA 1N72A 4YBSA 4Z93A 4Z6HA 3U5KA 5EV9A 4MR5A 5ENIA 5FG6A 5HRVA 5CUBA 5F61A 4XY9A 5HQ6A 5K29A 5DBMA 3JVKA 5EICA 5FH6A 4ZC9A 5ENGA 4YABA 5DKCA 4LRGA 4NR8A 5D3TA 4A9KA 5ENEA 5D26A 4MR4A 5AD2A 5I29A 3DAIA 3MULA 5BT5A 4YY6A 4HXPA 2YEMA 4QSWA 4XUBA 5D3RA 2NXBA 4NXJA 4O72A 4NYVA 5FE1A 5KTXA 4NS5A 5FE7A 4CUSA 3P1CA 2E3KA 2R0SA 5KO4A 3D7CA 2G4AA 4NR4A 3O36A 4YYDA 5DLZA 4NQMA 4PS5A 5CZGA 5L99A 5CU8A 5EA1A 4A9HA 3GG3A 3LQJA 4YYGA 3RCWA 5FE6A 5DKHA 4HBVA 5A5PA 4KV4A 5EWDA 2WP1A 4HBXA 5E9MA 5CRMA 4YH3A 5A85A 4HXRA 2YELA 2D82A 4UIWA 5COIA 4TYLA 4QBMA 5DYUA 5DFBA 4YYHA 5L96A 4QSSA 4J1PA 2I7KA 4TT6A 2L84A 4QSXA 4N3WA 5A5OA 3HMHA 4LZ2A 4XYAA 5A82A 3NXBA 5KTUA 4MENA 4TZ8A 5LUUA 4YADA 4MR6A 4A9NA 4NUCA 3TLPA 5A5NA 3P1EA 4OGJA 3SVHA 5F25A 4NUEA
chains in the Genus database with same CATH superfamily
4NR7A 5DYAA 5E7DA 3K2JA 4UYGA 5FE5A 4LZSA 1WUGA 4O78A 3U5LA 4HXMA 5FE0A 5HRWA 5E9LA 3S92A 2EJNA 5C85A 4N4GA 5ETDA 3AQAA 4QEWA 4Z1SA 5HLSA 5HFRA 4UIUA 5E9KA 4QYLA 5E0RA 5HQ7A 3UVYA 5CGPA 1JM4B 5EWCA 4AKNA 4WHUA 4ALGA 1JSPB 5F63A 5DFDA 3UV4A 4LDFA 4MR3A 4QC1A 5FH7A 3U5MA 2RFJA 4PKLA 5FFYA 5CUGA 1F68A 4NUDA 3UVXA 1EQFA 4C67A 4A9IA 4QEVA 5CQ7A 5HCLA 2GRCA 4AKGA 4E96A 4Z1QA 5LJ1A 5AMFA 4O7EA 5CQ8A 2OSSA 5HEMA 4A9JA 4CL9A 4NRCA 2RNWA 4QR5A 1ZKRA 4O7FA 4O74A 3U5JA 5KTWA 4YK0A 4IR4A 5TB6A 5LKZA 5FH8A 4LYIA 4O7BA 5E3GA 4YYNA 3UVWA 3G0LA 4CUQA 5CS8A 5EWVA 5FE2A 3IU5A 4BW3A 4QUUA 5EWWA 5DFCA 5FDZA 2H60A 4HXOA 2OO1A 5EQ1A 4UIYA 4Z6IA 2I8NA 4UIXA 4PY6A 3QZVA 5CUAA 5FE4A 4YAXA 5D3LA 2YQDA 5EPSA 5I40A 4QZSA 5IGNA 4QSUA 5LKTA 4IR6A 3HMEA 3Q2EA 4A9FA 5D3HA 4UIZA 2L85A 4IOOA 5DW2A 4UYFA 4O76A 3Q2FA 4MEPA 5D3NA 3U5PA 4N4IA 2DVRA 5F3AA 4QSRA 4TQNA 4NYXA 5KHMA 3U5OA 5A5SA 4UYFB 5CQ5A 2E7OA 4IR3A 2DVQA 5DW1A 4YBTA 5C7NA 5HM0A 1ZS5A 4A9LA 5CUEA 4O77A 3D1BA 5LJ2A 4NR9A 2WP2A 5TCMA 4O75A 5C4QA 5I86A 4J3IA 5L97A 3SVGA 4PTBA 2RS9B 5F1HA 3MB4A 3VKHA 4QR3A 4YBMA 5IGLA 3JVJA 5J0DA 4QSTA 5II2A 5CQTA 4F3IA 2R10A 4YC9A 4C66A 2DKWA 2DVVA 2YYNA 4NRAA 4KV1A 4N4FA 4QC3A 2R0YA 5A5QA 4O70A 4CFKA 4O7CA 4XUAA 5E3DA 3O33A 5EU1A 5FG4A 2RO1A 4ALHA 4A9OA 5EM3A 4LR6A 4TU4A 5FG5A 2D9EA 5HELA 2F6JA 5D3PA 4N4HA 5LKUA 3JVMA 5D3SA 5A5RA 3O34A 5CY9A 5I83A 5HENA 2DVSA 5H85A 4BJXA 3UVDA 5DKDA 5FB1A 5L8TA 4UYHA 4ZQLA 2L5EA 5E9IA 5F36A 5DLXA 5FFWA 5HQ5A 4DONA 3UV5A 5CUDA 5E9VA 3MUKA 3G0JA 5IIDA 4HXLA 5EK9A 5H1TA 5I88A 2F6NA 4IOQA 5D24A 5KU3A 4QSQA 4IORA 2OUOA 5HJCA 3QZTA 2MJVB 3UV2A 5FBXA 5H1UA 5DYCA 1E6IA 2E7NA 4QB3A 5CPEA 4QEUA 4Q0OA 4QUTA 3ZYUA 5CQ4A 4LC2A 2YDWA 4ZW1A 4OGIA 5BT3A 4UIVA 4QR4A 5FE9A 4TT4A 5L98A 5F2PA 4HXKA 5FE3A 1WUMA 5EI4A 4RVRA 5CQAA 5HFQA 4YYJA 5E73A 5II1A 2RI7A 5D3JA 5AD3A 5I80A 2R0VA 4HBYA 5F60A 5ACYA 5I1QA 4TT2A 4AI6A 4LYWA 5A7CA 5CFWA 5LVQA 5F1LA 4CLBA 4NR5A 5H1VA 5BT4A 3UW9A 4X2IA 5IGMA 3LJWA 3LQHA 4QSPA 2KTBB 4WHWA 5EISA 5A81A 4J0SA 4CFLA 3ONIA 4CUPA 4HBWA 3IU6A 4BW2A 5F5ZA 2DATA 3O37A 4HXNA 4GPJA 5E9YA 4BW1A 4CURA 5EP7A 5D25A 2N9GA 4O7AA 4FLPA 4YH4A 4TZ2A 3P5OA 5C87A 5FE8A 1X0JA 5IG6A 5D0CA 5C89A 2LSPB 5L8UA 4OUFA 5I7YA 4UYDA 5DX4A 3SVFA 3QZSA 3DWYA 5AMEA 