2DWWA

Crystal structure of bromodomain-containing protein 4
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
KSSKISEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLESREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Crystal structure of Bromodomain-containing protein 4
rcsb
source organism Mus musculus
molecule tags Transcription
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2dwwA00
5LVQA 5BT5A 5FH8A 3UW9A 4ZC9A 5EA1A 4YYGA 3U5OA 5EVAA 1ZS5A 4QUTA 4O76A 5IGLA 4NYXA 4Z6HA 4TYLA 4CURA 3MUKA 4MR6A 3MB3A 4QB3A 5CRMA 2D9EA 5ENIA 4Z6IA 4LDFA 4TT6A 4TU6A 4NUEA 4QSPA 2N9GA 5CY9A 2I7KA 5AD3A 4GPJA 4A9FA 4LZSA 4MEOA 4HXPA 4MR3A 5CRZA 5A5NA 4YYDA 3IU6A 5FG6A 5FE5A 4O7AA 5EV9A 5CQAA 5FBXA 4XY8A 5DYCA 4A9OA 4XUBA 3IU5A 4IOOA 4IR5A 5FG5A 2R0VA 5CFWA 5A5OA 3UVYA 5FE7A 5KU3A 5FE3A 4Z1QA 5E9VA 5F63A 4O75A 4QEUA 5D3SA 5FDZA 5EK9A 4E96A 5E9LA 3UVWA 1JSPB 4YYIA 3AQAA 4O78A 4J1PA 4C67A 5EWCA 4QR3A 4YATA 5EU1A 4N3WA 5CGPA 5F5ZA 4LZ2A 3DWYA 4PTBA 4F3IA 4YYHA 5IIDA 2KTBB 3FKMX 5D3RA 3JVKA 4HBVA 4OGJA 4O70A 5A83A 2DKWA 3UV5A 3O34A 3SVHA 2OSSA 4NYVA 1EQFA 5EPBA 4NR6A 4A9HA 5AD2A 4YYMA 5HCLA 5E9MA 4KCXA 5FFWA 5I83A 4O7EA 5FFVA 4CUSA 4Z93A 3P1DA 3JVJA 5D25A 4YYJA 5E9KA 4QC3A 5A82A 5ENCA 5EI4A 2RNYA 5FE4A 4Z1SA 5LKZA 5F1LA 2YQDA 3I3JA 5CUEA 5FFYA 2RNWA 4HXLA 5D3TA 5HM0A 4BW4A 3S92A 4N4GA 4BHWA 4YBSA 4UYDA 2DVVA 5A5RA 5G4RA 2GRCA 4PCIA 5DKHA 5I40A 4XY9A 2RO1A 4HXMA 4A9NA 3G0LA 5KTXA 4CUTA 2RNXA 5E3DA 4ALHA 4PS5A 5IG6A 5HQ5A 5DX4A 4QEWA 5A5QA 4MENA 4NR4A 5CU8A 2H60A 2F6NA 3Q2FA 5LKTA 5FE0A 3UVXA 3G0JA 2L84A 4O7BA 5FE6A 4MR4A 4TZ8A 2RI7A 5I7XA 4KV4A 4XUAA 4QEVA 1E6IA 4UIYA 4NR5A 5I86A 4UYFA 4IR4A 5TCMA 4IR3A 3ONIA 4J0RA 5CQ3A 4HBXA 4NUCA 5IGKA 5ENHA 5EWWA 2E7OA 5F61A 3DAIA 5D3JA 3LXJA 4WHWA 5D3LA 4Q0OA 2L5EA 5F36A 2G4AA 2DATA 3U5PA 5KHMA 4WHUA 5KO4A 5EM3A 3O36A 4O71A 5ETDA 5KTUA 4YH3A 1F68A 4HXSA 5H1TA 5I7YA 4UIVA 5H85A 5L97A 2DVQA 4PCEA 2OO1A 4NUDA 4QSTA 4LYIA 4TT4A 4ZQLA 4YABA 4NXJA 5G4SA 5E7DA 4YBMA 5I89A 2YDWA 2DWWA 5FB0A 5A7CA 4WIVA 5I1QA 5LJ2A 5DFCA 2E3KA 5JI8A 5I80A 1WUGA 4O77A 5IBNA 3AADA 5HRVA 4QY4A 5LKXA 2FSAA 2R0SA 5A81A 4QYDA 5BT4A 4CUQA 5KTWA 3P1CA 4FLPA 4IORA 5CUBA 4J3IA 5ENGA 3S91A 5ENFA 5CP5A 3ZYUA 3LJWA 3P1EA 2DVRA 4UYHA 5LVRA 4HXNA 4TZ2A 4DONA 4ALGA 5DBMA 5DFDA 5COIA 4QYLA 5FG4A 4OGIA 5DY7A 3U5NA 5K29A 4QUUA 4YY4A 4Q0NA 5IGNA 5E9YA 5FE9A 2L85A 3SVFA 5F3AA 4A9KA 5D3NA 5JWMA 3K2JA 5L8UA 5CQ6A 2OUOA 3UVDA 4O72A 5ACYA 5L8TA 4QSVA 3O37A 5EISA 4HBWA 4UIZA 5E3GA 5DFBA 2YEMA 5LJ0A 4N4IA 5C7NA 4HBYA 4UIXA 5IGMA 5FH6A 5F2PA 3UV4A 5ENJA 4UIUA 3LQJA 5CQTA 5LUUA 3P1FA 4NR8A 1WUMA 4HXOA 4CLBA 5EWVA 3TLPA 4BW2A 3U5MA 4TS8A 5FE8A 5DW2A 4LYSA 4HXKA 5AMEA 3MQMA 4IR6A 4HXRA 4J0SA 4OUFA 5DW1A 5I29A 2YYNA 4YBTA 5LKUA 4O7FA 3MB4A 4YH4A 4KV1A 5EQ1A 5E9IA 4O74A 2WP1A 4QSRA 3NXBA 4QR5A 4YADA 2D82A 5EPSA 5EPRA 4CL9A 5HFRA 5DYAA 4BW1A 2WP2A 4UYFB 3QZTA 4YC9A 5CS8A 3JVMA 5BT3A 5CQ7A 3LQHA 4NQMA 4A9EA 4A9LA 3JVLA 4YYKA 3UV2A 2NXBA 5DKCA 5HFQA 2YW5A 5H1UA 5CQ4A 5L99A 5F1HA 4NQNA 5CUCA 5C89A 3HMHA 5EICA 2RFJA 4QSUA 2DVSA 4LRGA 3U5LA 4NRBA 4IOQA 4AKNA 4MEPA 4NR9A 4CUUA 5F60A 5E0RA 2MJVB 5II1A 3RCWA 4UIWA 3Q2EA 5HRXA 4QBMA 4QSWA 2YEKA 4LC2A 4RVRA 5FE2A 5D0CA 5E74A 3O33A 4TT2A 5H1VA 5D24A 4QSSA 2YELA 5CTLA 4MEQA 5ENEA 5C8GA 2I8NA 5TB6A 4A9JA 3HMEA 4N4HA 5HEMA 4LYWA 5FE1A 4PY6A 4QC1A 4XYAA 4YY6A 4UYEA 5CQ5A 5C87A 4C66A 5HLSA 2LSPB 5DYXA 4BJXA 4A9MA 5L98A 5C4QA 3HMFA 4QSXA 4TTEA 5A85A 2RS9B 3U5JA 2E7NA 1X0JA 5DLXA 