2DWWA

Crystal structure of bromodomain-containing protein 4
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
KSSKISEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLESREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Crystal structure of Bromodomain-containing protein 4
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2dwwA00
4MR5A 2RNXA 2MJVB 4O71A 4UIWA 4YYJA 3P5OA 5IIDA 5E9KA 4QSUA 3GG3A 3UVWA 4YC9A 3D7CA 4TU4A 5CQAA 5A5RA 4CUPA 5F2PA 5EK9A 4MEOA 4J0SA 5CP5A 4KV1A 2RS9B 5F25A 4YYKA 4CUUA 5KTUA 4TS8A 5D24A 5F3AA 4MEPA 5FE8A 5DW2A 4NYVA 4UIYA 5K29A 3AQAA 4MEQA 4QBMA 4HBXA 5CQ4A 4IR5A 4O7EA 5EI4A 5E9LA 4UIUA 4A9OA 4GPJA 5HQ5A 5FG5A 3MXFA 5CQ6A 5C8GA 4CFLA 4O78A 3IU6A 4HBYA 2YDWA 4Z1QA 4RVRA 4O74A 3DWYA 3LQJA 5FB1A 5DLXA 3G0LA 4QR5A 5G4SA 1WUGA 4NYWA 4WIVA 4QC3A 3SVHA 5DKCA 5HRVA 5JWMA 4QSWA 5D3JA 2KTBB 5E9VA 3K2JA 5FE2A 4NR7A 4NR4A 4OGJA 4UYEA 5EWDA 4YADA 4QY4A 2E7OA 3S91A 5CRZA 2E3KA 3U5MA 5CUEA 2R10A 3Q2EA 4ZC9A 4YABA 4LRGA 4WHUA 4LC2A 3HMEA 5D7XA 4YYDA 3LJWA 5E7DA 4FLPA 4TU6A 4TZ8A 4QEWA 5CUDA 4IOQA 4NXJA 5L97A 4YBMA 3S92A 5JI8A 5EU1A 4BHWA 3O36A 2DVQA 4NRAA 4Z6HA 2DVRA 4ZQLA 3P1FA 5I7YA 5C85A 4A9IA 3U5OA 5CQ8A 4UIVA 3RCWA 3U5LA 4O75A 5EP7A 5CU8A 1X0JA 3ZYUA 4ALGA 5G4RA 4CLBA 1EQFA 4PTBA 4CFKA 5ENFA 4ALHA 5TB6A 5KU3A 2GRCA 5F62A 5A5NA 2RI7A 5L99A 4UYFA 4N4HA 5EM3A 5FE3A 4UIXA 3LXJA 5D3RA 5HFQA 5EWWA 5HRWA 4NRBA 5BT5A 1JSPB 5FE5A 4TT6A 4A9NA 4ZW1A 4YYMA 4YY6A 4YYNA 4QUUA 5LJ0A 5KO4A 5D3PA 5HQ6A 4MENA 4CUSA 4Q0OA 5AD3A 4NQMA 3SVFA 5BT4A 5TCMA 4YH3A 4CUQA 4HXRA 4HXOA 5E9IA 5H1UA 5L8UA 5FH8A 3U5KA 4PCEA 2R0VA 5FG4A 3DAIA 5A85A 3HMFA 4BW4A 5CFWA 5FG6A 4J3IA 4A9EA 4J1PA 5J0DA 3I3JA 4A9LA 4NQNA 5CZGA 1N72A 4BJXA 4CL9A 5FFWA 5BT3A 4YYHA 5I89A 5A5PA 5LKTA 5FFVA 2YW5A 3UVXA 5CQ3A 5CUGA 4QSPA 3HMHA 5L96A 5LKXA 3G0JA 2N9GA 4PY6A 5CS8A 5F1HA 4NR6A 2LSPB 3JVJA 3UVYA 4QR4A 4O76A 5C87A 5FE7A 5ENBA 2F6JA 3MB3A 1E6IA 4PKLA 4QSRA 4O7FA 4LZ2A 5EPSA 4J0RA 4XY9A 5D3TA 5D26A 5CUAA 5HJCA 5F61A 5II2A 5CY9A 5CQTA 3MUKA 4QYLA 3P1EA 5D3LA 5A82A 5DLZA 4A9MA 5D3NA 5AMEA 5CUCA 4YYIA 2R0YA 2L85A 4CURA 4QSSA 5LVQA 3ONIA 3UV4A 2G4AA 5HLSA 5COIA 4WHWA 1JM4B 5H1VA 5FBXA 3UV2A 5KTWA 4TT2A 5HFRA 5DBMA 5A7CA 4QR3A 4OUFA 4OGIA 3MB4A 4IR4A 5FE0A 5ACYA 2I8NA 5EPRA 3UW9A 5I29A 2YEKA 5EGUA 4O7CA 5ENGA 5DX4A 4MR3A 5IGLA 4A9FA 5L98A 5HM0A 4NUDA 2YYNA 4LDFA 4LR6A 4DONA 4KCXA 2H60A 5L8TA 5E3DA 5EWVA 5DYAA 4E96A 5F63A 4IORA 4YYGA 5D3SA 5E9MA 4XUAA 5A5OA 5EWCA 5DFBA 5I86A 5I83A 4YBSA 3U5NA 4TZ2A 2DVVA 5D3HA 5FH7A 4NR5A 5F36A 5DKHA 3Q2FA 5LJ1A 3QZVA 4C67A 5FE6A 4YK0A 3TLPA 4Z6IA 2FSAA 4NUEA 2D9EA 5EICA 5DFDA 4QSXA 3O37A 4HXKA 4A9JA 4YH4A 5C7NA 4N4GA 5E74A 2YEMA 3LQIA 4O72A 5FE1A 5E73A 4TQNA 5DFCA 5DW1A 2OSSA 5A5SA 2RO1A 5ETBA 5HRXA 4HBVA 4XYAA 3QZTA 5CUBA 5AD2A 4F3IA 3O34A 2DVSA 3MULA 4UYGA 2D82A 4YBTA 3O33A 5C89A 5C4QA 4XY8A 3O35A 5HQ7A 5LKUA 5E3GA 5CQ5A 4IOOA 5E0RA 5ENCA 4UYHA 5LVRA 4NUCA 4O70A 4Y03A 1ZS5A 4LYIA 4KV4A 4C66A 5H1TA 4QYDA 4N4FA 2YQDA 5A5QA 4HXMA 4HXPA 4HBWA 3JVLA 4QC1A 4HXLA 4NS5A 5I1QA 5A83A 5EQ1A 5FDZA 5AMFA 4NYXA 2L5EA 4QSTA 4TT4A 5IGNA 5LJ2A 4YAXA 5IG6A 4PCIA 3AADA 3UVDA 3P1CA 5CRMA 4N3WA 5EV9A 5D25A 4PS5A 3JVMA 4MR6A 4BW1A 3P1DA 5HELA 5KHMA 5ENEA 5ENHA 4O77A 5HEMA 4LZRA 2E7NA 2OO1A 5H85A 5II1A 4XUBA 5KTXA 4TYLA 3LQHA 4NRCA 4HXNA 5DY7A 3U5PA 4O7AA 3MQMA 5F60A 4UYDA 4QSQA 5CPEA 4UIZA 4LYSA 4QEUA 1F68A 5LUUA 4Z93A 5FH6A 4IR3A 5I40A 5F1LA 3SVGA 4CUTA 4NR8A 2L84A 5FE4A 4YY4A 3U5JA 4IR6A 5F5ZA 4X2IA 4TTEA 4NR9A 3UV5A 2DATA 2DKWA 2OUOA 5ENJA 5ENIA 4YATA 5I7XA 2WP1A 5LKZA 5EVAA 2NXBA 5EPBA 5FFYA 2R0SA 5ETDA 5HENA 3QZSA 5A81A 1WUMA 4QZSA 4AKNA 5IGMA 5HCLA 5CQ7A 2I7KA 4MR4A 4QEVA 4LYWA 4QSVA 4QB3A 4UITA 4BW2A 4LZSA 4Q0NA 4BW3A 5EA1A 5IGKA 5CTLA 5E9YA 5DYXA 5DKDA 4HXSA 4A9HA 5FE9A 3FKMX 2YELA 2DWWA 5CGPA 4Z1SA 4QUTA 2WP2A 4O7BA 3JVKA 5EISA 5FB0A 2F6NA 4N4IA 3IU5A 5DYCA 5I88A 4QNSA 5D0CA 4A9KA 5DYUA 5IBNA 5I80A 5EWHA 2RNYA 2RNWA 3NXBA 2RFJA 4UYFB
