5FFVA

Crystal structure of the bromodomain of human brpf1 in complex with h3k14ac histone peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
111
structure length
111
Chain Sequence
QLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Peregrin
publication title Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone peptide
rcsb
source organism Homo sapiens
total genus 40
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ffvA00
2E7OA 4YH4A 5CY9A 5LKTA 4MENA 5FFVA 2F6NA 5EK9A 3UVDA 4NUEA 4QZSA 5HQ7A 4A9EA 3UV2A 2E7NA 5FE6A 5HM0A 4A9NA 4A9HA 5A85A 4HXOA 5LKUA 4WIVA 4N4HA 4LYSA 4BW4A 4C67A 4O76A 3UVXA 5EPRA 5A83A 4N4GA 5KO4A 5I89A 4O78A 4XYAA 4QEWA 5IBNA 4FLPA 5CQ6A 5II2A 4YYJA 2E3KA 2N9GA 4LR6A 5ACYA 2DATA 3GG3A 2YEKA 4QUTA 4UYGA 4UIYA 4YAXA 4Z6IA 5EA1A 5F5ZA 3U5OA 3O35A 5CGPA 4HXNA 5DLXA 4Z1QA 5LKZA 4F3IA 4OUFA 3SVGA 4NR8A 5EWCA 4LZSA 5D24A 5CQ8A 5FE1A 3LQHA 5DX4A 4HBYA 4YYGA 5H1VA 2DVRA 4CUQA 4HXRA 5EV9A 4LZ2A 1WUGA 4WHUA 5HCLA 5AMFA 5A7CA 5A5PA 4HBVA 5EICA 5DFCA 5JI8A 5L8TA 5CQ3A 5I86A 4YYDA 5COIA 5D0CA 5DLZA 4YK0A 2DVSA 2R0VA 4YYKA 5D3TA 2KTBB 4NR6A 5CTLA 4A9LA 5A81A 4NYXA 5C85A 4J0RA 4TZ8A 4QEVA 2MJVB 5FFYA 5DY7A 3JVLA 5EWVA 5BT5A 5E3GA 4IR4A 3P5OA 3G0JA 1N72A 5EP7A 4BHWA 2L5EA 4YYNA 5E9VA 4CUUA 4A9KA 5CS8A 2G4AA 5FE9A 4QYLA 5D3PA 5E9LA 4LDFA 3DAIA 4QY4A 4NR7A 5CUEA 4Z1SA 5HEMA 3HMEA 5E0RA 4E96A 5CRMA 4OGJA 3P1CA 5CQAA 4TTEA 2OO1A 3LQJA 5BT4A 2OSSA 3RCWA 4QC1A 5F1HA 4A9OA 4A9FA 5DYCA 2I7KA 2RS9B 4LRGA 3U5LA 3U5MA 5D3NA 5E3DA 2WP2A 3MXFA 2OUOA 5CU8A 3Q2EA 5IG6A 4X2IA 4QSRA 1WUMA 4UIUA 4J3IA 1JM4B 4PY6A 4QR5A 2WP1A 3TLPA 5TB6A 3I3JA 5F2PA 5F62A 5HQ5A 2RI7A 4NQMA 3UV4A 5CQ4A 4YY4A 3AQAA 5C7NA 2LSPB 5H1UA 5D3SA 3DWYA 5CQ5A 4PKLA 5ENHA 5G4RA 4UYHA 4NRAA 4HXLA 4O72A 4UYFA 4NR9A 5L96A 3O34A 4QR3A 5ENFA 4CURA 4QR4A 5ETDA 4J0SA 5EGUA 4O74A 5DW2A 4BW1A 5DYUA 5CUAA 5LJ2A 5IGNA 2NXBA 3LQIA 4UIXA 4UIVA 4NRCA 4DONA 4YC9A 5L8UA 5FE2A 4O71A 4C66A 5D7XA 4QSQA 5LUUA 5E73A 4Y03A 4YY6A 