4QNSA 4QSVA 4A9MA 4Q0NA 5D7XA 3U5NA 4TTEA 4CUUA 3D1DA 3LQIA 4O71A 2YW5A 3MXFA 3AADA 4A9EA 4NYWA 3O35A 4HXSA 5LVRA 2RNXA 5DYXA 5DY7A 4CUTA 5EPRA 5G4SA 5ENHA 5A83A 5G4RA 4NR6A 4BW4A 3JVLA 4YATA 5EPBA 4WIVA 5IBNA 4BHWA 5EGUA 5ENCA 5I89A 5CTLA 4TU6A 2RNYA 4LZRA 4MEQA 3HMFA 4NQNA 4PCIA 4MEOA 5FFVA 2YEKA 5LJ0A 3P1FA 5ENJA 4YYMA 3MB3A 3MQMA 4J0RA 4YYKA 4UITA 4TS8A 5ENBA 2DWWA 4YY4A 5LKXA 4XY8A 5CUCA 4QY4A 5CRZA 3S91A 3I3JA 3ERRA 3LXJA 4QYDA 5FB0A 5JI8A 5JWMA 4PCEA 5CQ3A 4UYEA 2FSAA 5ENFA 5CQ6A 4LYSA 5CP5A 5IGKA 5E74A 5ETBA 5I7XA 4NRBA 3P1DA 5EVAA 5F62A 5HRXA 4KCXA 3FKMX 4IR5A 4YYIA 4Y03A 5C8GA 5EWHA 1N72A 4YBSA 4Z93A 4Z6HA 3U5KA 5EV9A 4MR5A 5ENIA 5FG6A 5HRVA 5CUBA 5F61A 4XY9A 5HQ6A 5K29A 5DBMA 3JVKA 4AKHA 5EICA 5FH6A 4ZC9A 5ENGA 4YABA 5DKCA 4LRGA 4NR8A 5D3TA 4A9KA 5ENEA 5D26A 4MR4A 5AD2A 5I29A 3DAIA 3MULA 5BT5A 4YY6A 4HXPA 2YEMA 4QSWA 4XUBA 5D3RA 2NXBA 4NXJA 4O72A 4NYVA 5FE1A 5KTXA 4NS5A 5FE7A 4CUSA 3P1CA 2E3KA 2R0SA 5KO4A 3D7CA 2G4AA 4NR4A 3O36A 4YYDA 5DLZA 4NQMA 4PS5A 3VKGA 1PUOA 5CZGA 5L99A 5CU8A 5EA1A 4A9HA 3GG3A 3LQJA 4YYGA 3RCWA 5FE6A 5DKHA 4HBVA 5A5PA 4KV4A 5EWDA 2WP1A 4HBXA 5E9MA 5CRMA 4YH3A 5A85A 4HXRA 2YELA 2D82A 4UIWA 5COIA 4TYLA 4AKIA 4QBMA 5DYUA 5DFBA 4YYHA 5L96A 4QSSA 4J1PA 2I7KA 4TT6A 2L84A 4QSXA 4N3WA 5A5OA 3HMHA 4LZ2A 4XYAA 5A82A 3NXBA 5KTUA 4MENA 4TZ8A 5LUUA 4YADA 4MR6A 4A9NA 4NUCA 3TLPA 5A5NA 3P1EA 4OGJA 3SVHA 5F25A 4NUEA
chains in the Genus database with same CATH topology
4NR7A 5DYAA 5E7DA 3K2JA 4UYGA 5FE5A 4LZSA 1WUGA 4O78A 3U5LA 4HXMA 5FE0A 5HRWA 5E9LA 3S92A 5C85A 4N4GA 5ETDA 3AQAA 4QEWA 4Z1SA 5HLSA 5HFRA 4UIUA 5E9KA 4QYLA 5E0RA 5HQ7A 3UVYA 5CGPA 1JM4B 5EWCA 4AKNA 4WHUA 4ALGA 1JSPB 5F63A 5DFDA 3UV4A 4LDFA 4MR3A 4QC1A 5FH7A 3U5MA 2RFJA 4PKLA 5FFYA 5CUGA 1F68A 4NUDA 3UVXA 1EQFA 4C67A 4A9IA 4QEVA 5CQ7A 5HCLA 2GRCA 4E96A 4Z1QA 5LJ1A 5AMFA 4O7EA 5CQ8A 2OSSA 5HEMA 4A9JA 4CL9A 4NRCA 2RNWA 4QR5A 4O7FA 4O74A 3U5JA 5KTWA 4YK0A 4IR4A 5TB6A 5LKZA 5FH8A 4LYIA 4O7BA 5E3GA 4YYNA 3UVWA 3G0LA 4CUQA 5CS8A 5EWVA 5FE2A 3IU5A 4BW3A 4QUUA 5EWWA 5DFCA 5FDZA 2H60A 4HXOA 2OO1A 5EQ1A 4UIYA 4Z6IA 2I8NA 4UIXA 4PY6A 3QZVA 5CUAA 5FE4A 4YAXA 5D3LA 2YQDA 5EPSA 5I40A 4QZSA 5IGNA 4QSUA 5LKTA 4IR6A 3HMEA 3Q2EA 4A9FA 5D3HA 4UIZA 2L85A 4IOOA 5DW2A 4UYFA 4O76A 3Q2FA 4MEPA 5D3NA 3U5PA 4N4IA 2DVRA 5F3AA 4QSRA 4TQNA 4NYXA 5KHMA 3U5OA 5A5SA 4UYFB 5CQ5A 2E7OA 4IR3A 2DVQA 5DW1A 4YBTA 5C7NA 5HM0A 1ZS5A 4A9LA 5CUEA 4O77A 5LJ2A 4NR9A 2WP2A 5TCMA 4O75A 5C4QA 5I86A 4J3IA 5L97A 3SVGA 4PTBA 2RS9B 5F1HA 3MB4A 4QR3A 4YBMA 5IGLA 3JVJA 5J0DA 4QSTA 5II2A 5CQTA 4F3IA 2R10A 4YC9A 4C66A 2DKWA 2DVVA 2YYNA 4NRAA 4KV1A 4N4FA 4QC3A 2R0YA 5A5QA 4O70A 4CFKA 4O7CA 4XUAA 5E3DA 3O33A 5EU1A 5FG4A 2RO1A 4ALHA 4A9OA 5EM3A 4LR6A 4TU4A 5FG5A 2D9EA 5HELA 2F6JA 5D3PA 4N4HA 5LKUA 3JVMA 5D3SA 5A5RA 3O34A 5CY9A 5I83A 5HENA 2DVSA 5H85A 4BJXA 3UVDA 5DKDA 5FB1A 5L8TA 4UYHA 4ZQLA 2L5EA 5E9IA 5F36A 5DLXA 5FFWA 5HQ5A 4DONA 3UV5A 5CUDA 5E9VA 3MUKA 3G0JA 5IIDA 4HXLA 5EK9A 5H1TA 5I88A 2F6NA 4IOQA 5D24A 5KU3A 4QSQA 4IORA 2OUOA 5HJCA 3QZTA 2MJVB 3UV2A 5FBXA 5H1UA 5DYCA 1E6IA 