2F6JA 5DYUA 3MULA 5DKDA 5HELA 5CUDA 5CUAA 5I88A 3QZSA 4QNSA 5D3HA 5LJ1A 4CUPA 4QSQA 5D3PA 5EWDA 4YYNA 1JM4B 4YAXA 4X2IA 3O35A 3SVGA 4NR7A 4LZRA 3P5OA 3MXFA 4Y03A 5II2A 4QR4A 4TU4A 5E73A 2R10A 5J0DA 5HQ6A 5FH7A 5HQ7A 4UYGA 5D26A 5F62A 5CZGA 4YK0A 5HJCA 5C85A 5AMFA 5CQ8A 3D7CA 5DLZA 5ETBA 4NRCA 3QZVA 4O7CA 5HENA 5EWHA 2R0YA 5FB1A 5CUGA 4UITA 4ZW1A 1N72A 4NS5A 5EGUA 5L96A 5ENBA 3U5KA 5EP7A 5HRWA 5CPEA 4CFKA 4MR5A 4PKLA 5F25A 5A5PA 5A5SA 4BW3A 4LR6A 4CFLA 4A9IA 4TQNA 4NRAA 3LQIA 4N4FA 4NYWA 5D7XA 4QZSA 3GG3A
chains in the Genus database with same CATH superfamily
5LVQA 5BT5A 5FH8A 3UW9A 4ZC9A 5EA1A 4YYGA 3U5OA 5EVAA 1ZS5A 4QUTA 4O76A 5IGLA 4NYXA 4Z6HA 4TYLA 4CURA 4AKIA 3MUKA 4MR6A 3MB3A 4QB3A 5CRMA 2D9EA 5ENIA 4Z6IA 4LDFA 4TT6A 4TU6A 4NUEA 4QSPA 2N9GA 5CY9A 2I7KA 5AD3A 4GPJA 4A9FA 4LZSA 4MEOA 4HXPA 4MR3A 5CRZA 5A5NA 4YYDA 3IU6A 5FG6A 5FE5A 4O7AA 5EV9A 5CQAA 5FBXA 4XY8A 5DYCA 4A9OA 4XUBA 3IU5A 4IOOA 4IR5A 5FG5A 2R0VA 5CFWA 5A5OA 3UVYA 5FE7A 5KU3A 5FE3A 4Z1QA 5E9VA 5F63A 4O75A 4QEUA 3ERRA 5D3SA 5FDZA 5EK9A 4E96A 5E9LA 3UVWA 1JSPB 4YYIA 3AQAA 4O78A 4J1PA 4C67A 5EWCA 3VKHA 4QR3A 4YATA 5EU1A 4N3WA 5CGPA 5F5ZA 4LZ2A 3DWYA 4PTBA 4F3IA 4YYHA 5IIDA 2KTBB 3FKMX 5D3RA 3JVKA 4HBVA 4OGJA 4O70A 5A83A 2DKWA 3UV5A 3O34A 3SVHA 2OSSA 4NYVA 1EQFA 5EPBA 4NR6A 4A9HA 5AD2A 4YYMA 5HCLA 5E9MA 4KCXA 5FFWA 5I83A 4O7EA 5FFVA 4CUSA 4Z93A 3P1DA 3JVJA 5D25A 4YYJA 5E9KA 4QC3A 5A82A 5ENCA 5EI4A 2RNYA 5FE4A 4Z1SA 5LKZA 5F1LA 2YQDA 3I3JA 5CUEA 5FFYA 2RNWA 4HXLA 5D3TA 4AI6A 5HM0A 4BW4A 3S92A 4N4GA 4BHWA 4YBSA 4UYDA 2DVVA 5A5RA 5G4RA 2GRCA 4PCIA 5DKHA 5I40A 4XY9A 2RO1A 4HXMA 4A9NA 3G0LA 5KTXA 4CUTA 2RNXA 5E3DA 4ALHA 4PS5A 5IG6A 5HQ5A 5DX4A 4QEWA 5A5QA 4MENA 4NR4A 5CU8A 2H60A 2F6NA 3Q2FA 5LKTA 5FE0A 3UVXA 3G0JA 2L84A 4O7BA 5FE6A 4MR4A 4TZ8A 2RI7A 5I7XA 4KV4A 4XUAA 4QEVA 1E6IA 4UIYA 4NR5A 5I86A 4UYFA 4IR4A 5TCMA 4IR3A 3ONIA 4J0RA 5CQ3A 4HBXA 4NUCA 5IGKA 5ENHA 5EWWA 2E7OA 1PUOA 5F61A 3DAIA 5D3JA 3LXJA 4WHWA 5D3LA 4Q0OA 2L5EA 5F36A 2G4AA 2DATA 3U5PA 5KHMA 4WHUA 5KO4A 3VKGA 5EM3A 3O36A 4O71A 5ETDA 5KTUA 4YH3A 1F68A 4HXSA 5H1TA 5I7YA 4UIVA 5H85A 5L97A 2DVQA 1ZKRA 4PCEA 2OO1A 4NUDA 4QSTA 4LYIA 4TT4A 4ZQLA 4YABA 4NXJA 5G4SA 5E7DA 4YBMA 5I89A 2YDWA 2DWWA 5FB0A 5A7CA 4WIVA 5I1QA 5LJ2A 5DFCA 2E3KA 5JI8A 5I80A 1WUGA 4O77A 5IBNA 3AADA 5HRVA 4QY4A 5LKXA 2FSAA 2R0SA 5A81A 4QYDA 5BT4A 4CUQA 3D1BA 5KTWA 3P1CA 4FLPA 4IORA 5CUBA 4J3IA 5ENGA 3S91A 5ENFA 5CP5A 3ZYUA 3LJWA 3P1EA 2DVRA 4UYHA 5LVRA 4HXNA 4TZ2A 4DONA 4ALGA 5DBMA 5DFDA 5COIA 4QYLA 5FG4A 4OGIA 5DY7A 3U5NA 5K29A 4QUUA 4YY4A 4Q0NA 5IGNA 5E9YA 5FE9A 2L85A 3SVFA 5F3AA 4A9KA 5D3NA 5JWMA 3K2JA 5L8UA 5CQ6A 2OUOA 3UVDA 4O72A 5ACYA 2EJNA 5L8TA 4QSVA 3O37A 5EISA 4HBWA 4UIZA 5E3GA 5DFBA 2YEMA 5LJ0A 4N4IA 5C7NA 4HBYA 4UIXA 5IGMA 5FH6A 4AKHA 5F2PA 3UV4A 5ENJA 4UIUA 3LQJA 5CQTA 5LUUA 3P1FA 4NR8A 1WUMA 4HXOA 4CLBA 5EWVA 3TLPA 4BW2A 3U5MA 4TS8A 5FE8A 5DW2A 4LYSA 4HXKA 5AMEA 3MQMA 4IR6A 4HXRA 4J0SA 4OUFA 5DW1A 5I29A 2YYNA 4YBTA 5LKUA 4O7FA 3MB4A 4YH4A 4KV1A 5EQ1A 5E9IA 4O74A 2WP1A 4QSRA 3NXBA 4QR5A 4YADA 2D82A 5EPSA 5EPRA 4CL9A 5HFRA 5DYAA 4BW1A 2WP2A 4UYFB 3QZTA 4YC9A 5CS8A 3JVMA 5BT3A 5CQ7A 3LQHA 4NQMA 4A9EA 4A9LA 3JVLA 4YYKA 3UV2A 2NXBA 5DKCA 5HFQA 2YW5A 5H1UA 5CQ4A 5L99A 5F1HA 4NQNA 5CUCA 5C89A 3HMHA 5EICA 2RFJA 4QSUA 2DVSA 4LRGA 3U5LA 4NRBA 4IOQA 4AKNA 4MEPA 4NR9A 4CUUA 5F60A 5E0RA 2MJVB 5II1A 3RCWA 4UIWA 3Q2EA 5HRXA 4QBMA 4QSWA 2YEKA 4LC2A 4RVRA 5FE2A 5D0CA 5E74A 3O33A 4TT2A 5H1VA 5D24A 4QSSA 