5II1A 5H1TA 5EU1A 4TZ2A 5D3JA 4N4IA 4N3WA 4O7FA 4RVRA 4TT6A 4MR5A 3D7CA 5LJ0A 3NXBA 5D3HA 5CUBA 5AMEA 2RNYA 5D3LA 5F60A 5ENCA 3UVYA 5D3RA 4N4FA 4UIZA 4Q0NA 5DKDA 3SVFA 2RO1A 5HFRA 5L98A 5TCMA 4MEOA 3ZYUA 5JWMA 4KV4A 5HRXA 4QSWA 5KTUA 2YDWA 5E9YA 5IGKA 5EWWA 5HELA 5FE5A 5HQ6A 2YEMA 5D25A 2D9EA 4NYVA 5FBXA 4MR3A 4LZRA 5ENGA 4BW2A 3JVKA 2DVVA 4YABA 4QSXA 3O37A 4PCEA 5I40A 4KCXA 4TT4A 4YH3A 4NYWA 4QBMA 4UYEA 4QSUA 4PTBA 3LXJA 5EISA 3O33A 4IOQA 4TQNA 4UYDA 4HXMA 5HRVA 4CUTA 2YYNA 4YBSA 2GRCA 3MB4A 4NUDA 5DFDA 5CUCA 5L97A 5C8GA 4PCIA 4XY9A 4ALGA 5F63A 5FE4A 3U5NA 2YW5A 3MQMA 4TU6A 4CFLA 3UW9A 2R10A 4HXPA 2I8NA 4O75A 5BT3A 4GPJA 4NS5A 5E74A 5FE7A 4MR4A 4O7EA 4XY8A 3QZSA 5I7XA 3HMFA 2YELA 4QSTA 4Z93A 5EPSA 4ZW1A 5I1QA 5E7DA 5FG5A 4YBMA 5I88A 4TT2A 2R0SA 4YADA 5ETBA 4NR5A 5ENJA 5DYXA 4QC3A 1F68A 4A9MA 5FE3A 4A9JA 4CUPA 4NR4A 3SVHA 4J1PA 5CPEA 4O7CA 3O36A 5H85A 5I83A 4XUBA 5LKXA 5E9KA 4Q0OA 5ENIA 3IU5A 3G0LA 3U5JA 4O7AA 5DYAA 3UV5A 4NUCA 3U5KA 5KU3A 3IU6A 3U5PA 5F36A 2L85A 5E9IA 5EQ1A 5K29A 1JSPB 4OGIA 5F25A 5LVRA 5I7YA 5FH6A 5IGMA 5I29A 5DKHA 2DWWA 5A82A 2DVQA 4IOOA 2D82A 4QEUA 4UIWA 4YYHA 5CFWA 4ZQLA 4TU4A 4LC2A 2RNXA 5HJCA 5I80A 4LYIA 2L84A 5FB0A 3UVWA 5DBMA 2RFJA 5A5RA 4QSVA 4NRBA 5LVQA 4QSPA 2DKWA 3LJWA 5KTWA 4MEPA 5FG4A 5EM3A 5FH7A 4YATA 4IR6A 5HENA 5C87A 4HBXA 5EI4A 5IIDA 5CUGA 4HBWA 4CFKA 5D26A 5A5QA 2H60A 4O7BA 4QNSA 4WHWA 5CP5A 5FFWA 4AKNA 5FG6A 4TS8A 4KV1A 5CUDA 4YBTA 4IR3A 3P1EA 4LYWA 4UYFB 5A5SA 5C89A 5G4SA 5ENBA 4YYMA 5KHMA 4Z6HA 5KTXA 5ENEA 2R0YA 5LJ1A 4UITA 4O70A 5FB1A 2F6JA 4BW3A 3JVMA 4QSSA 5HFQA 5FDZA 5F61A 4YYIA 3AADA 4MR6A 3QZVA 1ZS5A 4IR5A 4CLBA 5J0DA 4QUUA 4XUAA 1E6IA 1EQFA 4PS5A 5F3AA 5AD3A 5HLSA 5FH8A 4QYDA 4BJXA 3HMHA 3QZTA 5EPBA 4TYLA 5EVAA 5CQTA 5IGLA 4CUSA 1X0JA 4NQNA 3Q2FA 4NXJA 3S92A 4O77A 4IORA 3P1FA 5EWDA 4A9IA 5A5NA 5AD2A 2YQDA 3MUKA 3ONIA 5DFBA 5E9MA 5HRWA 3FKMX 5EWHA 3JVJA 5F1LA 4HXKA 3P1DA 5CZGA 5CQ7A 5A5OA 5CRZA 3K2JA 3MULA 4QB3A 2FSAA 4MEQA 5DKCA 3MB3A 5C4QA 4ALHA 4ZC9A 5L99A 5FE0A 4HXSA 2RNWA 3S91A 4CL9A 5FE8A 5DW1A