2E7NA 4QB3A 5CPEA 4QEUA 4Q0OA 4QUTA 3ZYUA 5CQ4A 4LC2A 2YDWA 4ZW1A 4OGIA 5BT3A 4UIVA 4QR4A 5FE9A 4TT4A 5L98A 5F2PA 4HXKA 5FE3A 1WUMA 5EI4A 4RVRA 5CQAA 5HFQA 4YYJA 5E73A 5II1A 2RI7A 5D3JA 5AD3A 5I80A 2R0VA 4HBYA 5F60A 5ACYA 5I1QA 4TT2A 4LYWA 5A7CA 5CFWA 5LVQA 5F1LA 4CLBA 4NR5A 5H1VA 5BT4A 3UW9A 4X2IA 5IGMA 3LJWA 3LQHA 4QSPA 2KTBB 4WHWA 5EISA 5A81A 4J0SA 4CFLA 3ONIA 4CUPA 4HBWA 3IU6A 4BW2A 5F5ZA 2DATA 3O37A 4HXNA 4GPJA 5E9YA 4BW1A 4CURA 5EP7A 5D25A 2N9GA 4O7AA 4FLPA 4YH4A 4TZ2A 3P5OA 5C87A 5FE8A 1X0JA 5IG6A 5D0CA 5C89A 2LSPB 5L8UA 4OUFA 5I7YA 4UYDA 5DX4A 3SVFA 3QZSA 3DWYA 5AMEA 4QNSA 4QSVA 4A9MA 4Q0NA 5D7XA 3U5NA 4TTEA 4CUUA 3LQIA 4O71A 2YW5A 3MXFA 3AADA 4A9EA 4NYWA 3O35A 4HXSA 5LVRA 2RNXA 5DYXA 5DY7A 4CUTA 5EPRA 5G4SA 5ENHA 5A83A 5G4RA 4NR6A 4BW4A 3JVLA 4YATA 5EPBA 4WIVA 5IBNA 4BHWA 5EGUA 5ENCA 5I89A 5CTLA 4TU6A 2RNYA 4LZRA 4MEQA 3HMFA 4NQNA 4PCIA 4MEOA 5FFVA 2YEKA 5LJ0A 3P1FA 5ENJA 4YYMA 3MB3A 3MQMA 4J0RA 4YYKA 4UITA 4TS8A 5ENBA 2DWWA 4YY4A 5LKXA 4XY8A 5CUCA 4QY4A 5CRZA 3S91A 3I3JA 3LXJA 4QYDA 5FB0A 5JI8A 5JWMA 4PCEA 5CQ3A 4UYEA 2FSAA 5ENFA 5CQ6A 4LYSA 5CP5A 5IGKA 5E74A 5ETBA 5I7XA 4NRBA 3P1DA 5EVAA 5F62A 5HRXA 4KCXA 3FKMX 4IR5A 4YYIA 4Y03A 5C8GA 5EWHA 1N72A 4YBSA 4Z93A 4Z6HA 3U5KA 5EV9A 4MR5A 5ENIA 5FG6A 5HRVA 5CUBA 5F61A 4XY9A 5HQ6A 5K29A 5DBMA 3JVKA 5EICA 5FH6A 4ZC9A 5ENGA 4YABA 5DKCA 4LRGA 4NR8A 5D3TA 4A9KA 5ENEA 5D26A 4MR4A 5AD2A 5I29A 3DAIA 3MULA 5BT5A 4YY6A 4HXPA 2YEMA 4QSWA 4XUBA 5D3RA 2NXBA 4NXJA 4O72A 4NYVA 5FE1A 5KTXA 4NS5A 5FE7A 4CUSA 3P1CA 2E3KA 2R0SA 5KO4A 3D7CA 2G4AA 4NR4A 3O36A 4YYDA 5DLZA 4NQMA 4PS5A 5CZGA 5L99A 5CU8A 5EA1A 4A9HA 3GG3A 3LQJA 4YYGA 3RCWA 5FE6A 5DKHA 4HBVA 5A5PA 4KV4A 5EWDA 2WP1A 4HBXA 5E9MA 5CRMA 4YH3A 5A85A 4HXRA 2YELA 2D82A 4UIWA 5COIA 4TYLA 4QBMA 5DYUA 5DFBA 4YYHA 5L96A 4QSSA 4J1PA 2I7KA 4TT6A 2L84A 4QSXA 4N3WA 5A5OA 3HMHA 4LZ2A 4XYAA 5A82A 3NXBA 5KTUA 4MENA 4TZ8A 5LUUA 4YADA 4MR6A 4A9NA 4NUCA 3TLPA 5A5NA 3P1EA 4OGJA 3SVHA 5F25A 4NUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NR7 A;  5DYA A;  5E7D A;  3K2J A;  4UYG A;  5FE5 A;  4LZS A;  1WUG A;  4O78 A;  3U5L A;  4HXM A;  5FE0 A;  5HRW A;  5E9L A;  3S92 A;  5C85 A;  4N4G A;  5ETD A;  3AQA A;  4QEW A;  4Z1S A;  5HLS A;  5HFR A;  4UIU A;  5E9K A;  4QYL A;  5E0R A;  5HQ7 A;  3UVY A;  5CGP A;  1JM4 B;  5EWC A;  4AKN A;  4WHU A;  4ALG A;  1JSP B;  5F63 A;  5DFD A;  3UV4 A;  4LDF A;  4MR3 A;  4QC1 A;  5FH7 A;  3U5M A;  2RFJ A;  4PKL A;  5FFY A;  5CUG A;  1F68 A;  4NUD A;  3UVX A;  1EQF A;  4C67 A;  4A9I A;  4QEV A;  5CQ7 A;  5HCL A;  2GRC A;  4E96 A;  4Z1Q A;  5LJ1 A;  5AMF A;  4O7E A;  5CQ8 A;  2OSS A;  5HEM A;  4A9J A;  4CL9 A;  4NRC A;  2RNW A;  4QR5 A;  4O7F A;  4O74 A;  3U5J A;  5KTW A;  4YK0 A;  4IR4 A;  5TB6 A;  5LKZ A;  5FH8 A;  4LYI A;  4O7B A;  5E3G A;  4YYN A;  3UVW A;  3G0L A;  4CUQ A;  5CS8 A;  5EWV A;  5FE2 A;  3IU5 A;  4BW3 A;  4QUU A;  5EWW A;  5DFC A;  5FDZ A;  2H60 A;  4HXO A;  2OO1 A;  5EQ1 A;  4UIY A;  4Z6I A;  2I8N A;  4UIX A;  4PY6 A;  3QZV A;  5CUA A;  5FE4 A;  4YAX A;  5D3L A;  2YQD A;  5EPS A;  