2YELA 5CTLA 4MEQA 5ENEA 5C8GA 2I8NA 5TB6A 4A9JA 3HMEA 4N4HA 5HEMA 4LYWA 5FE1A 4PY6A 4QC1A 4XYAA 4YY6A 4UYEA 5CQ5A 5C87A 4C66A 5HLSA 2LSPB 5DYXA 4BJXA 4A9MA 5L98A 5C4QA 3HMFA 4QSXA 4TTEA 5A85A 2RS9B 3U5JA 2E7NA 1X0JA 5DLXA 2F6JA 5DYUA 3MULA 5DKDA 5HELA 5CUDA 5CUAA 5I88A 3QZSA 4QNSA 5D3HA 5LJ1A 4CUPA 4QSQA 5D3PA 5EWDA 4YYNA 1JM4B 4YAXA 4X2IA 3O35A 3SVGA 4NR7A 4LZRA 3P5OA 4AKGA 3MXFA 4Y03A 5II2A 4QR4A 4TU4A 5E73A 2R10A 5J0DA 5HQ6A 5FH7A 5HQ7A 4UYGA 5D26A 5F62A 5CZGA 4YK0A 5HJCA 5C85A 5AMFA 5CQ8A 3D7CA 3D1DA 5DLZA 5ETBA 4NRCA 3QZVA 4O7CA 5HENA 5EWHA 2R0YA 5FB1A 5CUGA 4UITA 4ZW1A 1N72A 4NS5A 5EGUA 5L96A 5ENBA 3U5KA 5EP7A 5HRWA 5CPEA 4CFKA 4MR5A 4PKLA 5F25A 5A5PA 5A5SA 4BW3A 4LR6A 4CFLA 4A9IA 4TQNA 4NRAA 3LQIA 4N4FA 4NYWA 5D7XA 4QZSA 3GG3A
chains in the Genus database with same CATH topology
5LVQA 5BT5A 5FH8A 3UW9A 4ZC9A 5EA1A 4YYGA 3U5OA 5EVAA 1ZS5A 4QUTA 4O76A 5IGLA 4NYXA 4Z6HA 4TYLA 4CURA 3MUKA 4MR6A 3MB3A 4QB3A 5CRMA 2D9EA 5ENIA 4Z6IA 4LDFA 4TT6A 4TU6A 4NUEA 4QSPA 2N9GA 5CY9A 2I7KA 5AD3A 4GPJA 4A9FA 4LZSA 4MEOA 4HXPA 4MR3A 5CRZA 5A5NA 4YYDA 3IU6A 5FG6A 5FE5A 4O7AA 5EV9A 5CQAA 5FBXA 4XY8A 5DYCA 4A9OA 4XUBA 3IU5A 4IOOA 4IR5A 5FG5A 2R0VA 5CFWA 5A5OA 3UVYA 5FE7A 5KU3A 5FE3A 4Z1QA 5E9VA 5F63A 4O75A 4QEUA 5D3SA 5FDZA 5EK9A 4E96A 5E9LA 3UVWA 1JSPB 4YYIA 3AQAA 4O78A 4J1PA 4C67A 5EWCA 4QR3A 4YATA 5EU1A 4N3WA 5CGPA 5F5ZA 4LZ2A 3DWYA 4PTBA 4F3IA 4YYHA 5IIDA 2KTBB 3FKMX 5D3RA 3JVKA 4HBVA 4OGJA 4O70A 5A83A 2DKWA 3UV5A 3O34A 3SVHA 2OSSA 4NYVA 1EQFA 5EPBA 4NR6A 4A9HA 5AD2A 4YYMA 5HCLA 5E9MA 4KCXA 5FFWA 5I83A 4O7EA 5FFVA 4CUSA 4Z93A 3P1DA 3JVJA 5D25A 4YYJA 5E9KA 4QC3A 5A82A 5ENCA 5EI4A 2RNYA 5FE4A 4Z1SA 5LKZA 5F1LA 2YQDA 3I3JA 5CUEA 5FFYA 2RNWA 4HXLA 5D3TA 5HM0A 4BW4A 3S92A 4N4GA 4BHWA 4YBSA 4UYDA 2DVVA 5A5RA 5G4RA 2GRCA 4PCIA 5DKHA 5I40A 4XY9A 2RO1A 4HXMA 4A9NA 3G0LA 5KTXA 4CUTA 2RNXA 5E3DA 4ALHA 4PS5A 5IG6A 5HQ5A 5DX4A 4QEWA 5A5QA 4MENA 4NR4A 5CU8A 2H60A 2F6NA 3Q2FA 5LKTA 5FE0A 3UVXA 3G0JA 2L84A 4O7BA 5FE6A 4MR4A 4TZ8A 2RI7A 5I7XA 4KV4A 4XUAA 4QEVA 1E6IA 4UIYA 4NR5A 5I86A 4UYFA 4IR4A 5TCMA 4IR3A 3ONIA 4J0RA 5CQ3A 4HBXA 4NUCA 5IGKA 5ENHA 5EWWA 2E7OA 5F61A 3DAIA 5D3JA 3LXJA 4WHWA 5D3LA 4Q0OA 2L5EA 5F36A 2G4AA 2DATA 3U5PA 5KHMA 4WHUA 5KO4A 5EM3A 3O36A 4O71A 5ETDA 5KTUA 4YH3A 1F68A 4HXSA 5H1TA 5I7YA 4UIVA 5H85A 5L97A 2DVQA 4PCEA 2OO1A 4NUDA 4QSTA 4LYIA 4TT4A 4ZQLA 4YABA 4NXJA 5G4SA 5E7DA 4YBMA 5I89A 2YDWA 2DWWA 5FB0A 5A7CA 4WIVA 5I1QA 5LJ2A 5DFCA 2E3KA 5JI8A 5I80A 1WUGA 4O77A 5IBNA 3AADA 5HRVA 4QY4A 5LKXA 2FSAA 2R0SA 5A81A 4QYDA 5BT4A 4CUQA 5KTWA 3P1CA 4FLPA 4IORA 5CUBA 4J3IA 5ENGA 3S91A 5ENFA 5CP5A 3ZYUA 3LJWA 3P1EA 2DVRA 4UYHA 5LVRA 4HXNA 4TZ2A 4DONA 4ALGA 5DBMA 5DFDA 5COIA 4QYLA 5FG4A 4OGIA 5DY7A 3U5NA 5K29A 4QUUA 4YY4A 4Q0NA 5IGNA 5E9YA 5FE9A 2L85A 3SVFA 5F3AA 4A9KA 5D3NA 5JWMA 3K2JA 5L8UA 5CQ6A 2OUOA 3UVDA 4O72A 5ACYA 5L8TA 4QSVA 3O37A 5EISA 4HBWA 4UIZA 5E3GA 5DFBA 2YEMA 5LJ0A 4N4IA 5C7NA 4HBYA 4UIXA 5IGMA 5FH6A 5F2PA 3UV4A 5ENJA 4UIUA 3LQJA 5CQTA 5LUUA 3P1FA 4NR8A 1WUMA 4HXOA 4CLBA 5EWVA 3TLPA 4BW2A 3U5MA 4TS8A 5FE8A 5DW2A 4LYSA 4HXKA 5AMEA 3MQMA 4IR6A 4HXRA 4J0SA 4OUFA 5DW1A 5I29A 2YYNA 4YBTA 5LKUA 4O7FA 3MB4A 4YH4A 4KV1A 5EQ1A 5E9IA 4O74A 2WP1A 4QSRA 3NXBA 4QR5A 4YADA 2D82A 5EPSA 5EPRA 4CL9A 5HFRA 5DYAA 4BW1A 2WP2A 4UYFB 3QZTA 4YC9A 5CS8A 3JVMA 5BT3A 5CQ7A 3LQHA 4NQMA 4A9EA 4A9LA 3JVLA 4YYKA 3UV2A 2NXBA 5DKCA 5HFQA 2YW5A 5H1UA 5CQ4A 5L99A 5F1HA 4NQNA 5CUCA 5C89A 3HMHA 5EICA 2RFJA 4QSUA 2DVSA 4LRGA 