chains in the Genus database with same CATH superfamily
4MR5A 2RNXA 2MJVB 4O71A 4UIWA 4YYJA 3P5OA 5IIDA 5E9KA 4QSUA 3GG3A 3UVWA 4YC9A 3D7CA 4TU4A 5CQAA 5A5RA 4CUPA 5F2PA 5EK9A 4MEOA 4J0SA 5CP5A 4KV1A 2RS9B 5F25A 4YYKA 4CUUA 5KTUA 4TS8A 5D24A 5F3AA 4MEPA 5FE8A 5DW2A 4NYVA 4UIYA 5K29A 3AQAA 4MEQA 4QBMA 4HBXA 5CQ4A 4IR5A 4O7EA 5EI4A 5E9LA 4UIUA 4A9OA 4GPJA 5HQ5A 5FG5A 3MXFA 5CQ6A 5C8GA 4CFLA 4O78A 3IU6A 4HBYA 2YDWA 4Z1QA 4RVRA 4O74A 3DWYA 3LQJA 5FB1A 5DLXA 3G0LA 4QR5A 5G4SA 1WUGA 4NYWA 4WIVA 4QC3A 3SVHA 5DKCA 5HRVA 5JWMA 4QSWA 5D3JA 2KTBB 4AKGA 5E9VA 3K2JA 5FE2A 4NR7A 3ERRA 4NR4A 4OGJA 4UYEA 5EWDA 4YADA 4QY4A 2E7OA 3S91A 5CRZA 2E3KA 3U5MA 5CUEA 2R10A 3Q2EA 4ZC9A 4YABA 4LRGA 4WHUA 4LC2A 3HMEA 5D7XA 4YYDA 3LJWA 5E7DA 4FLPA 4TU6A 4TZ8A 4QEWA 5CUDA 4IOQA 4NXJA 5L97A 4YBMA 3S92A 5JI8A 5EU1A 4BHWA 3O36A 2DVQA 2EJNA 4NRAA 4Z6HA 2DVRA 4ZQLA 3P1FA 5I7YA 5C85A 4A9IA 3U5OA 5CQ8A 4UIVA 3RCWA 3U5LA 4O75A 5EP7A 5CU8A 1X0JA 3ZYUA 4ALGA 5G4RA 4CLBA 1EQFA 4PTBA 4CFKA 5ENFA 4ALHA 5TB6A 5KU3A 4AI6A 2GRCA 5F62A 5A5NA 2RI7A 5L99A 4UYFA 4N4HA 5EM3A 5FE3A 4AKHA 4UIXA 3LXJA 5D3RA 5HFQA 5EWWA 5HRWA 4NRBA 5BT5A 1JSPB 5FE5A 4TT6A 4A9NA 4ZW1A 4YYMA 4YY6A 4YYNA 4QUUA 5LJ0A 5KO4A 5D3PA 5HQ6A 4MENA 4CUSA 4Q0OA 5AD3A 4NQMA 3SVFA 5BT4A 5TCMA 4YH3A 4CUQA 4HXRA 4HXOA 5E9IA 5H1UA 5L8UA 5FH8A 3U5KA 4PCEA 2R0VA 5FG4A 3DAIA 5A85A 3HMFA 4BW4A 5CFWA 5FG6A 4J3IA 4A9EA 4J1PA 5J0DA 3I3JA 4A9LA 4NQNA 5CZGA 1N72A 4BJXA 4CL9A 5FFWA 5BT3A 4YYHA 5I89A 5A5PA 5LKTA 5FFVA 2YW5A 3UVXA 5CQ3A 5CUGA 4QSPA 3HMHA 5L96A 5LKXA 3G0JA 2N9GA 4PY6A 5CS8A 5F1HA 4NR6A 2LSPB 3JVJA 3UVYA 4QR4A 4O76A 5C87A 5FE7A 5ENBA 2F6JA 3MB3A 1E6IA 4PKLA 4QSRA 4O7FA 4LZ2A 5EPSA 4J0RA 4XY9A 5D3TA 5D26A 5CUAA 5HJCA 5F61A 5II2A 5CY9A 5CQTA 3MUKA 4QYLA 3P1EA 5D3LA 5A82A 5DLZA 4A9MA 5D3NA 5AMEA 5CUCA 4YYIA 2R0YA 2L85A 4CURA 4QSSA 5LVQA 3ONIA 3UV4A 2G4AA 5HLSA 5COIA 4WHWA 1JM4B 5H1VA 5FBXA 3UV2A 5KTWA 4TT2A 5HFRA 5DBMA 5A7CA 4QR3A 4OUFA 4OGIA 3MB4A 4IR4A 5FE0A 5ACYA 2I8NA 5EPRA 3UW9A 5I29A 2YEKA 5EGUA 4O7CA 5ENGA 3VKGA 5DX4A 4MR3A 5IGLA 4A9FA 5L98A 5HM0A 4NUDA 2YYNA 4LDFA 4LR6A 4DONA 4KCXA 2H60A 5L8TA 5E3DA 5EWVA 5DYAA 4E96A 3D1BA 5F63A 4IORA 4YYGA 5D3SA 5E9MA 4XUAA 5A5OA 5EWCA 5DFBA 5I86A 5I83A 4YBSA 3U5NA 4TZ2A 2DVVA 5D3HA 5FH7A 4NR5A 5F36A 5DKHA 3Q2FA 5LJ1A 3QZVA 4C67A 5FE6A 4YK0A 3TLPA 4Z6IA 3VKHA 2FSAA 4NUEA 2D9EA 5EICA 5DFDA 4QSXA 3O37A 4HXKA 4A9JA 4YH4A 5C7NA 4N4GA 5E74A 2YEMA 3LQIA 4O72A 5FE1A 5E73A 4TQNA 5DFCA 5DW1A 2OSSA 5A5SA 2RO1A 5ETBA 5HRXA 4HBVA 4XYAA 3QZTA 5CUBA 5AD2A 4F3IA 3O34A 2DVSA 4AKIA 3MULA 4UYGA 2D82A 4YBTA 3O33A 5C89A 5C4QA 4XY8A 3O35A 5HQ7A 5LKUA 5E3GA 5CQ5A 4IOOA 5E0RA 1ZKRA 5ENCA 1PUOA 4UYHA 5LVRA 4NUCA 4O70A 4Y03A 1ZS5A 4LYIA 4KV4A 4C66A 5H1TA 4QYDA 4N4FA 2YQDA 5A5QA 4HXMA 4HXPA 4HBWA 3JVLA 4QC1A 4HXLA 4NS5A 5I1QA 5A83A 5EQ1A 5FDZA 5AMFA 4NYXA 2L5EA 4QSTA 4TT4A 5IGNA 5LJ2A 4YAXA 5IG6A 4PCIA 3AADA 3UVDA 3P1CA 5CRMA 4N3WA 5EV9A 5D25A 4PS5A 3JVMA 4MR6A 4BW1A 3P1DA 5HELA 5KHMA 5ENEA 5ENHA 4O77A 