5I40 A;  4QZS A;  5IGN A;  4QSU A;  5LKT A;  4IR6 A;  3HME A;  3Q2E A;  4A9F A;  5D3H A;  4UIZ A;  2L85 A;  4IOO A;  5DW2 A;  4UYF A;  4O76 A;  3Q2F A;  4MEP A;  5D3N A;  3U5P A;  4N4I A;  2DVR A;  5F3A A;  4QSR A;  4TQN A;  4NYX A;  5KHM A;  3U5O A;  5A5S A;  4UYF B;  5CQ5 A;  2E7O A;  4IR3 A;  2DVQ A;  5DW1 A;  4YBT A;  5C7N A;  5HM0 A;  1ZS5 A;  4A9L A;  5CUE A;  4O77 A;  5LJ2 A;  4NR9 A;  2WP2 A;  5TCM A;  4O75 A;  5C4Q A;  5I86 A;  4J3I A;  5L97 A;  3SVG A;  4PTB A;  2RS9 B;  5F1H A;  3MB4 A;  4QR3 A;  4YBM A;  5IGL A;  3JVJ A;  5J0D A;  4QST A;  5II2 A;  5CQT A;  4F3I A;  2R10 A;  4YC9 A;  4C66 A;  2DKW A;  2DVV A;  2YYN A;  4NRA A;  4KV1 A;  4N4F A;  4QC3 A;  2R0Y A;  5A5Q A;  4O70 A;  4CFK A;  4O7C A;  4XUA A;  5E3D A;  3O33 A;  5EU1 A;  5FG4 A;  2RO1 A;  4ALH A;  4A9O A;  5EM3 A;  4LR6 A;  4TU4 A;  5FG5 A;  2D9E A;  5HEL A;  2F6J A;  5D3P A;  4N4H A;  5LKU A;  3JVM A;  5D3S A;  5A5R A;  3O34 A;  5CY9 A;  5I83 A;  5HEN A;  2DVS A;  5H85 A;  4BJX A;  3UVD A;  5DKD A;  5FB1 A;  5L8T A;  4UYH A;  4ZQL A;  2L5E A;  5E9I A;  5F36 A;  5DLX A;  5FFW A;  5HQ5 A;  4DON A;  3UV5 A;  5CUD A;  5E9V A;  3MUK A;  3G0J A;  5IID A;  4HXL A;  5EK9 A;  5H1T A;  5I88 A;  2F6N A;  4IOQ A;  5D24 A;  5KU3 A;  4QSQ A;  4IOR A;  2OUO A;  5HJC A;  3QZT A;  2MJV B;  3UV2 A;  5FBX A;  5H1U A;  5DYC A;  1E6I A;  2E7N A;  4QB3 A;  5CPE A;  4QEU A;  4Q0O A;  4QUT A;  3ZYU A;  5CQ4 A;  4LC2 A;  2YDW A;  4ZW1 A;  4OGI A;  5BT3 A;  4UIV A;  4QR4 A;  5FE9 A;  4TT4 A;  5L98 A;  5F2P A;  4HXK A;  5FE3 A;  1WUM A;  5EI4 A;  4RVR A;  5CQA A;  5HFQ A;  4YYJ A;  5E73 A;  5II1 A;  2RI7 A;  5D3J A;  5AD3 A;  5I80 A;  2R0V A;  4HBY A;  5F60 A;  5ACY A;  5I1Q A;  4TT2 A;  4LYW A;  5A7C A;  5CFW A;  5LVQ A;  5F1L A;  4CLB A;  4NR5 A;  5H1V A;  5BT4 A;  3UW9 A;  4X2I A;  5IGM A;  3LJW A;  3LQH A;  4QSP A;  2KTB B;  4WHW A;  5EIS A;  5A81 A;  4J0S A;  4CFL A;  3ONI A;  4CUP A;  4HBW A;  3IU6 A;  4BW2 A;  5F5Z A;  2DAT A;  3O37 A;  4HXN A;  4GPJ A;  5E9Y A;  4BW1 A;  4CUR A;  5EP7 A;  5D25 A;  2N9G A;  4O7A A;  4FLP A;  4YH4 A;  4TZ2 A;  3P5O A;  5C87 A;  5FE8 A;  1X0J A;  5IG6 A;  5D0C A;  5C89 A;  2LSP B;  5L8U A;  4OUF A;  5I7Y A;  4UYD A;  5DX4 A;  3SVF A;  3QZS A;  3DWY A;  5AME A;  4QNS A;  4QSV A;  4A9M A;  4Q0N A;  5D7X A;  3U5N A;  4TTE A;  4CUU A;  3LQI A;  4O71 A;  2YW5 A;  3MXF A;  3AAD A;  4A9E A;  4NYW A;  3O35 A;  4HXS A;  5LVR A;  2RNX A;  5DYX A;  5DY7 A;  4CUT A;  5EPR A;  5G4S A;  5ENH A;  5A83 A;  5G4R A;  4NR6 A;  4BW4 A;  3JVL A;  4YAT A;  5EPB A;  4WIV A;  5IBN A;  4BHW A;  5EGU A;  5ENC A;  5I89 A;  5CTL A;  4TU6 A;  2RNY A;  4LZR A;  4MEQ A;  3HMF A;  4NQN A;  4PCI A;  4MEO A;  5FFV A;  2YEK A;  5LJ0 A;  3P1F A;  5ENJ A;  4YYM A;  3MB3 A;  3MQM A;  4J0R A;  4YYK A;  4UIT A;  4TS8 A;  5ENB A;  2DWW A;  4YY4 A;  5LKX A;  4XY8 A;  5CUC A;  4QY4 A;  5CRZ A;  3S91 A;  3I3J A;  3LXJ A;  4QYD A;  5FB0 A;  5JI8 A;  5JWM A;  4PCE A;  5CQ3 A;  4UYE A;  2FSA A;  5ENF A;  5CQ6 A;  4LYS A;  5CP5 A;  5IGK A;  5E74 A;  5ETB A;  5I7X