chains in the Genus database with same CATH superfamily
2E7OA 4YH4A 5CY9A 5LKTA 4MENA 5FFVA 2F6NA 5EK9A 3UVDA 4NUEA 4QZSA 5HQ7A 4A9EA 3UV2A 2E7NA 5FE6A 5HM0A 4A9NA 4A9HA 5A85A 4HXOA 5LKUA 4AKGA 4WIVA 4N4HA 4LYSA 4BW4A 4C67A 4O76A 3UVXA 5EPRA 5A83A 4N4GA 5KO4A 5I89A 4O78A 4XYAA 4AKHA 4QEWA 5IBNA 4FLPA 5CQ6A 5II2A 4YYJA 2E3KA 2N9GA 4LR6A 5ACYA 2DATA 3GG3A 2YEKA 4QUTA 4UYGA 4UIYA 4YAXA 4Z6IA 5EA1A 5F5ZA 3U5OA 3O35A 5CGPA 4HXNA 5DLXA 4Z1QA 3VKGA 5LKZA 4F3IA 4OUFA 3SVGA 4NR8A 5EWCA 4LZSA 5D24A 5CQ8A 3ERRA 5FE1A 3LQHA 5DX4A 4HBYA 4YYGA 5H1VA 2DVRA 4CUQA 4HXRA 5EV9A 4LZ2A 1WUGA 4WHUA 5HCLA 5AMFA 5A7CA 5A5PA 4HBVA 5EICA 5DFCA 5JI8A 5L8TA 5CQ3A 5I86A 4YYDA 5COIA 5D0CA 5DLZA 4YK0A 2DVSA 2R0VA 4YYKA 5D3TA 2KTBB 4NR6A 5CTLA 4A9LA 5A81A 4NYXA 1PUOA 3VKHA 5C85A 4J0RA 4TZ8A 4QEVA 2MJVB 5FFYA 5DY7A 3JVLA 5EWVA 5BT5A 5E3GA 4IR4A 3P5OA 3G0JA 1N72A 5EP7A 4BHWA 2L5EA 4YYNA 5E9VA 4CUUA 4A9KA 5CS8A 2G4AA 5FE9A 4QYLA 5D3PA 5E9LA 4LDFA 3DAIA 4QY4A 4NR7A 5CUEA 4Z1SA 5HEMA 3HMEA 5E0RA 4E96A 5CRMA 4OGJA 3P1CA 5CQAA 4TTEA 2OO1A 3LQJA 5BT4A 2OSSA 3RCWA 4QC1A 5F1HA 4A9OA 4A9FA 5DYCA 2I7KA 2RS9B 4LRGA 3U5LA 3U5MA 5D3NA 5E3DA 3D1BA 2WP2A 3MXFA 2OUOA 5CU8A 3Q2EA 5IG6A 4X2IA 4QSRA 1WUMA 4UIUA 4J3IA 1JM4B 4PY6A 4QR5A 2WP1A 3TLPA 5TB6A 3I3JA 5F2PA 5F62A 5HQ5A 2RI7A 4NQMA 3UV4A 5CQ4A 4YY4A 3AQAA 5C7NA 2LSPB 5H1UA 5D3SA 3DWYA 5CQ5A 4PKLA 5ENHA 5G4RA 4UYHA 4NRAA 4HXLA 4O72A 4UYFA 4NR9A 5L96A 3O34A 4QR3A 5ENFA 4CURA 4QR4A 5ETDA 4J0SA 5EGUA 4O74A 5DW2A 4BW1A 5DYUA 5CUAA 5LJ2A 4AKIA 5IGNA 2NXBA 3LQIA 4UIXA 4UIVA 4NRCA 4DONA 4YC9A 5L8UA 5FE2A 4O71A 4C66A 5D7XA 4QSQA 5LUUA 5E73A 4Y03A 4YY6A 5II1A 5H1TA 5EU1A 4TZ2A 5D3JA 4N4IA 4N3WA 4O7FA 4RVRA 4TT6A 4MR5A 3D7CA 5LJ0A 3NXBA 5D3HA 5CUBA 5AMEA 2RNYA 5D3LA 5F60A 5ENCA 3UVYA 5D3RA 4N4FA 4UIZA 4Q0NA 5DKDA 3SVFA 2RO1A 5HFRA 5L98A 5TCMA 4MEOA 3ZYUA 5JWMA 4KV4A 5HRXA 4QSWA 5KTUA 2YDWA 5E9YA 5IGKA 5EWWA 5HELA 5FE5A 