3U5LA 4NRBA 4IOQA 4AKNA 4MEPA 4NR9A 4CUUA 5F60A 5E0RA 2MJVB 5II1A 3RCWA 4UIWA 3Q2EA 5HRXA 4QBMA 4QSWA 2YEKA 4LC2A 4RVRA 5FE2A 5D0CA 5E74A 3O33A 4TT2A 5H1VA 5D24A 4QSSA 2YELA 5CTLA 4MEQA 5ENEA 5C8GA 2I8NA 5TB6A 4A9JA 3HMEA 4N4HA 5HEMA 4LYWA 5FE1A 4PY6A 4QC1A 4XYAA 4YY6A 4UYEA 5CQ5A 5C87A 4C66A 5HLSA 2LSPB 5DYXA 4BJXA 4A9MA 5L98A 5C4QA 3HMFA 4QSXA 4TTEA 5A85A 2RS9B 3U5JA 2E7NA 1X0JA 5DLXA 2F6JA 5DYUA 3MULA 5DKDA 5HELA 5CUDA 5CUAA 5I88A 3QZSA 4QNSA 5D3HA 5LJ1A 4CUPA 4QSQA 5D3PA 5EWDA 4YYNA 1JM4B 4YAXA 4X2IA 3O35A 3SVGA 4NR7A 4LZRA 3P5OA 3MXFA 4Y03A 5II2A 4QR4A 4TU4A 5E73A 2R10A 5J0DA 5HQ6A 5FH7A 5HQ7A 4UYGA 5D26A 5F62A 5CZGA 4YK0A 5HJCA 5C85A 5AMFA 5CQ8A 3D7CA 5DLZA 5ETBA 4NRCA 3QZVA 4O7CA 5HENA 5EWHA 2R0YA 5FB1A 5CUGA 4UITA 4ZW1A 1N72A 4NS5A 5EGUA 5L96A 5ENBA 3U5KA 5EP7A 5HRWA 5CPEA 4CFKA 4MR5A 4PKLA 5F25A 5A5PA 5A5SA 4BW3A 4LR6A 4CFLA 4A9IA 4TQNA 4NRAA 3LQIA 4N4FA 4NYWA 5D7XA 4QZSA 3GG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LVQ A;  5BT5 A;  5FH8 A;  3UW9 A;  4ZC9 A;  5EA1 A;  4YYG A;  3U5O A;  5EVA A;  1ZS5 A;  4QUT A;  4O76 A;  5IGL A;  4NYX A;  4Z6H A;  4TYL A;  4CUR A;  3MUK A;  4MR6 A;  3MB3 A;  4QB3 A;  5CRM A;  2D9E A;  5ENI A;  4Z6I A;  4LDF A;  4TT6 A;  4TU6 A;  4NUE A;  4QSP A;  2N9G A;  5CY9 A;  2I7K A;  5AD3 A;  4GPJ A;  4A9F A;  4LZS A;  4MEO A;  4HXP A;  4MR3 A;  5CRZ A;  5A5N A;  4YYD A;  3IU6 A;  5FG6 A;  5FE5 A;  4O7A A;  5EV9 A;  5CQA A;  5FBX A;  4XY8 A;  5DYC A;  4A9O A;  4XUB A;  3IU5 A;  4IOO A;  4IR5 A;  5FG5 A;  2R0V A;  5CFW A;  5A5O A;  3UVY A;  5FE7 A;  5KU3 A;  5FE3 A;  4Z1Q A;  5E9V A;  5F63 A;  4O75 A;  4QEU A;  5D3S A;  5FDZ A;  5EK9 A;  4E96 A;  5E9L A;  3UVW A;  1JSP B;  4YYI A;  3AQA A;  4O78 A;  4J1P A;  4C67 A;  5EWC A;  4QR3 A;  4YAT A;  5EU1 A;  4N3W A;  5CGP A;  5F5Z A;  4LZ2 A;  3DWY A;  4PTB A;  4F3I A;  4YYH A;  5IID A;  2KTB B;  3FKM X;  5D3R A;  3JVK A;  4HBV A;  4OGJ A;  4O70 A;  5A83 A;  2DKW A;  3UV5 A;  3O34 A;  3SVH A;  2OSS A;  4NYV A;  1EQF A;  5EPB A;  4NR6 A;  4A9H A;  5AD2 A;  4YYM A;  5HCL A;  5E9M A;  4KCX A;  5FFW A;  5I83 A;  4O7E A;  5FFV A;  4CUS A;  4Z93 A;  3P1D A;  3JVJ A;  5D25 A;  4YYJ A;  5E9K A;  4QC3 A;  5A82 A;  5ENC A;  5EI4 A;  2RNY A;  5FE4 A;  4Z1S A;  5LKZ A;  5F1L A;  2YQD A;  3I3J A;  5CUE A;  5FFY A;  2RNW A;  4HXL A;  5D3T A;  5HM0 A;  4BW4 A;  3S92 A;  4N4G A;  4BHW A;  4YBS A;  4UYD A;  2DVV A;  5A5R A;  5G4R A;  2GRC A;  4PCI A;  5DKH A;  5I40 A;  4XY9 A;  2RO1 A;  4HXM A;  4A9N A;  3G0L A;  5KTX A;  4CUT A;  2RNX A;  5E3D A;  4ALH A;  4PS5 A;  5IG6 A;  5HQ5 A;  5DX4 A;  4QEW A;  5A5Q A;  4MEN A;  4NR4 A;  5CU8 A;  2H60 A;  2F6N A;  3Q2F A;  5LKT A;  5FE0 A;  3UVX A;  3G0J A;  2L84 A;  4O7B A;  5FE6 A;  4MR4 A;  4TZ8 A;  2RI7 A;  5I7X A;  4KV4 A;  4XUA A;  4QEV A;  1E6I A;  4UIY A;  4NR5 A;  5I86 A;  4UYF A;  4IR4 A;  5TCM A;  4IR3 A;  3ONI A;  4J0R A;  5CQ3 A;  4HBX A;  4NUC A;  5IGK A;  5ENH A;  5EWW A;  2E7O A;  5F61 A;  3DAI A;  5D3J A;  3LXJ A;  4WHW A;  5D3L A;  4Q0O A;  2L5E A;  5F36 A;  2G4A A;  2DAT A;  3U5P A;  5KHM A;  4WHU A;  5KO4 A;  5EM3 A;  3O36 A;  4O71 A;  5ETD A;  5KTU A;  4YH3 A;  1F68 A;  4HXS A;  5H1T A;  5I7Y A;  4UIV A;  5H85 A;  5L97 A;  2DVQ A;  4PCE A;  2OO1 A;  4NUD A;  4QST A;  4LYI A;  4TT4 A;  4ZQL A;  4YAB A;  4NXJ A;  5G4S A;  5E7D A;  4YBM A;  5I89 A;  2YDW A;  2DWW A;  5FB0 A;  5A7C A;  4WIV A;  5I1Q A;  5LJ2 A;  5DFC A;  2E3K A;  5JI8 A;  5I80 A;  1WUG A;  4O77 A;  