A;  4NRB A;  3P1D A;  5EVA A;  5F62 A;  5HRX A;  4KCX A;  3FKM X;  4IR5 A;  4YYI A;  4Y03 A;  5C8G A;  5EWH A;  1N72 A;  4YBS A;  4Z93 A;  4Z6H A;  3U5K A;  5EV9 A;  4MR5 A;  5ENI A;  5FG6 A;  5HRV A;  5CUB A;  5F61 A;  4XY9 A;  5HQ6 A;  5K29 A;  5DBM A;  3JVK A;  5EIC A;  5FH6 A;  4ZC9 A;  5ENG A;  4YAB A;  5DKC A;  4LRG A;  4NR8 A;  5D3T A;  4A9K A;  5ENE A;  5D26 A;  4MR4 A;  5AD2 A;  5I29 A;  3DAI A;  3MUL A;  5BT5 A;  4YY6 A;  4HXP A;  2YEM A;  4QSW A;  4XUB A;  5D3R A;  2NXB A;  4NXJ A;  4O72 A;  4NYV A;  5FE1 A;  5KTX A;  4NS5 A;  5FE7 A;  4CUS A;  3P1C A;  2E3K A;  2R0S A;  5KO4 A;  3D7C A;  2G4A A;  4NR4 A;  3O36 A;  4YYD A;  5DLZ A;  4NQM A;  4PS5 A;  5CZG A;  5L99 A;  5CU8 A;  5EA1 A;  4A9H A;  3GG3 A;  3LQJ A;  4YYG A;  3RCW A;  5FE6 A;  5DKH A;  4HBV A;  5A5P A;  4KV4 A;  5EWD A;  2WP1 A;  4HBX A;  5E9M A;  5CRM A;  4YH3 A;  5A85 A;  4HXR A;  2YEL A;  2D82 A;  4UIW A;  5COI A;  4TYL A;  4QBM A;  5DYU A;  5DFB A;  4YYH A;  5L96 A;  4QSS A;  4J1P A;  2I7K A;  4TT6 A;  2L84 A;  4QSX A;  4N3W A;  5A5O A;  3HMH A;  4LZ2 A;  4XYA A;  5A82 A;  3NXB A;  5KTU A;  4MEN A;  4TZ8 A;  5LUU A;  4YAD A;  4MR6 A;  4A9N A;  4NUC A;  3TLP A;  5A5N A;  3P1E A;  4OGJ A;  3SVH A;  5F25 A;  4NUE A; 
#chains in the Genus database with same CATH topology
 4NR7 A;  5DYA A;  5E7D A;  3K2J A;  4UYG A;  5FE5 A;  4LZS A;  1WUG A;  4O78 A;  3U5L A;  4HXM A;  5FE0 A;  5HRW A;  5E9L A;  3S92 A;  2EJN A;  5C85 A;  4N4G A;  5ETD A;  3AQA A;  4QEW A;  4Z1S A;  5HLS A;  5HFR A;  4UIU A;  5E9K A;  4QYL A;  5E0R A;  5HQ7 A;  3UVY A;  5CGP A;  1JM4 B;  5EWC A;  4AKN A;  4WHU A;  4ALG A;  1JSP B;  5F63 A;  5DFD A;  3UV4 A;  4LDF A;  4MR3 A;  4QC1 A;  5FH7 A;  3U5M A;  2RFJ A;  4PKL A;  5FFY A;  5CUG A;  1F68 A;  4NUD A;  3UVX A;  1EQF A;  4C67 A;  4A9I A;  4QEV A;  5CQ7 A;  5HCL A;  2GRC A;  4AKG A;  4E96 A;  4Z1Q A;  5LJ1 A;  5AMF A;  4O7E A;  5CQ8 A;  2OSS A;  5HEM A;  4A9J A;  4CL9 A;  4NRC A;  2RNW A;  4QR5 A;  1ZKR A;  4O7F A;  4O74 A;  3U5J A;  5KTW A;  4YK0 A;  4IR4 A;  5TB6 A;  5LKZ A;  5FH8 A;  4LYI A;  4O7B A;  5E3G A;  4YYN A;  3UVW A;  3G0L A;  4CUQ A;  5CS8 A;  5EWV A;  5FE2 A;  3IU5 A;  4BW3 A;  4QUU A;  5EWW A;  5DFC A;  5FDZ A;  2H60 A;  4HXO A;  2OO1 A;  5EQ1 A;  4UIY A;  4Z6I A;  2I8N A;  4UIX A;  4PY6 A;  3QZV A;  5CUA A;  5FE4 A;  4YAX A;  5D3L A;  2YQD A;  5EPS A;  5I40 A;  4QZS A;  5IGN A;  4QSU A;  5LKT A;  4IR6 A;  3HME A;  3Q2E A;  4A9F A;  5D3H A;  4UIZ A;  2L85 A;  4IOO A;  5DW2 A;  4UYF A;  4O76 A;  3Q2F A;  4MEP A;  5D3N A;  3U5P A;  4N4I A;  2DVR A;  5F3A A;  4QSR A;  4TQN A;  4NYX A;  5KHM A;  3U5O A;  5A5S A;  4UYF B;  5CQ5 A;  2E7O A;  4IR3 A;  2DVQ A;  5DW1 A;  4YBT A;  5C7N A;  5HM0 A;  1ZS5 A;  4A9L A;  5CUE A;  4O77 A;  3D1B A;  5LJ2 A;  4NR9 A;  2WP2 A;  5TCM A;  4O75 A;  5C4Q A;  5I86 A;  4J3I A;  5L97 A;  3SVG A;  4PTB A;  2RS9 B;  5F1H A;  3MB4 A;  3VKH A;  4QR3 A;  4YBM A;  5IGL A;  3JVJ A;  5J0D A;  4QST A;  5II2 A;  5CQT A;  4F3I A;  2R10 A;  4YC9 A;  4C66 A;  2DKW A;  2DVV A;  2YYN A;  