5HEMA 4LZRA 2E7NA 2OO1A 5H85A 5II1A 4XUBA 5KTXA 4TYLA 3LQHA 4NRCA 4HXNA 5DY7A 3U5PA 4O7AA 3MQMA 5F60A 4UYDA 4QSQA 5CPEA 4UIZA 4LYSA 4QEUA 1F68A 5LUUA 4Z93A 5FH6A 4IR3A 5I40A 5F1LA 3SVGA 4CUTA 4NR8A 2L84A 5FE4A 4YY4A 3U5JA 4IR6A 5F5ZA 4X2IA 4TTEA 4NR9A 3UV5A 2DATA 2DKWA 2OUOA 5ENJA 5ENIA 4YATA 5I7XA 2WP1A 5LKZA 5EVAA 2NXBA 5EPBA 5FFYA 2R0SA 5ETDA 5HENA 3QZSA 5A81A 1WUMA 4QZSA 4AKNA 5IGMA 5HCLA 5CQ7A 2I7KA 4MR4A 4QEVA 4LYWA 4QSVA 4QB3A 4UITA 4BW2A 4LZSA 4Q0NA 4BW3A 5EA1A 5IGKA 5CTLA 5E9YA 5DYXA 5DKDA 4HXSA 3D1DA 4A9HA 5FE9A 3FKMX 2YELA 2DWWA 5CGPA 4Z1SA 4QUTA 2WP2A 4O7BA 3JVKA 5EISA 5FB0A 2F6NA 4N4IA 3IU5A 5DYCA 5I88A 4QNSA 5D0CA 4A9KA 5DYUA 5IBNA 5I80A 5EWHA 2RNYA 2RNWA 3NXBA 2RFJA 4UYFB
chains in the Genus database with same CATH topology
4MR5A 2RNXA 2MJVB 4O71A 4UIWA 4YYJA 3P5OA 5IIDA 5E9KA 4QSUA 3GG3A 3UVWA 4YC9A 3D7CA 4TU4A 5CQAA 5A5RA 4CUPA 5F2PA 5EK9A 4MEOA 4J0SA 5CP5A 4KV1A 2RS9B 5F25A 4YYKA 4CUUA 5KTUA 4TS8A 5D24A 5F3AA 4MEPA 5FE8A 5DW2A 4NYVA 4UIYA 5K29A 3AQAA 4MEQA 4QBMA 4HBXA 5CQ4A 4IR5A 4O7EA 5EI4A 5E9LA 4UIUA 4A9OA 4GPJA 5HQ5A 5FG5A 3MXFA 5CQ6A 5C8GA 4CFLA 4O78A 3IU6A 4HBYA 2YDWA 4Z1QA 4RVRA 4O74A 3DWYA 3LQJA 5FB1A 5DLXA 3G0LA 4QR5A 5G4SA 1WUGA 4NYWA 4WIVA 4QC3A 3SVHA 5DKCA 5HRVA 5JWMA 4QSWA 5D3JA 2KTBB 5E9VA 3K2JA 5FE2A 4NR7A 4NR4A 4OGJA 4UYEA 5EWDA 4YADA 4QY4A 2E7OA 3S91A 5CRZA 2E3KA 3U5MA 5CUEA 2R10A 3Q2EA 4ZC9A 4YABA 4LRGA 4WHUA 4LC2A 3HMEA 5D7XA 4YYDA 3LJWA 5E7DA 4FLPA 4TU6A 4TZ8A 4QEWA 5CUDA 4IOQA 4NXJA 5L97A 4YBMA 3S92A 5JI8A 5EU1A 4BHWA 3O36A 2DVQA 4NRAA 4Z6HA 2DVRA 4ZQLA 3P1FA 5I7YA 5C85A 4A9IA 3U5OA 5CQ8A 4UIVA 3RCWA 3U5LA 4O75A 5EP7A 5CU8A 1X0JA 3ZYUA 4ALGA 5G4RA 4CLBA 1EQFA 4PTBA 4CFKA 5ENFA 4ALHA 5TB6A 5KU3A 2GRCA 5F62A 5A5NA 2RI7A 5L99A 4UYFA 4N4HA 5EM3A 5FE3A 4UIXA 3LXJA 5D3RA 5HFQA 5EWWA 5HRWA 4NRBA 5BT5A 1JSPB 5FE5A 4TT6A 4A9NA 4ZW1A 4YYMA 4YY6A 4YYNA 4QUUA 5LJ0A 5KO4A 5D3PA 5HQ6A 4MENA 4CUSA 4Q0OA 5AD3A 4NQMA 3SVFA 5BT4A 5TCMA 4YH3A 4CUQA 4HXRA 4HXOA 5E9IA 5H1UA 5L8UA 5FH8A 3U5KA 4PCEA 2R0VA 5FG4A 3DAIA 5A85A 3HMFA 4BW4A 5CFWA 5FG6A 4J3IA 4A9EA 4J1PA 5J0DA 3I3JA 4A9LA 4NQNA 5CZGA 1N72A 4BJXA 4CL9A 5FFWA 5BT3A 4YYHA 5I89A 5A5PA 5LKTA 5FFVA 2YW5A 3UVXA 5CQ3A 5CUGA 4QSPA 3HMHA 5L96A 5LKXA 3G0JA 2N9GA 4PY6A 5CS8A 5F1HA 4NR6A 2LSPB 3JVJA 3UVYA 4QR4A 4O76A 5C87A 5FE7A 5ENBA 2F6JA 3MB3A 1E6IA 4PKLA 4QSRA 4O7FA 4LZ2A 5EPSA 4J0RA 4XY9A 5D3TA 5D26A 5CUAA 5HJCA 5F61A 5II2A 5CY9A 5CQTA 3MUKA 4QYLA 3P1EA 5D3LA 5A82A 5DLZA 4A9MA 5D3NA 5AMEA 5CUCA 4YYIA 2R0YA 2L85A 4CURA 4QSSA 5LVQA 3ONIA 3UV4A 2G4AA 5HLSA 5COIA 4WHWA 1JM4B 5H1VA 5FBXA 3UV2A 5KTWA 4TT2A 5HFRA 5DBMA 5A7CA 4QR3A 4OUFA 4OGIA 3MB4A 4IR4A 5FE0A 5ACYA 2I8NA 5EPRA 3UW9A 5I29A 2YEKA 5EGUA 4O7CA 5ENGA 5DX4A 4MR3A 5IGLA 4A9FA 5L98A 5HM0A 4NUDA 2YYNA 4LDFA 4LR6A 4DONA 4KCXA 2H60A 5L8TA 5E3DA 5EWVA 5DYAA 4E96A 5F63A 4IORA 4YYGA 5D3SA 5E9MA 4XUAA 5A5OA 5EWCA 5DFBA 5I86A 5I83A 4YBSA 3U5NA 4TZ2A 2DVVA 5D3HA 5FH7A 4NR5A 5F36A 5DKHA 3Q2FA 5LJ1A 3QZVA 4C67A 5FE6A 4YK0A 3TLPA 4Z6IA 2FSAA 4NUEA 2D9EA 5EICA 5DFDA 4QSXA 3O37A 4HXKA 4A9JA 4YH4A 5C7NA 4N4GA 5E74A 2YEMA 3LQIA 4O72A 5FE1A 5E73A 4TQNA 5DFCA 5DW1A 2OSSA 5A5SA 2RO1A 5ETBA 5HRXA 4HBVA 4XYAA 3QZTA 5CUBA 5AD2A 4F3IA 3O34A 2DVSA 3MULA 4UYGA 2D82A 4YBTA 3O33A 5C89A 5C4QA 4XY8A 3O35A 5HQ7A 5LKUA 5E3GA 5CQ5A 4IOOA 5E0RA 5ENCA 4UYHA 5LVRA 4NUCA 4O70A 4Y03A 1ZS5A 4LYIA 4KV4A 4C66A 5H1TA 4QYDA 4N4FA 2YQDA 5A5QA 4HXMA 4HXPA 4HBWA 3JVLA 4QC1A 4HXLA 4NS5A 5I1QA 5A83A 5EQ1A 