5IBN A;  3AAD A;  5HRV A;  4QY4 A;  5LKX A;  2FSA A;  2R0S A;  5A81 A;  4QYD A;  5BT4 A;  4CUQ A;  5KTW A;  3P1C A;  4FLP A;  4IOR A;  5CUB A;  4J3I A;  5ENG A;  3S91 A;  5ENF A;  5CP5 A;  3ZYU A;  3LJW A;  3P1E A;  2DVR A;  4UYH A;  5LVR A;  4HXN A;  4TZ2 A;  4DON A;  4ALG A;  5DBM A;  5DFD A;  5COI A;  4QYL A;  5FG4 A;  4OGI A;  5DY7 A;  3U5N A;  5K29 A;  4QUU A;  4YY4 A;  4Q0N A;  5IGN A;  5E9Y A;  5FE9 A;  2L85 A;  3SVF A;  5F3A A;  4A9K A;  5D3N A;  5JWM A;  3K2J A;  5L8U A;  5CQ6 A;  2OUO A;  3UVD A;  4O72 A;  5ACY A;  5L8T A;  4QSV A;  3O37 A;  5EIS A;  4HBW A;  4UIZ A;  5E3G A;  5DFB A;  2YEM A;  5LJ0 A;  4N4I A;  5C7N A;  4HBY A;  4UIX A;  5IGM A;  5FH6 A;  5F2P A;  3UV4 A;  5ENJ A;  4UIU A;  3LQJ A;  5CQT A;  5LUU A;  3P1F A;  4NR8 A;  1WUM A;  4HXO A;  4CLB A;  5EWV A;  3TLP A;  4BW2 A;  3U5M A;  4TS8 A;  5FE8 A;  5DW2 A;  4LYS A;  4HXK A;  5AME A;  3MQM A;  4IR6 A;  4HXR A;  4J0S A;  4OUF A;  5DW1 A;  5I29 A;  2YYN A;  4YBT A;  5LKU A;  4O7F A;  3MB4 A;  4YH4 A;  4KV1 A;  5EQ1 A;  5E9I A;  4O74 A;  2WP1 A;  4QSR A;  3NXB A;  4QR5 A;  4YAD A;  2D82 A;  5EPS A;  5EPR A;  4CL9 A;  5HFR A;  5DYA A;  4BW1 A;  2WP2 A;  4UYF B;  3QZT A;  4YC9 A;  5CS8 A;  3JVM A;  5BT3 A;  5CQ7 A;  3LQH A;  4NQM A;  4A9E A;  4A9L A;  3JVL A;  4YYK A;  3UV2 A;  2NXB A;  5DKC A;  5HFQ A;  2YW5 A;  5H1U A;  5CQ4 A;  5L99 A;  5F1H A;  4NQN A;  5CUC A;  5C89 A;  3HMH A;  5EIC A;  2RFJ A;  4QSU A;  2DVS A;  4LRG A;  3U5L A;  4NRB A;  4IOQ A;  4AKN A;  4MEP A;  4NR9 A;  4CUU A;  5F60 A;  5E0R A;  2MJV B;  5II1 A;  3RCW A;  4UIW A;  3Q2E A;  5HRX A;  4QBM A;  4QSW A;  2YEK A;  4LC2 A;  4RVR A;  5FE2 A;  5D0C A;  5E74 A;  3O33 A;  4TT2 A;  5H1V A;  5D24 A;  4QSS A;  2YEL A;  5CTL A;  4MEQ A;  5ENE A;  5C8G A;  2I8N A;  5TB6 A;  4A9J A;  3HME A;  4N4H A;  5HEM A;  4LYW A;  5FE1 A;  4PY6 A;  4QC1 A;  4XYA A;  4YY6 A;  4UYE A;  5CQ5 A;  5C87 A;  4C66 A;  5HLS A;  2LSP B;  5DYX A;  4BJX A;  4A9M A;  5L98 A;  5C4Q A;  3HMF A;  4QSX A;  4TTE A;  5A85 A;  2RS9 B;  3U5J A;  2E7N A;  1X0J A;  5DLX A;  2F6J A;  5DYU A;  3MUL A;  5DKD A;  5HEL A;  5CUD A;  5CUA A;  5I88 A;  3QZS A;  4QNS A;  5D3H A;  5LJ1 A;  4CUP A;  4QSQ A;  5D3P A;  5EWD A;  4YYN A;  1JM4 B;  4YAX A;  4X2I A;  3O35 A;  3SVG A;  4NR7 A;  4LZR A;  3P5O A;  3MXF A;  4Y03 A;  5II2 A;  4QR4 A;  4TU4 A;  5E73 A;  2R10 A;  5J0D A;  5HQ6 A;  5FH7 A;  5HQ7 A;  4UYG A;  5D26 A;  5F62 A;  5CZG A;  4YK0 A;  5HJC A;  5C85 A;  5AMF A;  5CQ8 A;  3D7C A;  5DLZ A;  5ETB A;  4NRC A;  3QZV A;  4O7C A;  5HEN A;  5EWH A;  2R0Y A;  5FB1 A;  5CUG A;  4UIT A;  4ZW1 A;  1N72 A;  4NS5 A;  5EGU A;  5L96 A;  5ENB A;  3U5K A;  5EP7 A;  5HRW A;  5CPE A;  4CFK A;  4MR5 A;  4PKL A;  5F25 A;  5A5P A;  5A5S A;  4BW3 A;  4LR6 A;  4CFL A;  4A9I A;  4TQN A;  4NRA A;  3LQI A;  4N4F A;  4NYW A;  5D7X A;  4QZS A;  3GG3 A; 
#chains in the Genus database with same CATH topology
 5LVQ A;  5BT5 A;  5FH8 A;  3UW9 A;  4ZC9 A;  5EA1 A;  4YYG A;  3U5O A;  5EVA A;  1ZS5 A;  4QUT A;  4O76 A;  5IGL A;  4NYX A;  4Z6H A;  4TYL A;  4CUR A;  4AKI A;  3MUK A;  4MR6 A;  3MB3 A;  4QB3 A;  5CRM A;  2D9E A;  5ENI A;  4Z6I A;  4LDF A;  4TT6 A;  4TU6 A;  4NUE A;  4QSP A;  2N9G A;  5CY9 A;  2I7K A;  5AD3 A;  4GPJ A;  4A9F A;  4LZS A;  4MEO A;  4HXP A;  4MR3 A;  5CRZ A;  5A5N A;  4YYD A;  3IU6 A;  5FG6 A;  5FE5 A;  4O7A A;  5EV9 A;  5CQA A;  5FBX A;  4XY8 A;  5DYC A;  4A9O A;  4XUB A;  3IU5 A;  4IOO A;  4IR5 