4NRA A;  4KV1 A;  4N4F A;  4QC3 A;  2R0Y A;  5A5Q A;  4O70 A;  4CFK A;  4O7C A;  4XUA A;  5E3D A;  3O33 A;  5EU1 A;  5FG4 A;  2RO1 A;  4ALH A;  4A9O A;  5EM3 A;  4LR6 A;  4TU4 A;  5FG5 A;  2D9E A;  5HEL A;  2F6J A;  5D3P A;  4N4H A;  5LKU A;  3JVM A;  5D3S A;  5A5R A;  3O34 A;  5CY9 A;  5I83 A;  5HEN A;  2DVS A;  5H85 A;  4BJX A;  3UVD A;  5DKD A;  5FB1 A;  5L8T A;  4UYH A;  4ZQL A;  2L5E A;  5E9I A;  5F36 A;  5DLX A;  5FFW A;  5HQ5 A;  4DON A;  3UV5 A;  5CUD A;  5E9V A;  3MUK A;  3G0J A;  5IID A;  4HXL A;  5EK9 A;  5H1T A;  5I88 A;  2F6N A;  4IOQ A;  5D24 A;  5KU3 A;  4QSQ A;  4IOR A;  2OUO A;  5HJC A;  3QZT A;  2MJV B;  3UV2 A;  5FBX A;  5H1U A;  5DYC A;  1E6I A;  2E7N A;  4QB3 A;  5CPE A;  4QEU A;  4Q0O A;  4QUT A;  3ZYU A;  5CQ4 A;  4LC2 A;  2YDW A;  4ZW1 A;  4OGI A;  5BT3 A;  4UIV A;  4QR4 A;  5FE9 A;  4TT4 A;  5L98 A;  5F2P A;  4HXK A;  5FE3 A;  1WUM A;  5EI4 A;  4RVR A;  5CQA A;  5HFQ A;  4YYJ A;  5E73 A;  5II1 A;  2RI7 A;  5D3J A;  5AD3 A;  5I80 A;  2R0V A;  4HBY A;  5F60 A;  5ACY A;  5I1Q A;  4TT2 A;  4AI6 A;  4LYW A;  5A7C A;  5CFW A;  5LVQ A;  5F1L A;  4CLB A;  4NR5 A;  5H1V A;  5BT4 A;  3UW9 A;  4X2I A;  5IGM A;  3LJW A;  3LQH A;  4QSP A;  2KTB B;  4WHW A;  5EIS A;  5A81 A;  4J0S A;  4CFL A;  3ONI A;  4CUP A;  4HBW A;  3IU6 A;  4BW2 A;  5F5Z A;  2DAT A;  3O37 A;  4HXN A;  4GPJ A;  5E9Y A;  4BW1 A;  4CUR A;  5EP7 A;  5D25 A;  2N9G A;  4O7A A;  4FLP A;  4YH4 A;  4TZ2 A;  3P5O A;  5C87 A;  5FE8 A;  1X0J A;  5IG6 A;  5D0C A;  5C89 A;  2LSP B;  5L8U A;  4OUF A;  5I7Y A;  4UYD A;  5DX4 A;  3SVF A;  3QZS A;  3DWY A;  5AME A;  4QNS A;  4QSV A;  4A9M A;  4Q0N A;  5D7X A;  3U5N A;  4TTE A;  4CUU A;  3D1D A;  3LQI A;  4O71 A;  2YW5 A;  3MXF A;  3AAD A;  4A9E A;  4NYW A;  3O35 A;  4HXS A;  5LVR A;  2RNX A;  5DYX A;  5DY7 A;  4CUT A;  5EPR A;  5G4S A;  5ENH A;  5A83 A;  5G4R A;  4NR6 A;  4BW4 A;  3JVL A;  4YAT A;  5EPB A;  4WIV A;  5IBN A;  4BHW A;  5EGU A;  5ENC A;  5I89 A;  5CTL A;  4TU6 A;  2RNY A;  4LZR A;  4MEQ A;  3HMF A;  4NQN A;  4PCI A;  4MEO A;  5FFV A;  2YEK A;  5LJ0 A;  3P1F A;  5ENJ A;  4YYM A;  3MB3 A;  3MQM A;  4J0R A;  4YYK A;  4UIT A;  4TS8 A;  5ENB A;  2DWW A;  4YY4 A;  5LKX A;  4XY8 A;  5CUC A;  4QY4 A;  5CRZ A;  3S91 A;  3I3J A;  3ERR A;  3LXJ A;  4QYD A;  5FB0 A;  5JI8 A;  5JWM A;  4PCE A;  5CQ3 A;  4UYE A;  2FSA A;  5ENF A;  5CQ6 A;  4LYS A;  5CP5 A;  5IGK A;  5E74 A;  5ETB A;  5I7X A;  4NRB A;  3P1D A;  5EVA A;  5F62 A;  5HRX A;  4KCX A;  3FKM X;  4IR5 A;  4YYI A;  4Y03 A;  5C8G A;  5EWH A;  1N72 A;  4YBS A;  4Z93 A;  4Z6H A;  3U5K A;  5EV9 A;  4MR5 A;  5ENI A;  5FG6 A;  5HRV A;  5CUB A;  5F61 A;  4XY9 A;  5HQ6 A;  5K29 A;  5DBM A;  3JVK A;  4AKH A;  5EIC A;  5FH6 A;  4ZC9 A;  5ENG A;  4YAB A;  5DKC A;  4LRG A;  4NR8 A;  5D3T A;  4A9K A;  5ENE A;  5D26 A;  4MR4 A;  5AD2 A;  5I29 A;  3DAI A;  3MUL A;  5BT5 A;  4YY6 A;  4HXP A;  2YEM A;  4QSW A;  4XUB A;  5D3R A;  2NXB A;  4NXJ A;  4O72 A;  4NYV A;  5FE1 A;  5KTX A;  4NS5 A;  5FE7 A;  4CUS A;  3P1C A;  2E3K A;  2R0S A;  5KO4 A;  3D7C