5HQ6A 2YEMA 5D25A 2D9EA 4NYVA 5FBXA 4MR3A 4LZRA 5ENGA 4BW2A 3JVKA 2DVVA 4YABA 4QSXA 3O37A 4PCEA 5I40A 4KCXA 4TT4A 4YH3A 4NYWA 4QBMA 4UYEA 4QSUA 4PTBA 3LXJA 5EISA 3O33A 4IOQA 4TQNA 4UYDA 4HXMA 5HRVA 4CUTA 2YYNA 4YBSA 2GRCA 3MB4A 4NUDA 5DFDA 5CUCA 5L97A 5C8GA 4PCIA 4XY9A 4ALGA 5F63A 5FE4A 3U5NA 2YW5A 3MQMA 4TU6A 4CFLA 3UW9A 2R10A 4HXPA 2I8NA 4O75A 5BT3A 4GPJA 4NS5A 5E74A 5FE7A 4MR4A 4O7EA 4XY8A 3QZSA 5I7XA 3HMFA 2YELA 4QSTA 4Z93A 5EPSA 4ZW1A 5I1QA 5E7DA 5FG5A 4YBMA 5I88A 4TT2A 2R0SA 4YADA 5ETBA 4NR5A 5ENJA 1ZKRA 5DYXA 4QC3A 1F68A 4A9MA 5FE3A 4A9JA 4CUPA 4NR4A 3SVHA 4J1PA 5CPEA 4O7CA 3O36A 5H85A 5I83A 4XUBA 4AI6A 5LKXA 5E9KA 4Q0OA 5ENIA 3IU5A 3G0LA 3U5JA 4O7AA 5DYAA 3UV5A 4NUCA 3U5KA 5KU3A 3IU6A 3U5PA 5F36A 2L85A 5E9IA 5EQ1A 5K29A 1JSPB 4OGIA 5F25A 5LVRA 5I7YA 5FH6A 5IGMA 5I29A 5DKHA 2DWWA 5A82A 2DVQA 4IOOA 2D82A 4QEUA 4UIWA 4YYHA 5CFWA 4ZQLA 4TU4A 4LC2A 2RNXA 5HJCA 5I80A 4LYIA 2L84A 5FB0A 3UVWA 5DBMA 2RFJA 5A5RA 4QSVA 4NRBA 5LVQA 4QSPA 2DKWA 3LJWA 5KTWA 4MEPA 5FG4A 5EM3A 5FH7A 4YATA 4IR6A 5HENA 5C87A 4HBXA 5EI4A 3D1DA 5CUGA 5IIDA 4HBWA 4CFKA 5D26A 5A5QA 2H60A 4O7BA 4QNSA 4WHWA 5CP5A 5FFWA 4AKNA 5FG6A 4TS8A 4KV1A 5CUDA 2EJNA 4YBTA 4IR3A 3P1EA 4LYWA 4UYFB 5A5SA 5C89A 5G4SA 5ENBA 4YYMA 5KHMA 4Z6HA 5KTXA 5ENEA 2R0YA 5LJ1A 4UITA 4O70A 5FB1A 2F6JA 4BW3A 3JVMA 4QSSA 5HFQA 5FDZA 5F61A 4YYIA 3AADA 4MR6A 3QZVA 1ZS5A 4IR5A 4CLBA 5J0DA 4QUUA 4XUAA 1E6IA 1EQFA 4PS5A 5F3AA 5AD3A 5HLSA 5FH8A 4QYDA 4BJXA 3HMHA 3QZTA 5EPBA 4TYLA 5EVAA 5CQTA 5IGLA 4CUSA 1X0JA 4NQNA 3Q2FA 4NXJA 3S92A 4O77A 4IORA 3P1FA 5EWDA 4A9IA 5A5NA 5AD2A 2YQDA 3MUKA 3ONIA 5DFBA 5E9MA 5HRWA 3FKMX 5EWHA 3JVJA 5F1LA 4HXKA 3P1DA 5CZGA 5CQ7A 5A5OA 5CRZA 3K2JA 3MULA 4QB3A 2FSAA 4MEQA 5DKCA 3MB3A 5C4QA 4ALHA 4ZC9A 5L99A 5FE0A 4HXSA 2RNWA 3S91A 4CL9A 5FE8A 5DW1A
chains in the Genus database with same CATH topology