5FDZA 5AMFA 4NYXA 2L5EA 4QSTA 4TT4A 5IGNA 5LJ2A 4YAXA 5IG6A 4PCIA 3AADA 3UVDA 3P1CA 5CRMA 4N3WA 5EV9A 5D25A 4PS5A 3JVMA 4MR6A 4BW1A 3P1DA 5HELA 5KHMA 5ENEA 5ENHA 4O77A 5HEMA 4LZRA 2E7NA 2OO1A 5H85A 5II1A 4XUBA 5KTXA 4TYLA 3LQHA 4NRCA 4HXNA 5DY7A 3U5PA 4O7AA 3MQMA 5F60A 4UYDA 4QSQA 5CPEA 4UIZA 4LYSA 4QEUA 1F68A 5LUUA 4Z93A 5FH6A 4IR3A 5I40A 5F1LA 3SVGA 4CUTA 4NR8A 2L84A 5FE4A 4YY4A 3U5JA 4IR6A 5F5ZA 4X2IA 4TTEA 4NR9A 3UV5A 2DATA 2DKWA 2OUOA 5ENJA 5ENIA 4YATA 5I7XA 2WP1A 5LKZA 5EVAA 2NXBA 5EPBA 5FFYA 2R0SA 5ETDA 5HENA 3QZSA 5A81A 1WUMA 4QZSA 4AKNA 5IGMA 5HCLA 5CQ7A 2I7KA 4MR4A 4QEVA 4LYWA 4QSVA 4QB3A 4UITA 4BW2A 4LZSA 4Q0NA 4BW3A 5EA1A 5IGKA 5CTLA 5E9YA 5DYXA 5DKDA 4HXSA 4A9HA 5FE9A 3FKMX 2YELA 2DWWA 5CGPA 4Z1SA 4QUTA 2WP2A 4O7BA 3JVKA 5EISA 5FB0A 2F6NA 4N4IA 3IU5A 5DYCA 5I88A 4QNSA 5D0CA 4A9KA 5DYUA 5IBNA 5I80A 5EWHA 2RNYA 2RNWA 3NXBA 2RFJA 4UYFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MR5 A;  2RNX A;  2MJV B;  4O71 A;  4UIW A;  4YYJ A;  3P5O A;  5IID A;  5E9K A;  4QSU A;  3GG3 A;  3UVW A;  4YC9 A;  3D7C A;  4TU4 A;  5CQA A;  5A5R A;  4CUP A;  5F2P A;  5EK9 A;  4MEO A;  4J0S A;  5CP5 A;  4KV1 A;  2RS9 B;  5F25 A;  4YYK A;  4CUU A;  5KTU A;  4TS8 A;  5D24 A;  5F3A A;  4MEP A;  5FE8 A;  5DW2 A;  4NYV A;  4UIY A;  5K29 A;  3AQA A;  4MEQ A;  4QBM A;  4HBX A;  5CQ4 A;  4IR5 A;  4O7E A;  5EI4 A;  5E9L A;  4UIU A;  4A9O A;  4GPJ A;  5HQ5 A;  5FG5 A;  3MXF A;  5CQ6 A;  5C8G A;  4CFL A;  4O78 A;  3IU6 A;  4HBY A;  2YDW A;  4Z1Q A;  4RVR A;  4O74 A;  3DWY A;  3LQJ A;  5FB1 A;  5DLX A;  3G0L A;  4QR5 A;  5G4S A;  1WUG A;  4NYW A;  4WIV A;  4QC3 A;  3SVH A;  5DKC A;  5HRV A;  5JWM A;  4QSW A;  5D3J A;  2KTB B;  5E9V A;  3K2J A;  5FE2 A;  4NR7 A;  4NR4 A;  4OGJ A;  4UYE A;  5EWD A;  4YAD A;  4QY4 A;  2E7O A;  3S91 A;  5CRZ A;  2E3K A;  3U5M A;  5CUE A;  2R10 A;  3Q2E A;  4ZC9 A;  4YAB A;  4LRG A;  4WHU A;  4LC2 A;  3HME A;  5D7X A;  4YYD A;  3LJW A;  5E7D A;  4FLP A;  4TU6 A;  4TZ8 A;  4QEW A;  5CUD A;  4IOQ A;  4NXJ A;  5L97 A;  4YBM A;  3S92 A;  5JI8 A;  5EU1 A;  4BHW A;  3O36 A;  2DVQ A;  4NRA A;  4Z6H A;  2DVR A;  4ZQL A;  3P1F A;  5I7Y A;  5C85 A;  4A9I A;  3U5O A;  5CQ8 A;  4UIV A;  3RCW A;  3U5L A;  4O75 A;  5EP7 A;  5CU8 A;  1X0J A;  3ZYU A;  4ALG A;  5G4R A;  4CLB A;  1EQF A;  4PTB A;  4CFK A;  5ENF A;  4ALH A;  5TB6 A;  5KU3 A;  2GRC A;  5F62 A;  5A5N A;  2RI7 A;  5L99 A;  4UYF A;  4N4H A;  5EM3 A;  5FE3 A;  4UIX A;  3LXJ A;  5D3R A;  5HFQ A;  5EWW A;  5HRW A;  4NRB A;  5BT5 A;  1JSP B;  5FE5 A;  4TT6 A;  4A9N A;  4ZW1 A;  4YYM A;  4YY6 A;  4YYN A;  4QUU A;  5LJ0 A;  5KO4 A;  5D3P A;  5HQ6 A;  4MEN A;  4CUS A;  4Q0O A;  5AD3 A;  4NQM A;  3SVF A;  5BT4 A;  5TCM A;  4YH3 A;  4CUQ A;  4HXR A;  4HXO A;  5E9I A;  5H1U A;  5L8U A;  5FH8 A;  3U5K A;  4PCE A;  2R0V A;  5FG4 A;  3DAI A;  5A85 A;  3HMF A;  4BW4 A;  5CFW A;  5FG6 A;  4J3I A;  4A9E A;  4J1P A;  5J0D A;  3I3J A;  4A9L A;  4NQN A;  5CZG A;  1N72 A;  4BJX A;  4CL9 A;  5FFW A;  5BT3 A;  4YYH A;  5I89 A;  5A5P A;  5LKT A;  5FFV A;  2YW5 A;  3UVX A;  5CQ3 A;  5CUG A;  4QSP A;  3HMH A;  5L96 A;  5LKX A;  3G0J A;  2N9G A;  4PY6 A;  5CS8 A;  5F1H A;  4NR6 A;  2LSP B;  3JVJ A;  3UVY A;  4QR4 A;  4O76 A;  5C87 A;  5FE7 A;  5ENB A;  2F6J A;  3MB3 A;  1E6I A;  4PKL A;  4QSR A;  4O7F A;  4LZ2 A;  5EPS A;  4J0R A;  4XY9 A;  5D3T A;  5D26 A;  5CUA A;  5HJC A;  5F61 A;  5II2 A;  5CY9 A;  5CQT A;  3MUK A;  4QYL A;  3P1E A;  5D3L A;  