A;  2G4A A;  4NR4 A;  3O36 A;  4YYD A;  5DLZ A;  4NQM A;  4PS5 A;  3VKG A;  1PUO A;  5CZG A;  5L99 A;  5CU8 A;  5EA1 A;  4A9H A;  3GG3 A;  3LQJ A;  4YYG A;  3RCW A;  5FE6 A;  5DKH A;  4HBV A;  5A5P A;  4KV4 A;  5EWD A;  2WP1 A;  4HBX A;  5E9M A;  5CRM A;  4YH3 A;  5A85 A;  4HXR A;  2YEL A;  2D82 A;  4UIW A;  5COI A;  4TYL A;  4AKI A;  4QBM A;  5DYU A;  5DFB A;  4YYH A;  5L96 A;  4QSS A;  4J1P A;  2I7K A;  4TT6 A;  2L84 A;  4QSX A;  4N3W A;  5A5O A;  3HMH A;  4LZ2 A;  4XYA A;  5A82 A;  3NXB A;  5KTU A;  4MEN A;  4TZ8 A;  5LUU A;  4YAD A;  4MR6 A;  4A9N A;  4NUC A;  3TLP A;  5A5N A;  3P1E A;  4OGJ A;  3SVH A;  5F25 A;  4NUE A; 
#chains in the Genus database with same CATH homology
 4NR7 A;  5DYA A;  5E7D A;  3K2J A;  4UYG A;  5FE5 A;  4LZS A;  1WUG A;  4O78 A;  3U5L A;  4HXM A;  5FE0 A;  5HRW A;  5E9L A;  3S92 A;  5C85 A;  4N4G A;  5ETD A;  3AQA A;  4QEW A;  4Z1S A;  5HLS A;  5HFR A;  4UIU A;  5E9K A;  4QYL A;  5E0R A;  5HQ7 A;  3UVY A;  5CGP A;  1JM4 B;  5EWC A;  4AKN A;  4WHU A;  4ALG A;  1JSP B;  5F63 A;  5DFD A;  3UV4 A;  4LDF A;  4MR3 A;  4QC1 A;  5FH7 A;  3U5M A;  2RFJ A;  4PKL A;  5FFY A;  5CUG A;  1F68 A;  4NUD A;  3UVX A;  1EQF A;  4C67 A;  4A9I A;  4QEV A;  5CQ7 A;  5HCL A;  2GRC A;  4E96 A;  4Z1Q A;  5LJ1 A;  5AMF A;  4O7E A;  5CQ8 A;  2OSS A;  5HEM A;  4A9J A;  4CL9 A;  4NRC A;  2RNW A;  4QR5 A;  4O7F A;  4O74 A;  3U5J A;  5KTW A;  4YK0 A;  4IR4 A;  5TB6 A;  5LKZ A;  5FH8 A;  4LYI A;  4O7B A;  5E3G A;  4YYN A;  3UVW A;  3G0L A;  4CUQ A;  5CS8 A;  5EWV A;  5FE2 A;  3IU5 A;  4BW3 A;  4QUU A;  5EWW A;  5DFC A;  5FDZ A;  2H60 A;  4HXO A;  2OO1 A;  5EQ1 A;  4UIY A;  4Z6I A;  2I8N A;  4UIX A;  4PY6 A;  3QZV A;  5CUA A;  5FE4 A;  4YAX A;  5D3L A;  2YQD A;  5EPS A;  5I40 A;  4QZS A;  5IGN A;  4QSU A;  5LKT A;  4IR6 A;  3HME A;  3Q2E A;  4A9F A;  5D3H A;  4UIZ A;  2L85 A;  4IOO A;  5DW2 A;  4UYF A;  4O76 A;  3Q2F A;  4MEP A;  5D3N A;  3U5P A;  4N4I A;  2DVR A;  5F3A A;  4QSR A;  4TQN A;  4NYX A;  5KHM A;  3U5O A;  5A5S A;  4UYF B;  5CQ5 A;  2E7O A;  4IR3 A;  2DVQ A;  5DW1 A;  4YBT A;  5C7N A;  5HM0 A;  1ZS5 A;  4A9L A;  5CUE A;  4O77 A;  5LJ2 A;  4NR9 A;  2WP2 A;  5TCM A;  4O75 A;  5C4Q A;  5I86 A;  4J3I A;  5L97 A;  3SVG A;  4PTB A;  2RS9 B;  5F1H A;  3MB4 A;  4QR3 A;  4YBM A;  5IGL A;  3JVJ A;  5J0D A;  4QST A;  5II2 A;  5CQT A;  4F3I A;  2R10 A;  4YC9 A;  4C66 A;  2DKW A;  2DVV A;  2YYN A;  4NRA A;  4KV1 A;  4N4F A;  4QC3 A;  2R0Y A;  5A5Q A;  4O70 A;  4CFK A;  4O7C A;  4XUA A;  5E3D A;  3O33 A;  5EU1 A;  5FG4 A;  2RO1 A;  4ALH A;  4A9O A;  5EM3 A;  4LR6 A;  4TU4 A;  5FG5 A;  2D9E A;  5HEL A;  2F6J A;  5D3P A;  4N4H A;  5LKU A;  3JVM A;  5D3S A;  5A5R A;  3O34 A;  5CY9 A;  5I83 A;  5HEN A;  2DVS A;  5H85 A;  4BJX A;  3UVD A;  5DKD A;  5FB1 A;  5L8T A;  4UYH A;  4ZQL A;  2L5E A;  5E9I A;  5F36 A;  5DLX A;  5FFW A;  5HQ5 A;  4DON A;  3UV5 A;  5CUD A;  5E9V A;  3MUK A;  3G0J A;  5IID A;  4HXL A;  5EK9 A;  5H1T A;  5I88 A;  2F6N A;  4IOQ A;  5D24 A;  5KU3 A;  4QSQ A;  4IOR A;  2OUO A;  5HJC A;  3QZT A;  