2E7OA 4YH4A 5CY9A 5LKTA 4MENA 5FFVA 2F6NA 5EK9A 3UVDA 4NUEA 4QZSA 5HQ7A 4A9EA 3UV2A 2E7NA 5FE6A 5HM0A 4A9NA 4A9HA 5A85A 4HXOA 5LKUA 4WIVA 4N4HA 4LYSA 4BW4A 4C67A 4O76A 3UVXA 5EPRA 5A83A 4N4GA 5KO4A 5I89A 4O78A 4XYAA 4QEWA 5IBNA 4FLPA 5CQ6A 5II2A 4YYJA 2E3KA 2N9GA 4LR6A 5ACYA 2DATA 3GG3A 2YEKA 4QUTA 4UYGA 4UIYA 4YAXA 4Z6IA 5EA1A 5F5ZA 3U5OA 3O35A 5CGPA 4HXNA 5DLXA 4Z1QA 5LKZA 4F3IA 4OUFA 3SVGA 4NR8A 5EWCA 4LZSA 5D24A 5CQ8A 5FE1A 3LQHA 5DX4A 4HBYA 4YYGA 5H1VA 2DVRA 4CUQA 4HXRA 5EV9A 4LZ2A 1WUGA 4WHUA 5HCLA 5AMFA 5A7CA 5A5PA 4HBVA 5EICA 5DFCA 5JI8A 5L8TA 5CQ3A 5I86A 4YYDA 5COIA 5D0CA 5DLZA 4YK0A 2DVSA 2R0VA 4YYKA 5D3TA 2KTBB 4NR6A 5CTLA 4A9LA 5A81A 4NYXA 5C85A 4J0RA 4TZ8A 4QEVA 2MJVB 5FFYA 5DY7A 3JVLA 5EWVA 5BT5A 5E3GA 4IR4A 3P5OA 3G0JA 1N72A 5EP7A 4BHWA 2L5EA 4YYNA 5E9VA 4CUUA 4A9KA 5CS8A 2G4AA 5FE9A 4QYLA 5D3PA 5E9LA 4LDFA 3DAIA 4QY4A 4NR7A 5CUEA 4Z1SA 5HEMA 3HMEA 5E0RA 4E96A 5CRMA 4OGJA 3P1CA 5CQAA 4TTEA 2OO1A 3LQJA 5BT4A 2OSSA 3RCWA 4QC1A 5F1HA 4A9OA 4A9FA 5DYCA 2I7KA 2RS9B 4LRGA 3U5LA 3U5MA 5D3NA 5E3DA 2WP2A 3MXFA 2OUOA 5CU8A 3Q2EA 5IG6A 4X2IA 4QSRA 1WUMA 4UIUA 4J3IA 1JM4B 4PY6A 4QR5A 2WP1A 3TLPA 5TB6A 3I3JA 5F2PA 5F62A 5HQ5A 2RI7A 4NQMA 3UV4A 5CQ4A 4YY4A 3AQAA 5C7NA 2LSPB 5H1UA 5D3SA 3DWYA 5CQ5A 4PKLA 5ENHA 5G4RA 4UYHA 4NRAA 4HXLA 4O72A 4UYFA 4NR9A 5L96A 3O34A 4QR3A 5ENFA 4CURA 4QR4A 5ETDA 4J0SA 5EGUA 4O74A 5DW2A 4BW1A 5DYUA 5CUAA 5LJ2A 5IGNA 2NXBA 3LQIA 4UIXA 4UIVA 4NRCA 4DONA 4YC9A 5L8UA 5FE2A 4O71A 4C66A 5D7XA 4QSQA 5LUUA 5E73A 4Y03A 4YY6A 5II1A 5H1TA 5EU1A 4TZ2A 5D3JA 4N4IA 4N3WA 4O7FA 4RVRA 4TT6A 4MR5A 3D7CA 5LJ0A 3NXBA 5D3HA 5CUBA 5AMEA 2RNYA 5D3LA 5F60A 5ENCA 3UVYA 5D3RA 4N4FA 4UIZA 4Q0NA 5DKDA 3SVFA 2RO1A 5HFRA 5L98A 5TCMA 4MEOA 3ZYUA 5JWMA 4KV4A 5HRXA 4QSWA 5KTUA 2YDWA 5E9YA 5IGKA 5EWWA 5HELA 5FE5A 5HQ6A 2YEMA 5D25A 2D9EA 4NYVA 5FBXA 4MR3A 4LZRA 5ENGA 4BW2A 3JVKA 2DVVA 4YABA 4QSXA 3O37A 4PCEA 5I40A 4KCXA 4TT4A 4YH3A 4NYWA 4QBMA 4UYEA 4QSUA 4PTBA 3LXJA 5EISA 3O33A 4IOQA 4TQNA 4UYDA 4HXMA 5HRVA 4CUTA 2YYNA 4YBSA 2GRCA 3MB4A 4NUDA 5DFDA 5CUCA 5L97A 5C8GA 4PCIA 4XY9A 4ALGA 5F63A 5FE4A 3U5NA 