5A82 A;  5DLZ A;  4A9M A;  5D3N A;  5AME A;  5CUC A;  4YYI A;  2R0Y A;  2L85 A;  4CUR A;  4QSS A;  5LVQ A;  3ONI A;  3UV4 A;  2G4A A;  5HLS A;  5COI A;  4WHW A;  1JM4 B;  5H1V A;  5FBX A;  3UV2 A;  5KTW A;  4TT2 A;  5HFR A;  5DBM A;  5A7C A;  4QR3 A;  4OUF A;  4OGI A;  3MB4 A;  4IR4 A;  5FE0 A;  5ACY A;  2I8N A;  5EPR A;  3UW9 A;  5I29 A;  2YEK A;  5EGU A;  4O7C A;  5ENG A;  5DX4 A;  4MR3 A;  5IGL A;  4A9F A;  5L98 A;  5HM0 A;  4NUD A;  2YYN A;  4LDF A;  4LR6 A;  4DON A;  4KCX A;  2H60 A;  5L8T A;  5E3D A;  5EWV A;  5DYA A;  4E96 A;  5F63 A;  4IOR A;  4YYG A;  5D3S A;  5E9M A;  4XUA A;  5A5O A;  5EWC A;  5DFB A;  5I86 A;  5I83 A;  4YBS A;  3U5N A;  4TZ2 A;  2DVV A;  5D3H A;  5FH7 A;  4NR5 A;  5F36 A;  5DKH A;  3Q2F A;  5LJ1 A;  3QZV A;  4C67 A;  5FE6 A;  4YK0 A;  3TLP A;  4Z6I A;  2FSA A;  4NUE A;  2D9E A;  5EIC A;  5DFD A;  4QSX A;  3O37 A;  4HXK A;  4A9J A;  4YH4 A;  5C7N A;  4N4G A;  5E74 A;  2YEM A;  3LQI A;  4O72 A;  5FE1 A;  5E73 A;  4TQN A;  5DFC A;  5DW1 A;  2OSS A;  5A5S A;  2RO1 A;  5ETB A;  5HRX A;  4HBV A;  4XYA A;  3QZT A;  5CUB A;  5AD2 A;  4F3I A;  3O34 A;  2DVS A;  3MUL A;  4UYG A;  2D82 A;  4YBT A;  3O33 A;  5C89 A;  5C4Q A;  4XY8 A;  3O35 A;  5HQ7 A;  5LKU A;  5E3G A;  5CQ5 A;  4IOO A;  5E0R A;  5ENC A;  4UYH A;  5LVR A;  4NUC A;  4O70 A;  4Y03 A;  1ZS5 A;  4LYI A;  4KV4 A;  4C66 A;  5H1T A;  4QYD A;  4N4F A;  2YQD A;  5A5Q A;  4HXM A;  4HXP A;  4HBW A;  3JVL A;  4QC1 A;  4HXL A;  4NS5 A;  5I1Q A;  5A83 A;  5EQ1 A;  5FDZ A;  5AMF A;  4NYX A;  2L5E A;  4QST A;  4TT4 A;  5IGN A;  5LJ2 A;  4YAX A;  5IG6 A;  4PCI A;  3AAD A;  3UVD A;  3P1C A;  5CRM A;  4N3W A;  5EV9 A;  5D25 A;  4PS5 A;  3JVM A;  4MR6 A;  4BW1 A;  3P1D A;  5HEL A;  5KHM A;  5ENE A;  5ENH A;  4O77 A;  5HEM A;  4LZR A;  2E7N A;  2OO1 A;  5H85 A;  5II1 A;  4XUB A;  5KTX A;  4TYL A;  3LQH A;  4NRC A;  4HXN A;  5DY7 A;  3U5P A;  4O7A A;  3MQM A;  5F60 A;  4UYD A;  4QSQ A;  5CPE A;  4UIZ A;  4LYS A;  4QEU A;  1F68 A;  5LUU A;  4Z93 A;  5FH6 A;  4IR3 A;  5I40 A;  5F1L A;  3SVG A;  4CUT A;  4NR8 A;  2L84 A;  5FE4 A;  4YY4 A;  3U5J A;  4IR6 A;  5F5Z A;  4X2I A;  4TTE A;  4NR9 A;  3UV5 A;  2DAT A;  2DKW A;  2OUO A;  5ENJ A;  5ENI A;  4YAT A;  5I7X A;  2WP1 A;  5LKZ A;  5EVA A;  2NXB A;  5EPB A;  5FFY A;  2R0S A;  5ETD A;  5HEN A;  3QZS A;  5A81 A;  1WUM A;  4QZS A;  4AKN A;  5IGM A;  5HCL A;  5CQ7 A;  2I7K A;  4MR4 A;  4QEV A;  4LYW A;  4QSV A;  4QB3 A;  4UIT A;  4BW2 A;  4LZS A;  4Q0N A;  4BW3 A;  5EA1 A;  5IGK A;  5CTL A;  5E9Y A;  5DYX A;  5DKD A;  4HXS A;  4A9H A;  5FE9 A;  3FKM X;  2YEL A;  2DWW A;  5CGP A;  4Z1S A;  4QUT A;  2WP2 A;  4O7B A;  3JVK A;  5EIS A;  5FB0 A;  2F6N A;  4N4I A;  3IU5 A;  5DYC A;  5I88 A;  4QNS A;  5D0C A;  4A9K A;  5DYU A;  5IBN A;  5I80 A;  5EWH A;  2RNY A;  2RNW A;  3NXB A;  2RFJ A;  4UYF B; 
#chains in the Genus database with same CATH topology
 4MR5 A;  2RNX A;  2MJV B;  4O71 A;  4UIW A;  4YYJ A;  3P5O A;  5IID A;  5E9K A;  4QSU A;  3GG3 A;  3UVW A;  4YC9 A;  3D7C A;  4TU4 A;  5CQA A;  5A5R A;  4CUP A;  5F2P A;  5EK9 A;  4MEO A;  4J0S A;  5CP5 A;  4KV1 A;  2RS9 B;  5F25 A;  4YYK A;  4CUU A;  5KTU A;  4TS8 A;  5D24 A;  5F3A A;  4MEP A;  5FE8 A;  5DW2 A;  4NYV A;  4UIY A;  5K29 A;  3AQA A;  4MEQ A;  4QBM A;  4HBX A;  5CQ4 A;  4IR5 A;  4O7E A;  5EI4 A;  5E9L A;  4UIU A;  4A9O A;  4GPJ A;  5HQ5 A;  5FG5 A;  3MXF A;  5CQ6 A;  5C8G A;  4CFL A;  4O78 A;  3IU6 A;  4HBY A;  2YDW A;  4Z1Q