A;  5FG5 A;  2R0V A;  5CFW A;  5A5O A;  3UVY A;  5FE7 A;  5KU3 A;  5FE3 A;  4Z1Q A;  5E9V A;  5F63 A;  4O75 A;  4QEU A;  3ERR A;  5D3S A;  5FDZ A;  5EK9 A;  4E96 A;  5E9L A;  3UVW A;  1JSP B;  4YYI A;  3AQA A;  4O78 A;  4J1P A;  4C67 A;  5EWC A;  3VKH A;  4QR3 A;  4YAT A;  5EU1 A;  4N3W A;  5CGP A;  5F5Z A;  4LZ2 A;  3DWY A;  4PTB A;  4F3I A;  4YYH A;  5IID A;  2KTB B;  3FKM X;  5D3R A;  3JVK A;  4HBV A;  4OGJ A;  4O70 A;  5A83 A;  2DKW A;  3UV5 A;  3O34 A;  3SVH A;  2OSS A;  4NYV A;  1EQF A;  5EPB A;  4NR6 A;  4A9H A;  5AD2 A;  4YYM A;  5HCL A;  5E9M A;  4KCX A;  5FFW A;  5I83 A;  4O7E A;  5FFV A;  4CUS A;  4Z93 A;  3P1D A;  3JVJ A;  5D25 A;  4YYJ A;  5E9K A;  4QC3 A;  5A82 A;  5ENC A;  5EI4 A;  2RNY A;  5FE4 A;  4Z1S A;  5LKZ A;  5F1L A;  2YQD A;  3I3J A;  5CUE A;  5FFY A;  2RNW A;  4HXL A;  5D3T A;  4AI6 A;  5HM0 A;  4BW4 A;  3S92 A;  4N4G A;  4BHW A;  4YBS A;  4UYD A;  2DVV A;  5A5R A;  5G4R A;  2GRC A;  4PCI A;  5DKH A;  5I40 A;  4XY9 A;  2RO1 A;  4HXM A;  4A9N A;  3G0L A;  5KTX A;  4CUT A;  2RNX A;  5E3D A;  4ALH A;  4PS5 A;  5IG6 A;  5HQ5 A;  5DX4 A;  4QEW A;  5A5Q A;  4MEN A;  4NR4 A;  5CU8 A;  2H60 A;  2F6N A;  3Q2F A;  5LKT A;  5FE0 A;  3UVX A;  3G0J A;  2L84 A;  4O7B A;  5FE6 A;  4MR4 A;  4TZ8 A;  2RI7 A;  5I7X A;  4KV4 A;  4XUA A;  4QEV A;  1E6I A;  4UIY A;  4NR5 A;  5I86 A;  4UYF A;  4IR4 A;  5TCM A;  4IR3 A;  3ONI A;  4J0R A;  5CQ3 A;  4HBX A;  4NUC A;  5IGK A;  5ENH A;  5EWW A;  2E7O A;  1PUO A;  5F61 A;  3DAI A;  5D3J A;  3LXJ A;  4WHW A;  5D3L A;  4Q0O A;  2L5E A;  5F36 A;  2G4A A;  2DAT A;  3U5P A;  5KHM A;  4WHU A;  5KO4 A;  3VKG A;  5EM3 A;  3O36 A;  4O71 A;  5ETD A;  5KTU A;  4YH3 A;  1F68 A;  4HXS A;  5H1T A;  5I7Y A;  4UIV A;  5H85 A;  5L97 A;  2DVQ A;  1ZKR A;  4PCE A;  2OO1 A;  4NUD A;  4QST A;  4LYI A;  4TT4 A;  4ZQL A;  4YAB A;  4NXJ A;  5G4S A;  5E7D A;  4YBM A;  5I89 A;  2YDW A;  2DWW A;  5FB0 A;  5A7C A;  4WIV A;  5I1Q A;  5LJ2 A;  5DFC A;  2E3K A;  5JI8 A;  5I80 A;  1WUG A;  4O77 A;  5IBN A;  3AAD A;  5HRV A;  4QY4 A;  5LKX A;  2FSA A;  2R0S A;  5A81 A;  4QYD A;  5BT4 A;  4CUQ A;  3D1B A;  5KTW A;  3P1C A;  4FLP A;  4IOR A;  5CUB A;  4J3I A;  5ENG A;  3S91 A;  5ENF A;  5CP5 A;  3ZYU A;  3LJW A;  3P1E A;  2DVR A;  4UYH A;  5LVR A;  4HXN A;  4TZ2 A;  4DON A;  4ALG A;  5DBM A;  5DFD A;  5COI A;  4QYL A;  5FG4 A;  4OGI A;  5DY7 A;  3U5N A;  5K29 A;  4QUU A;  4YY4 A;  4Q0N A;  5IGN A;  5E9Y A;  5FE9 A;  2L85 A;  3SVF A;  5F3A A;  4A9K A;  5D3N A;  5JWM A;  3K2J A;  5L8U A;  5CQ6 A;  2OUO A;  3UVD A;  4O72 A;  5ACY A;  2EJN A;  5L8T A;  4QSV A;  3O37 A;  5EIS A;  4HBW A;  4UIZ A;  5E3G A;  5DFB A;  2YEM A;  5LJ0 A;  4N4I A;  5C7N A;  4HBY A;  4UIX A;  5IGM A;  5FH6 A;  4AKH A;  5F2P A;  3UV4 A;  5ENJ A;  4UIU A;  3LQJ A;  5CQT A;  5LUU A;  3P1F A;  4NR8 A;  1WUM A;  4HXO A;  4CLB A;  5EWV A;  3TLP A;  4BW2 A;  3U5M A;  4TS8 A;  5FE8 A;  5DW2 A;  4LYS A;  4HXK A;  5AME A;  3MQM A;  4IR6 A;  4HXR A;  4J0S A;  4OUF A;  5DW1 A;  5I29 A;  2YYN A;  4YBT A;  5LKU A;  4O7F A;  3MB4 A;  4YH4 A;  4KV1 A;  5EQ1 A;  5E9I A;  4O74 A;  2WP1 A;  4QSR A;  3NXB A;  4QR5 A;  4YAD A;  2D82 A;  5EPS A;  5EPR A;  4CL9 A;  5HFR A;  5DYA A;  4BW1 A;  2WP2 A;  4UYF B;  3QZT A;  4YC9 A;  5CS8 A;  3JVM A;  5BT3 A;  5CQ7 A;  3LQH A;  4NQM A;  4A9E A;  4A9L A;  3JVL A;  4YYK A;  3UV2 A;  2NXB A;  5DKC A;  5HFQ A;  2YW5 A;  5H1U A;  5CQ4 A;  5L99 A;  5F1H A;  4NQN A;  5CUC A;  5C89 A;  3HMH