2YW5A 3MQMA 4TU6A 4CFLA 3UW9A 2R10A 4HXPA 2I8NA 4O75A 5BT3A 4GPJA 4NS5A 5E74A 5FE7A 4MR4A 4O7EA 4XY8A 3QZSA 5I7XA 3HMFA 2YELA 4QSTA 4Z93A 5EPSA 4ZW1A 5I1QA 5E7DA 5FG5A 4YBMA 5I88A 4TT2A 2R0SA 4YADA 5ETBA 4NR5A 5ENJA 5DYXA 4QC3A 1F68A 4A9MA 5FE3A 4A9JA 4CUPA 4NR4A 3SVHA 4J1PA 5CPEA 4O7CA 3O36A 5H85A 5I83A 4XUBA 5LKXA 5E9KA 4Q0OA 5ENIA 3IU5A 3G0LA 3U5JA 4O7AA 5DYAA 3UV5A 4NUCA 3U5KA 5KU3A 3IU6A 3U5PA 5F36A 2L85A 5E9IA 5EQ1A 5K29A 1JSPB 4OGIA 5F25A 5LVRA 5I7YA 5FH6A 5IGMA 5I29A 5DKHA 2DWWA 5A82A 2DVQA 4IOOA 2D82A 4QEUA 4UIWA 4YYHA 5CFWA 4ZQLA 4TU4A 4LC2A 2RNXA 5HJCA 5I80A 4LYIA 2L84A 5FB0A 3UVWA 5DBMA 2RFJA 5A5RA 4QSVA 4NRBA 5LVQA 4QSPA 2DKWA 3LJWA 5KTWA 4MEPA 5FG4A 5EM3A 5FH7A 4YATA 4IR6A 5HENA 5C87A 4HBXA 5EI4A 5IIDA 5CUGA 4HBWA 4CFKA 5D26A 5A5QA 2H60A 4O7BA 4QNSA 4WHWA 5CP5A 5FFWA 4AKNA 5FG6A 4TS8A 4KV1A 5CUDA 4YBTA 4IR3A 3P1EA 4LYWA 4UYFB 5A5SA 5C89A 5G4SA 5ENBA 4YYMA 5KHMA 4Z6HA 5KTXA 5ENEA 2R0YA 5LJ1A 4UITA 4O70A 5FB1A 2F6JA 4BW3A 3JVMA 4QSSA 5HFQA 5FDZA 5F61A 4YYIA 3AADA 4MR6A 3QZVA 1ZS5A 4IR5A 4CLBA 5J0DA 4QUUA 4XUAA 1E6IA 1EQFA 4PS5A 5F3AA 5AD3A 5HLSA 5FH8A 4QYDA 4BJXA 3HMHA 3QZTA 5EPBA 4TYLA 5EVAA 5CQTA 5IGLA 4CUSA 1X0JA 4NQNA 3Q2FA 4NXJA 3S92A 4O77A 4IORA 3P1FA 5EWDA 4A9IA 5A5NA 5AD2A 2YQDA 3MUKA 3ONIA 5DFBA 5E9MA 5HRWA 3FKMX 5EWHA 3JVJA 5F1LA 4HXKA 3P1DA 5CZGA 5CQ7A 5A5OA 5CRZA 3K2JA 3MULA 4QB3A 2FSAA 4MEQA 5DKCA 3MB3A 5C4QA 4ALHA 4ZC9A 5L99A 5FE0A 4HXSA 2RNWA 3S91A 4CL9A 5FE8A 5DW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E7O A;  4YH4 A;  5CY9 A;  5LKT A;  4MEN A;  5FFV A;  2F6N A;  5EK9 A;  3UVD A;  4NUE A;  4QZS A;  5HQ7 A;  4A9E A;  3UV2 A;  2E7N A;  5FE6 A;  5HM0 A;  4A9N A;  4A9H A;  5A85 A;  4HXO A;  5LKU A;  4WIV A;  4N4H A;  4LYS A;  4BW4 A;  4C67 A;  4O76 A;  3UVX A;  5EPR A;  5A83 A;  4N4G A;  5KO4 A;  5I89 A;  4O78 A;  4XYA A;  4QEW A;  5IBN A;  4FLP A;  5CQ6 A;  5II2 A;  4YYJ A;  2E3K A;  2N9G A;  4LR6 A;  5ACY A;  2DAT A;  3GG3 A;  2YEK A;  4QUT