A;  4RVR A;  4O74 A;  3DWY A;  3LQJ A;  5FB1 A;  5DLX A;  3G0L A;  4QR5 A;  5G4S A;  1WUG A;  4NYW A;  4WIV A;  4QC3 A;  3SVH A;  5DKC A;  5HRV A;  5JWM A;  4QSW A;  5D3J A;  2KTB B;  4AKG A;  5E9V A;  3K2J A;  5FE2 A;  4NR7 A;  3ERR A;  4NR4 A;  4OGJ A;  4UYE A;  5EWD A;  4YAD A;  4QY4 A;  2E7O A;  3S91 A;  5CRZ A;  2E3K A;  3U5M A;  5CUE A;  2R10 A;  3Q2E A;  4ZC9 A;  4YAB A;  4LRG A;  4WHU A;  4LC2 A;  3HME A;  5D7X A;  4YYD A;  3LJW A;  5E7D A;  4FLP A;  4TU6 A;  4TZ8 A;  4QEW A;  5CUD A;  4IOQ A;  4NXJ A;  5L97 A;  4YBM A;  3S92 A;  5JI8 A;  5EU1 A;  4BHW A;  3O36 A;  2DVQ A;  2EJN A;  4NRA A;  4Z6H A;  2DVR A;  4ZQL A;  3P1F A;  5I7Y A;  5C85 A;  4A9I A;  3U5O A;  5CQ8 A;  4UIV A;  3RCW A;  3U5L A;  4O75 A;  5EP7 A;  5CU8 A;  1X0J A;  3ZYU A;  4ALG A;  5G4R A;  4CLB A;  1EQF A;  4PTB A;  4CFK A;  5ENF A;  4ALH A;  5TB6 A;  5KU3 A;  4AI6 A;  2GRC A;  5F62 A;  5A5N A;  2RI7 A;  5L99 A;  4UYF A;  4N4H A;  5EM3 A;  5FE3 A;  4AKH A;  4UIX A;  3LXJ A;  5D3R A;  5HFQ A;  5EWW A;  5HRW A;  4NRB A;  5BT5 A;  1JSP B;  5FE5 A;  4TT6 A;  4A9N A;  4ZW1 A;  4YYM A;  4YY6 A;  4YYN A;  4QUU A;  5LJ0 A;  5KO4 A;  5D3P A;  5HQ6 A;  4MEN A;  4CUS A;  4Q0O A;  5AD3 A;  4NQM A;  3SVF A;  5BT4 A;  5TCM A;  4YH3 A;  4CUQ A;  4HXR A;  4HXO A;  5E9I A;  5H1U A;  5L8U A;  5FH8 A;  3U5K A;  4PCE A;  2R0V A;  5FG4 A;  3DAI A;  5A85 A;  3HMF A;  4BW4 A;  5CFW A;  5FG6 A;  4J3I A;  4A9E A;  4J1P A;  5J0D A;  3I3J A;  4A9L A;  4NQN A;  5CZG A;  1N72 A;  4BJX A;  4CL9 A;  5FFW A;  5BT3 A;  4YYH A;  5I89 A;  5A5P A;  5LKT A;  5FFV A;  2YW5 A;  3UVX A;  5CQ3 A;  5CUG A;  4QSP A;  3HMH A;  5L96 A;  5LKX A;  3G0J A;  2N9G A;  4PY6 A;  5CS8 A;  5F1H A;  4NR6 A;  2LSP B;  3JVJ A;  3UVY A;  4QR4 A;  4O76 A;  5C87 A;  5FE7 A;  5ENB A;  2F6J A;  3MB3 A;  1E6I A;  4PKL A;  4QSR A;  4O7F A;  4LZ2 A;  5EPS A;  4J0R A;  4XY9 A;  5D3T A;  5D26 A;  5CUA A;  5HJC A;  5F61 A;  5II2 A;  5CY9 A;  5CQT A;  3MUK A;  4QYL A;  3P1E A;  5D3L A;  5A82 A;  5DLZ A;  4A9M A;  5D3N A;  5AME A;  5CUC A;  4YYI A;  2R0Y A;  2L85 A;  4CUR A;  4QSS A;  5LVQ A;  3ONI A;  3UV4 A;  2G4A A;  5HLS A;  5COI A;  4WHW A;  1JM4 B;  5H1V A;  5FBX A;  3UV2 A;  5KTW A;  4TT2 A;  5HFR A;  5DBM A;  5A7C A;  4QR3 A;  4OUF A;  4OGI A;  3MB4 A;  4IR4 A;  5FE0 A;  5ACY A;  2I8N A;  5EPR A;  3UW9 A;  5I29 A;  2YEK A;  5EGU A;  4O7C A;  5ENG A;  3VKG A;  5DX4 A;  4MR3 A;  5IGL A;  4A9F A;  5L98 A;  5HM0 A;  4NUD A;  2YYN A;  4LDF A;  4LR6 A;  4DON A;  4KCX A;  2H60 A;  5L8T A;  5E3D A;  5EWV A;  5DYA A;  4E96 A;  3D1B A;  5F63 A;  4IOR A;  4YYG A;  5D3S A;  5E9M A;  4XUA A;  5A5O A;  5EWC A;  5DFB A;  5I86 A;  5I83 A;  4YBS A;  3U5N A;  4TZ2 A;  2DVV A;  5D3H A;  5FH7 A;  4NR5 A;  5F36 A;  5DKH A;  3Q2F A;  5LJ1 A;  3QZV A;  4C67 A;  5FE6 A;  4YK0 A;  3TLP A;  4Z6I A;  3VKH A;  2FSA A;  4NUE A;  2D9E A;  5EIC A;  5DFD A;  4QSX A;  3O37 A;  4HXK A;  4A9J A;  4YH4 A;  5C7N A;  4N4G A;  5E74 A;  2YEM A;  3LQI A;  4O72 A;  5FE1 A;  5E73 A;  4TQN A;  5DFC A;  5DW1 A;  2OSS A;  5A5S A;  2RO1 A;  5ETB A;  5HRX A;  4HBV A;  4XYA A;  3QZT A;  5CUB A;  5AD2 A;  4F3I A;  3O34 A;  2DVS A;  4AKI A;  3MUL A;  4UYG A;  2D82 A;  4YBT A;  3O33 A;  5C89 A;  5C4Q A;  4XY8 A;  3O35 A;  5HQ7 A;  5LKU A;  5E3G A;  5CQ5 A;  4IOO A;  5E0R A;  1ZKR A;  5ENC A;  1PUO A;  4UYH A;  5LVR A;  4NUC A;  4O70 A;  4Y03 A;  1ZS5 A;  4LYI A;  4KV4 A;  4C66 A;  5H1T A;  4QYD A;  4N4F A;  2YQD