2MJV B;  3UV2 A;  5FBX A;  5H1U A;  5DYC A;  1E6I A;  2E7N A;  4QB3 A;  5CPE A;  4QEU A;  4Q0O A;  4QUT A;  3ZYU A;  5CQ4 A;  4LC2 A;  2YDW A;  4ZW1 A;  4OGI A;  5BT3 A;  4UIV A;  4QR4 A;  5FE9 A;  4TT4 A;  5L98 A;  5F2P A;  4HXK A;  5FE3 A;  1WUM A;  5EI4 A;  4RVR A;  5CQA A;  5HFQ A;  4YYJ A;  5E73 A;  5II1 A;  2RI7 A;  5D3J A;  5AD3 A;  5I80 A;  2R0V A;  4HBY A;  5F60 A;  5ACY A;  5I1Q A;  4TT2 A;  4LYW A;  5A7C A;  5CFW A;  5LVQ A;  5F1L A;  4CLB A;  4NR5 A;  5H1V A;  5BT4 A;  3UW9 A;  4X2I A;  5IGM A;  3LJW A;  3LQH A;  4QSP A;  2KTB B;  4WHW A;  5EIS A;  5A81 A;  4J0S A;  4CFL A;  3ONI A;  4CUP A;  4HBW A;  3IU6 A;  4BW2 A;  5F5Z A;  2DAT A;  3O37 A;  4HXN A;  4GPJ A;  5E9Y A;  4BW1 A;  4CUR A;  5EP7 A;  5D25 A;  2N9G A;  4O7A A;  4FLP A;  4YH4 A;  4TZ2 A;  3P5O A;  5C87 A;  5FE8 A;  1X0J A;  5IG6 A;  5D0C A;  5C89 A;  2LSP B;  5L8U A;  4OUF A;  5I7Y A;  4UYD A;  5DX4 A;  3SVF A;  3QZS A;  3DWY A;  5AME A;  4QNS A;  4QSV A;  4A9M A;  4Q0N A;  5D7X A;  3U5N A;  4TTE A;  4CUU A;  3LQI A;  4O71 A;  2YW5 A;  3MXF A;  3AAD A;  4A9E A;  4NYW A;  3O35 A;  4HXS A;  5LVR A;  2RNX A;  5DYX A;  5DY7 A;  4CUT A;  5EPR A;  5G4S A;  5ENH A;  5A83 A;  5G4R A;  4NR6 A;  4BW4 A;  3JVL A;  4YAT A;  5EPB A;  4WIV A;  5IBN A;  4BHW A;  5EGU A;  5ENC A;  5I89 A;  5CTL A;  4TU6 A;  2RNY A;  4LZR A;  4MEQ A;  3HMF A;  4NQN A;  4PCI A;  4MEO A;  5FFV A;  2YEK A;  5LJ0 A;  3P1F A;  5ENJ A;  4YYM A;  3MB3 A;  3MQM A;  4J0R A;  4YYK A;  4UIT A;  4TS8 A;  5ENB A;  2DWW A;  4YY4 A;  5LKX A;  4XY8 A;  5CUC A;  4QY4 A;  5CRZ A;  3S91 A;  3I3J A;  3LXJ A;  4QYD A;  5FB0 A;  5JI8 A;  5JWM A;  4PCE A;  5CQ3 A;  4UYE A;  2FSA A;  5ENF A;  5CQ6 A;  4LYS A;  5CP5 A;  5IGK A;  5E74 A;  5ETB A;  5I7X A;  4NRB A;  3P1D A;  5EVA A;  5F62 A;  5HRX A;  4KCX A;  3FKM X;  4IR5 A;  4YYI A;  4Y03 A;  5C8G A;  5EWH A;  1N72 A;  4YBS A;  4Z93 A;  4Z6H A;  3U5K A;  5EV9 A;  4MR5 A;  5ENI A;  5FG6 A;  5HRV A;  5CUB A;  5F61 A;  4XY9 A;  5HQ6 A;  5K29 A;  5DBM A;  3JVK A;  5EIC A;  5FH6 A;  4ZC9 A;  5ENG A;  4YAB A;  5DKC A;  4LRG A;  4NR8 A;  5D3T A;  4A9K A;  5ENE A;  5D26 A;  4MR4 A;  5AD2 A;  5I29 A;  3DAI A;  3MUL A;  5BT5 A;  4YY6 A;  4HXP A;  2YEM A;  4QSW A;  4XUB A;  5D3R A;  2NXB A;  4NXJ A;  4O72 A;  4NYV A;  5FE1 A;  5KTX A;  4NS5 A;  5FE7 A;  4CUS A;  3P1C A;  2E3K A;  2R0S A;  5KO4 A;  3D7C A;  2G4A A;  4NR4 A;  3O36 A;  4YYD A;  5DLZ A;  4NQM A;  4PS5 A;  5CZG A;  5L99 A;  5CU8 A;  5EA1 A;  4A9H A;  3GG3 A;  3LQJ A;  4YYG A;  3RCW A;  5FE6 A;  5DKH A;  4HBV A;  5A5P A;  4KV4 A;  5EWD A;  2WP1 A;  4HBX A;  5E9M A;  5CRM A;  4YH3 A;  5A85 A;  4HXR A;  2YEL A;  2D82 A;  4UIW A;  5COI A;  4TYL A;  4QBM A;  5DYU A;  5DFB A;  4YYH A;  5L96 A;  4QSS A;  4J1P A;  2I7K A;  4TT6 A;  2L84 A;  4QSX A;  4N3W A;  5A5O A;  3HMH A;  4LZ2 A;  4XYA A;  5A82 A;  3NXB A;  5KTU A;  4MEN A;  4TZ8 A;  5LUU A;  4YAD A;  4MR6 A;  4A9N A;  4NUC A;  3TLP A;  5A5N A;  3P1E A;  4OGJ A;  3SVH A;  5F25 A;  4NUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...