A;  5EIC A;  2RFJ A;  4QSU A;  2DVS A;  4LRG A;  3U5L A;  4NRB A;  4IOQ A;  4AKN A;  4MEP A;  4NR9 A;  4CUU A;  5F60 A;  5E0R A;  2MJV B;  5II1 A;  3RCW A;  4UIW A;  3Q2E A;  5HRX A;  4QBM A;  4QSW A;  2YEK A;  4LC2 A;  4RVR A;  5FE2 A;  5D0C A;  5E74 A;  3O33 A;  4TT2 A;  5H1V A;  5D24 A;  4QSS A;  2YEL A;  5CTL A;  4MEQ A;  5ENE A;  5C8G A;  2I8N A;  5TB6 A;  4A9J A;  3HME A;  4N4H A;  5HEM A;  4LYW A;  5FE1 A;  4PY6 A;  4QC1 A;  4XYA A;  4YY6 A;  4UYE A;  5CQ5 A;  5C87 A;  4C66 A;  5HLS A;  2LSP B;  5DYX A;  4BJX A;  4A9M A;  5L98 A;  5C4Q A;  3HMF A;  4QSX A;  4TTE A;  5A85 A;  2RS9 B;  3U5J A;  2E7N A;  1X0J A;  5DLX A;  2F6J A;  5DYU A;  3MUL A;  5DKD A;  5HEL A;  5CUD A;  5CUA A;  5I88 A;  3QZS A;  4QNS A;  5D3H A;  5LJ1 A;  4CUP A;  4QSQ A;  5D3P A;  5EWD A;  4YYN A;  1JM4 B;  4YAX A;  4X2I A;  3O35 A;  3SVG A;  4NR7 A;  4LZR A;  3P5O A;  4AKG A;  3MXF A;  4Y03 A;  5II2 A;  4QR4 A;  4TU4 A;  5E73 A;  2R10 A;  5J0D A;  5HQ6 A;  5FH7 A;  5HQ7 A;  4UYG A;  5D26 A;  5F62 A;  5CZG A;  4YK0 A;  5HJC A;  5C85 A;  5AMF A;  5CQ8 A;  3D7C A;  3D1D A;  5DLZ A;  5ETB A;  4NRC A;  3QZV A;  4O7C A;  5HEN A;  5EWH A;  2R0Y A;  5FB1 A;  5CUG A;  4UIT A;  4ZW1 A;  1N72 A;  4NS5 A;  5EGU A;  5L96 A;  5ENB A;  3U5K A;  5EP7 A;  5HRW A;  5CPE A;  4CFK A;  4MR5 A;  4PKL A;  5F25 A;  5A5P A;  5A5S A;  4BW3 A;  4LR6 A;  4CFL A;  4A9I A;  4TQN A;  4NRA A;  3LQI A;  4N4F A;  4NYW A;  5D7X A;  4QZS A;  3GG3 A; 
#chains in the Genus database with same CATH homology
 5LVQ A;  5BT5 A;  5FH8 A;  3UW9 A;  4ZC9 A;  5EA1 A;  4YYG A;  3U5O A;  5EVA A;  1ZS5 A;  4QUT A;  4O76 A;  5IGL A;  4NYX A;  4Z6H A;  4TYL A;  4CUR A;  3MUK A;  4MR6 A;  3MB3 A;  4QB3 A;  5CRM A;  2D9E A;  5ENI A;  4Z6I A;  4LDF A;  4TT6 A;  4TU6 A;  4NUE A;  4QSP A;  2N9G A;  5CY9 A;  2I7K A;  5AD3 A;  4GPJ A;  4A9F A;  4LZS A;  4MEO A;  4HXP A;  4MR3 A;  5CRZ A;  5A5N A;  4YYD A;  3IU6 A;  5FG6 A;  5FE5 A;  4O7A A;  5EV9 A;  5CQA A;  5FBX A;  4XY8 A;  5DYC A;  4A9O A;  4XUB A;  3IU5 A;  4IOO A;  4IR5 A;  5FG5 A;  2R0V A;  5CFW A;  5A5O A;  3UVY A;  5FE7 A;  5KU3 A;  5FE3 A;  4Z1Q A;  5E9V A;  5F63 A;  4O75 A;  4QEU A;  5D3S A;  5FDZ A;  5EK9 A;  4E96 A;  5E9L A;  3UVW A;  1JSP B;  4YYI A;  3AQA A;  4O78 A;  4J1P A;  4C67 A;  5EWC A;  4QR3 A;  4YAT A;  5EU1 A;  4N3W A;  5CGP A;  5F5Z A;  4LZ2 A;  3DWY A;  4PTB A;  4F3I A;  4YYH A;  5IID A;  2KTB B;  3FKM X;  5D3R A;  3JVK A;  4HBV A;  4OGJ A;  4O70 A;  5A83 A;  2DKW A;  3UV5 A;  3O34 A;  3SVH A;  2OSS A;  4NYV A;  1EQF A;  5EPB A;  4NR6 A;  4A9H A;  5AD2 A;  4YYM A;  5HCL A;  5E9M A;  4KCX A;  5FFW A;  5I83 A;  4O7E A;  5FFV A;  4CUS A;  4Z93 A;  3P1D A;  3JVJ A;  5D25 A;  4YYJ A;  5E9K A;  4QC3 A;  5A82 A;  5ENC A;  5EI4 A;  2RNY A;  5FE4 A;  4Z1S A;  5LKZ A;  5F1L A;  2YQD A;  3I3J A;  5CUE A;  5FFY A;  2RNW A;  4HXL A;  5D3T A;  5HM0 A;  4BW4 A;  3S92 A;  4N4G A;  4BHW A;  4YBS A;  4UYD A;  2DVV A;  5A5R A;  5G4R A;  2GRC A;  4PCI A;  5DKH A;  5I40 A;  4XY9 A;  2RO1 A;  4HXM A;  4A9N A;  3G0L A;  5KTX A;  4CUT A;  2RNX A;  5E3D A;  4ALH A;  4PS5 A;  5IG6 A;  5HQ5 A;  5DX4 A;  4QEW A;  5A5Q A;  4MEN A;  4NR4 A;  5CU8 A;  2H60 A;  2F6N A;  3Q2F A;  5LKT A;  5FE0 A;  3UVX A;  3G0J A;  2L84 A;  4O7B A;  5FE6 A;  4MR4 A;  4TZ8 A;  2RI7 A;  5I7X A;  4KV4 A;  4XUA A;  4QEV A;  1E6I A;  4UIY A;  4NR5 A;  5I86 A;  4UYF A;  4IR4 A;  5TCM A;  4IR3 A;  3ONI A;  4J0R A;  5CQ3 A;  4HBX A;  4NUC A;  5IGK