A;  4UYG A;  4UIY A;  4YAX A;  4Z6I A;  5EA1 A;  5F5Z A;  3U5O A;  3O35 A;  5CGP A;  4HXN A;  5DLX A;  4Z1Q A;  5LKZ A;  4F3I A;  4OUF A;  3SVG A;  4NR8 A;  5EWC A;  4LZS A;  5D24 A;  5CQ8 A;  5FE1 A;  3LQH A;  5DX4 A;  4HBY A;  4YYG A;  5H1V A;  2DVR A;  4CUQ A;  4HXR A;  5EV9 A;  4LZ2 A;  1WUG A;  4WHU A;  5HCL A;  5AMF A;  5A7C A;  5A5P A;  4HBV A;  5EIC A;  5DFC A;  5JI8 A;  5L8T A;  5CQ3 A;  5I86 A;  4YYD A;  5COI A;  5D0C A;  5DLZ A;  4YK0 A;  2DVS A;  2R0V A;  4YYK A;  5D3T A;  2KTB B;  4NR6 A;  5CTL A;  4A9L A;  5A81 A;  4NYX A;  5C85 A;  4J0R A;  4TZ8 A;  4QEV A;  2MJV B;  5FFY A;  5DY7 A;  3JVL A;  5EWV A;  5BT5 A;  5E3G A;  4IR4 A;  3P5O A;  3G0J A;  1N72 A;  5EP7 A;  4BHW A;  2L5E A;  4YYN A;  5E9V A;  4CUU A;  4A9K A;  5CS8 A;  2G4A A;  5FE9 A;  4QYL A;  5D3P A;  5E9L A;  4LDF A;  3DAI A;  4QY4 A;  4NR7 A;  5CUE A;  4Z1S A;  5HEM A;  3HME A;  5E0R A;  4E96 A;  5CRM A;  4OGJ A;  3P1C A;  5CQA A;  4TTE A;  2OO1 A;  3LQJ A;  5BT4 A;  2OSS A;  3RCW A;  4QC1 A;  5F1H A;  4A9O A;  4A9F A;  5DYC A;  2I7K A;  2RS9 B;  4LRG A;  3U5L A;  3U5M A;  5D3N A;  5E3D A;  2WP2 A;  3MXF A;  2OUO A;  5CU8 A;  3Q2E A;  5IG6 A;  4X2I A;  4QSR A;  1WUM A;  4UIU A;  4J3I A;  1JM4 B;  4PY6 A;  4QR5 A;  2WP1 A;  3TLP A;  5TB6 A;  3I3J A;  5F2P A;  5F62 A;  5HQ5 A;  2RI7 A;  4NQM A;  3UV4 A;  5CQ4 A;  4YY4 A;  3AQA A;  5C7N A;  2LSP B;  5H1U A;  5D3S A;  3DWY A;  5CQ5 A;  4PKL A;  5ENH A;  5G4R A;  4UYH A;  4NRA A;  4HXL A;  4O72 A;  4UYF A;  4NR9 A;  5L96 A;  3O34 A;  4QR3 A;  5ENF A;  4CUR A;  4QR4 A;  5ETD A;  4J0S A;  5EGU A;  4O74 A;  5DW2 A;  4BW1 A;  5DYU A;  5CUA A;  5LJ2 A;  5IGN A;  2NXB A;  3LQI A;  4UIX A;  4UIV A;  4NRC A;  4DON A;  4YC9 A;  5L8U A;  5FE2 A;  4O71 A;  4C66 A;  5D7X A;  4QSQ A;  5LUU A;  5E73 A;  4Y03 A;  4YY6 A;  5II1 A;  5H1T A;  5EU1 A;  4TZ2 A;  5D3J A;  4N4I A;  4N3W A;  4O7F A;  4RVR A;  4TT6 A;  4MR5 A;  3D7C A;  5LJ0 A;  3NXB A;  5D3H A;  5CUB A;  5AME A;  