A;  5A5Q A;  4HXM A;  4HXP A;  4HBW A;  3JVL A;  4QC1 A;  4HXL A;  4NS5 A;  5I1Q A;  5A83 A;  5EQ1 A;  5FDZ A;  5AMF A;  4NYX A;  2L5E A;  4QST A;  4TT4 A;  5IGN A;  5LJ2 A;  4YAX A;  5IG6 A;  4PCI A;  3AAD A;  3UVD A;  3P1C A;  5CRM A;  4N3W A;  5EV9 A;  5D25 A;  4PS5 A;  3JVM A;  4MR6 A;  4BW1 A;  3P1D A;  5HEL A;  5KHM A;  5ENE A;  5ENH A;  4O77 A;  5HEM A;  4LZR A;  2E7N A;  2OO1 A;  5H85 A;  5II1 A;  4XUB A;  5KTX A;  4TYL A;  3LQH A;  4NRC A;  4HXN A;  5DY7 A;  3U5P A;  4O7A A;  3MQM A;  5F60 A;  4UYD A;  4QSQ A;  5CPE A;  4UIZ A;  4LYS A;  4QEU A;  1F68 A;  5LUU A;  4Z93 A;  5FH6 A;  4IR3 A;  5I40 A;  5F1L A;  3SVG A;  4CUT A;  4NR8 A;  2L84 A;  5FE4 A;  4YY4 A;  3U5J A;  4IR6 A;  5F5Z A;  4X2I A;  4TTE A;  4NR9 A;  3UV5 A;  2DAT A;  2DKW A;  2OUO A;  5ENJ A;  5ENI A;  4YAT A;  5I7X A;  2WP1 A;  5LKZ A;  5EVA A;  2NXB A;  5EPB A;  5FFY A;  2R0S A;  5ETD A;  5HEN A;  3QZS A;  5A81 A;  1WUM A;  4QZS A;  4AKN A;  5IGM A;  5HCL A;  5CQ7 A;  2I7K A;  4MR4 A;  4QEV A;  4LYW A;  4QSV A;  4QB3 A;  4UIT A;  4BW2 A;  4LZS A;  4Q0N A;  4BW3 A;  5EA1 A;  5IGK A;  5CTL A;  5E9Y A;  5DYX A;  5DKD A;  4HXS A;  3D1D A;  4A9H A;  5FE9 A;  3FKM X;  2YEL A;  2DWW A;  5CGP A;  4Z1S A;  4QUT A;  2WP2 A;  4O7B A;  3JVK A;  5EIS A;  5FB0 A;  2F6N A;  4N4I A;  3IU5 A;  5DYC A;  5I88 A;  4QNS A;  5D0C A;  4A9K A;  5DYU A;  5IBN A;  5I80 A;  5EWH A;  2RNY A;  2RNW A;  3NXB A;  2RFJ A;  4UYF B; 
#chains in the Genus database with same CATH homology
 4MR5 A;  2RNX A;  2MJV B;  4O71 A;  4UIW A;  4YYJ A;  3P5O A;  5IID A;  5E9K A;  4QSU A;  3GG3 A;  3UVW A;  4YC9 A;  3D7C A;  4TU4 A;  5CQA A;  5A5R A;  4CUP A;  5F2P A;  5EK9 A;  4MEO A;  4J0S A;  5CP5 A;  4KV1 A;  2RS9 B;  5F25 A;  4YYK A;  4CUU A;  5KTU A;  4TS8 A;  5D24 A;  5F3A A;  4MEP A;  5FE8 A;  5DW2 A;  4NYV A;  4UIY A;  5K29 A;  3AQA A;  4MEQ A;  4QBM A;  4HBX A;  5CQ4 A;  4IR5 A;  4O7E A;  5EI4 A;  5E9L A;  4UIU A;  4A9O A;  4GPJ A;  5HQ5 A;  5FG5 A;  3MXF A;  5CQ6 A;  5C8G A;  4CFL A;  4O78 A;  3IU6 A;  4HBY A;  2YDW A;  4Z1Q A;  4RVR A;  4O74 A;  3DWY A;  3LQJ A;  5FB1 A;  5DLX A;  3G0L A;  4QR5 A;  5G4S A;  1WUG A;  4NYW A;  4WIV A;  4QC3 A;  3SVH A;  5DKC A;  5HRV A;  5JWM A;  4QSW A;  5D3J A;  2KTB B;  5E9V A;  3K2J A;  5FE2 A;  4NR7 A;  4NR4 A;  4OGJ A;  4UYE A;  5EWD A;  4YAD A;  4QY4 A;  2E7O A;  3S91 A;  5CRZ A;  2E3K A;  3U5M A;  5CUE A;  2R10 A;  3Q2E A;  4ZC9 A;  4YAB A;  4LRG A;  4WHU A;  4LC2 A;  3HME A;  5D7X A;  4YYD A;  3LJW A;  5E7D A;  4FLP A;  4TU6 A;  4TZ8 A;  4QEW A;  5CUD A;  4IOQ A;  4NXJ A;  5L97 A;  4YBM A;  3S92 A;  5JI8 A;  5EU1 A;  4BHW A;  3O36 A;  2DVQ A;  4NRA A;  4Z6H A;  2DVR A;  4ZQL A;  3P1F A;  5I7Y A;  5C85 A;  4A9I A;  3U5O A;  5CQ8 A;  4UIV A;  3RCW A;  3U5L A;  4O75 A;  5EP7 A;  5CU8 A;  1X0J A;  3ZYU A;  4ALG A;  5G4R A;  4CLB A;  1EQF A;  4PTB A;  4CFK A;  5ENF A;  4ALH A;  5TB6 A;  5KU3 A;  2GRC A;  5F62 A;  5A5N A;  2RI7 A;  5L99 A;  4UYF A;  4N4H A;  5EM3 A;  5FE3 A;  4UIX A;  3LXJ A;  5D3R A;  5HFQ A;  5EWW A;  5HRW A;  4NRB A;  5BT5 A;  1JSP B;  5FE5 A;  4TT6 A;  4A9N A;  4ZW1 A;  4YYM A;  4YY6 A;  4YYN A;  4QUU A;  5LJ0 A;  5KO4 A;  5D3P A;  5HQ6 A;  4MEN A;  4CUS A;  4Q0O A;  5AD3 A;  4NQM A;  3SVF A;  5BT4 A;  5TCM A;  4YH3 A;  4CUQ A;  4HXR A;  4HXO A;  5E9I A;  5H1U A;  5L8U A;  5FH8 A;  3U5K A;  4PCE A;  2R0V A;  5FG4 A;  3DAI A;  5A85 A;  3HMF A;  4BW4 A;  5CFW A;  5FG6 A;  4J3I A;  4A9E