A;  5ENH A;  5EWW A;  2E7O A;  5F61 A;  3DAI A;  5D3J A;  3LXJ A;  4WHW A;  5D3L A;  4Q0O A;  2L5E A;  5F36 A;  2G4A A;  2DAT A;  3U5P A;  5KHM A;  4WHU A;  5KO4 A;  5EM3 A;  3O36 A;  4O71 A;  5ETD A;  5KTU A;  4YH3 A;  1F68 A;  4HXS A;  5H1T A;  5I7Y A;  4UIV A;  5H85 A;  5L97 A;  2DVQ A;  4PCE A;  2OO1 A;  4NUD A;  4QST A;  4LYI A;  4TT4 A;  4ZQL A;  4YAB A;  4NXJ A;  5G4S A;  5E7D A;  4YBM A;  5I89 A;  2YDW A;  2DWW A;  5FB0 A;  5A7C A;  4WIV A;  5I1Q A;  5LJ2 A;  5DFC A;  2E3K A;  5JI8 A;  5I80 A;  1WUG A;  4O77 A;  5IBN A;  3AAD A;  5HRV A;  4QY4 A;  5LKX A;  2FSA A;  2R0S A;  5A81 A;  4QYD A;  5BT4 A;  4CUQ A;  5KTW A;  3P1C A;  4FLP A;  4IOR A;  5CUB A;  4J3I A;  5ENG A;  3S91 A;  5ENF A;  5CP5 A;  3ZYU A;  3LJW A;  3P1E A;  2DVR A;  4UYH A;  5LVR A;  4HXN A;  4TZ2 A;  4DON A;  4ALG A;  5DBM A;  5DFD A;  5COI A;  4QYL A;  5FG4 A;  4OGI A;  5DY7 A;  3U5N A;  5K29 A;  4QUU A;  4YY4 A;  4Q0N A;  5IGN A;  5E9Y A;  5FE9 A;  2L85 A;  3SVF A;  5F3A A;  4A9K A;  5D3N A;  5JWM A;  3K2J A;  5L8U A;  5CQ6 A;  2OUO A;  3UVD A;  4O72 A;  5ACY A;  5L8T A;  4QSV A;  3O37 A;  5EIS A;  4HBW A;  4UIZ A;  5E3G A;  5DFB A;  2YEM A;  5LJ0 A;  4N4I A;  5C7N A;  4HBY A;  4UIX A;  5IGM A;  5FH6 A;  5F2P A;  3UV4 A;  5ENJ A;  4UIU A;  3LQJ A;  5CQT A;  5LUU A;  3P1F A;  4NR8 A;  1WUM A;  4HXO A;  4CLB A;  5EWV A;  3TLP A;  4BW2 A;  3U5M A;  4TS8 A;  5FE8 A;  5DW2 A;  4LYS A;  4HXK A;  5AME A;  3MQM A;  4IR6 A;  4HXR A;  4J0S A;  4OUF A;  5DW1 A;  5I29 A;  2YYN A;  4YBT A;  5LKU A;  4O7F A;  3MB4 A;  4YH4 A;  4KV1 A;  5EQ1 A;  5E9I A;  4O74 A;  2WP1 A;  4QSR A;  3NXB A;  4QR5 A;  4YAD A;  2D82 A;  5EPS A;  5EPR A;  4CL9 A;  5HFR A;  5DYA A;  4BW1 A;  2WP2 A;  4UYF B;  3QZT A;  4YC9 A;  5CS8 A;  3JVM A;  5BT3 A;  5CQ7 A;  3LQH A;  4NQM A;  4A9E A;  4A9L A;  3JVL A;  4YYK A;  3UV2 A;  2NXB A;  5DKC A;  5HFQ A;  2YW5 A;  5H1U A;  5CQ4 A;  5L99 A;  5F1H A;  4NQN A;  5CUC A;  5C89 A;  3HMH A;  5EIC A;  2RFJ A;  4QSU A;  2DVS A;  4LRG A;  3U5L A;  4NRB A;  4IOQ A;  4AKN A;  4MEP A;  4NR9 A;  4CUU A;  5F60 A;  5E0R A;  2MJV B;  5II1 A;  3RCW A;  4UIW A;  3Q2E A;  5HRX A;  4QBM A;  4QSW A;  2YEK A;  4LC2 A;  4RVR A;  5FE2 A;  5D0C A;  5E74 A;  3O33 A;  4TT2 A;  5H1V A;  5D24 A;  4QSS A;  2YEL A;  5CTL A;  4MEQ A;  5ENE A;  5C8G A;  2I8N A;  5TB6 A;  4A9J A;  3HME A;  4N4H A;  5HEM A;  4LYW A;  5FE1 A;  4PY6 A;  4QC1 A;  4XYA A;  4YY6 A;  4UYE A;  5CQ5 A;  5C87 A;  4C66 A;  5HLS A;  2LSP B;  5DYX A;  4BJX A;  4A9M A;  5L98 A;  5C4Q A;  3HMF A;  4QSX A;  4TTE A;  5A85 A;  2RS9 B;  3U5J A;  2E7N A;  1X0J A;  5DLX A;  2F6J A;  5DYU A;  3MUL A;  5DKD A;  5HEL A;  5CUD A;  5CUA A;  5I88 A;  3QZS A;  4QNS A;  5D3H A;  5LJ1 A;  4CUP A;  4QSQ A;  5D3P A;  5EWD A;  4YYN A;  1JM4 B;  4YAX A;  4X2I A;  3O35 A;  3SVG A;  4NR7 A;  4LZR A;  3P5O A;  3MXF A;  4Y03 A;  5II2 A;  4QR4 A;  4TU4 A;  5E73 A;  2R10 A;  5J0D A;  5HQ6 A;  5FH7 A;  5HQ7 A;  4UYG A;  5D26 A;  5F62 A;  5CZG A;  4YK0 A;  5HJC A;  5C85 A;  5AMF A;  5CQ8 A;  3D7C A;  5DLZ A;  5ETB A;  4NRC A;  3QZV A;  4O7C A;  5HEN A;  5EWH A;  2R0Y A;  5FB1 A;  5CUG A;  4UIT A;  4ZW1 A;  1N72 A;  4NS5 A;  5EGU A;  5L96 A;  5ENB A;  3U5K A;  5EP7 A;  5HRW A;  5CPE A;  4CFK A;  4MR5 A;  4PKL A;  5F25 A;  5A5P A;  5A5S A;  4BW3 A;  4LR6 A;  4CFL A;  4A9I A;  4TQN A;  4NRA A;  3LQI A;  4N4F A;  4NYW A;  5D7X A;  4QZS A;  3GG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...