A;  4J1P A;  5J0D A;  3I3J A;  4A9L A;  4NQN A;  5CZG A;  1N72 A;  4BJX A;  4CL9 A;  5FFW A;  5BT3 A;  4YYH A;  5I89 A;  5A5P A;  5LKT A;  5FFV A;  2YW5 A;  3UVX A;  5CQ3 A;  5CUG A;  4QSP A;  3HMH A;  5L96 A;  5LKX A;  3G0J A;  2N9G A;  4PY6 A;  5CS8 A;  5F1H A;  4NR6 A;  2LSP B;  3JVJ A;  3UVY A;  4QR4 A;  4O76 A;  5C87 A;  5FE7 A;  5ENB A;  2F6J A;  3MB3 A;  1E6I A;  4PKL A;  4QSR A;  4O7F A;  4LZ2 A;  5EPS A;  4J0R A;  4XY9 A;  5D3T A;  5D26 A;  5CUA A;  5HJC A;  5F61 A;  5II2 A;  5CY9 A;  5CQT A;  3MUK A;  4QYL A;  3P1E A;  5D3L A;  5A82 A;  5DLZ A;  4A9M A;  5D3N A;  5AME A;  5CUC A;  4YYI A;  2R0Y A;  2L85 A;  4CUR A;  4QSS A;  5LVQ A;  3ONI A;  3UV4 A;  2G4A A;  5HLS A;  5COI A;  4WHW A;  1JM4 B;  5H1V A;  5FBX A;  3UV2 A;  5KTW A;  4TT2 A;  5HFR A;  5DBM A;  5A7C A;  4QR3 A;  4OUF A;  4OGI A;  3MB4 A;  4IR4 A;  5FE0 A;  5ACY A;  2I8N A;  5EPR A;  3UW9 A;  5I29 A;  2YEK A;  5EGU A;  4O7C A;  5ENG A;  5DX4 A;  4MR3 A;  5IGL A;  4A9F A;  5L98 A;  5HM0 A;  4NUD A;  2YYN A;  4LDF A;  4LR6 A;  4DON A;  4KCX A;  2H60 A;  5L8T A;  5E3D A;  5EWV A;  5DYA A;  4E96 A;  5F63 A;  4IOR A;  4YYG A;  5D3S A;  5E9M A;  4XUA A;  5A5O A;  5EWC A;  5DFB A;  5I86 A;  5I83 A;  4YBS A;  3U5N A;  4TZ2 A;  2DVV A;  5D3H A;  5FH7 A;  4NR5 A;  5F36 A;  5DKH A;  3Q2F A;  5LJ1 A;  3QZV A;  4C67 A;  5FE6 A;  4YK0 A;  3TLP A;  4Z6I A;  2FSA A;  4NUE A;  2D9E A;  5EIC A;  5DFD A;  4QSX A;  3O37 A;  4HXK A;  4A9J A;  4YH4 A;  5C7N A;  4N4G A;  5E74 A;  2YEM A;  3LQI A;  4O72 A;  5FE1 A;  5E73 A;  4TQN A;  5DFC A;  5DW1 A;  2OSS A;  5A5S A;  2RO1 A;  5ETB A;  5HRX A;  4HBV A;  4XYA A;  3QZT A;  5CUB A;  5AD2 A;  4F3I A;  3O34 A;  2DVS A;  3MUL A;  4UYG A;  2D82 A;  4YBT A;  3O33 A;  5C89 A;  5C4Q A;  4XY8 A;  3O35 A;  5HQ7 A;  5LKU A;  5E3G A;  5CQ5 A;  4IOO A;  5E0R A;  5ENC A;  4UYH A;  5LVR A;  4NUC A;  4O70 A;  4Y03 A;  1ZS5 A;  4LYI A;  4KV4 A;  4C66 A;  5H1T A;  4QYD A;  4N4F A;  2YQD A;  5A5Q A;  4HXM A;  4HXP A;  4HBW A;  3JVL A;  4QC1 A;  4HXL A;  4NS5 A;  5I1Q A;  5A83 A;  5EQ1 A;  5FDZ A;  5AMF A;  4NYX A;  2L5E A;  4QST A;  4TT4 A;  5IGN A;  5LJ2 A;  4YAX A;  5IG6 A;  4PCI A;  3AAD A;  3UVD A;  3P1C A;  5CRM A;  4N3W A;  5EV9 A;  5D25 A;  4PS5 A;  3JVM A;  4MR6 A;  4BW1 A;  3P1D A;  5HEL A;  5KHM A;  5ENE A;  5ENH A;  4O77 A;  5HEM A;  4LZR A;  2E7N A;  2OO1 A;  5H85 A;  5II1 A;  4XUB A;  5KTX A;  4TYL A;  3LQH A;  4NRC A;  4HXN A;  5DY7 A;  3U5P A;  4O7A A;  3MQM A;  5F60 A;  4UYD A;  4QSQ A;  5CPE A;  4UIZ A;  4LYS A;  4QEU A;  1F68 A;  5LUU A;  4Z93 A;  5FH6 A;  4IR3 A;  5I40 A;  5F1L A;  3SVG A;  4CUT A;  4NR8 A;  2L84 A;  5FE4 A;  4YY4 A;  3U5J A;  4IR6 A;  5F5Z A;  4X2I A;  4TTE A;  4NR9 A;  3UV5 A;  2DAT A;  2DKW A;  2OUO A;  5ENJ A;  5ENI A;  4YAT A;  5I7X A;  2WP1 A;  5LKZ A;  5EVA A;  2NXB A;  5EPB A;  5FFY A;  2R0S A;  5ETD A;  5HEN A;  3QZS A;  5A81 A;  1WUM A;  4QZS A;  4AKN A;  5IGM A;  5HCL A;  5CQ7 A;  2I7K A;  4MR4 A;  4QEV A;  4LYW A;  4QSV A;  4QB3 A;  4UIT A;  4BW2 A;  4LZS A;  4Q0N A;  4BW3 A;  5EA1 A;  5IGK A;  5CTL A;  5E9Y A;  5DYX A;  5DKD A;  4HXS A;  4A9H A;  5FE9 A;  3FKM X;  2YEL A;  2DWW A;  5CGP A;  4Z1S A;  4QUT A;  2WP2 A;  4O7B A;  3JVK A;  5EIS A;  5FB0 A;  2F6N A;  4N4I A;  3IU5 A;  5DYC A;  5I88 A;  4QNS A;  5D0C A;  4A9K A;  5DYU A;  5IBN A;  5I80 A;  5EWH A;  2RNY A;  2RNW A;  3NXB A;  2RFJ A;  4UYF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...