2RNY A;  5D3L A;  5F60 A;  5ENC A;  3UVY A;  5D3R A;  4N4F A;  4UIZ A;  4Q0N A;  5DKD A;  3SVF A;  2RO1 A;  5HFR A;  5L98 A;  5TCM A;  4MEO A;  3ZYU A;  5JWM A;  4KV4 A;  5HRX A;  4QSW A;  5KTU A;  2YDW A;  5E9Y A;  5IGK A;  5EWW A;  5HEL A;  5FE5 A;  5HQ6 A;  2YEM A;  5D25 A;  2D9E A;  4NYV A;  5FBX A;  4MR3 A;  4LZR A;  5ENG A;  4BW2 A;  3JVK A;  2DVV A;  4YAB A;  4QSX A;  3O37 A;  4PCE A;  5I40 A;  4KCX A;  4TT4 A;  4YH3 A;  4NYW A;  4QBM A;  4UYE A;  4QSU A;  4PTB A;  3LXJ A;  5EIS A;  3O33 A;  4IOQ A;  4TQN A;  4UYD A;  4HXM A;  5HRV A;  4CUT A;  2YYN A;  4YBS A;  2GRC A;  3MB4 A;  4NUD A;  5DFD A;  5CUC A;  5L97 A;  5C8G A;  4PCI A;  4XY9 A;  4ALG A;  5F63 A;  5FE4 A;  3U5N A;  2YW5 A;  3MQM A;  4TU6 A;  4CFL A;  3UW9 A;  2R10 A;  4HXP A;  2I8N A;  4O75 A;  5BT3 A;  4GPJ A;  4NS5 A;  5E74 A;  5FE7 A;  4MR4 A;  4O7E A;  4XY8 A;  3QZS A;  5I7X A;  3HMF A;  2YEL A;  4QST A;  4Z93 A;  5EPS A;  4ZW1 A;  5I1Q A;  5E7D A;  5FG5 A;  4YBM A;  5I88 A;  4TT2 A;  2R0S A;  4YAD A;  5ETB A;  4NR5 A;  5ENJ A;  5DYX A;  4QC3 A;  1F68 A;  4A9M A;  5FE3 A;  4A9J A;  4CUP A;  4NR4 A;  3SVH A;  4J1P A;  5CPE A;  4O7C A;  3O36 A;  5H85 A;  5I83 A;  4XUB A;  5LKX A;  5E9K A;  4Q0O A;  5ENI A;  3IU5 A;  3G0L A;  3U5J A;  4O7A A;  5DYA A;  3UV5 A;  4NUC A;  3U5K A;  5KU3 A;  3IU6 A;  3U5P A;  5F36 A;  2L85 A;  5E9I A;  5EQ1 A;  5K29 A;  1JSP B;  4OGI A;  5F25 A;  5LVR A;  5I7Y A;  5FH6 A;  5IGM A;  5I29 A;  5DKH A;  2DWW A;  5A82 A;  2DVQ A;  4IOO A;  2D82 A;  4QEU A;  4UIW A;  4YYH A;  5CFW A;  4ZQL A;  4TU4 A;  4LC2 A;  2RNX A;  5HJC A;  5I80 A;  4LYI A;  2L84 A;  5FB0 A;  3UVW A;  5DBM A;  2RFJ A;  5A5R A;  4QSV A;  4NRB A;  5LVQ A;  4QSP A;  2DKW A;  3LJW A;  5KTW A;  4MEP A;  5FG4 A;  5EM3 A;  5FH7 A;  4YAT A;  4IR6 A;  5HEN A;  5C87 A;  4HBX A;  5EI4 A;  5IID A;  5CUG A;  4HBW A;  4CFK A;  5D26 A;  5A5Q A;  2H60 A;  4O7B A;  4QNS A;  4WHW A;  5CP5 A;  5FFW A;  4AKN A;  5FG6 A;  4TS8 A;  4KV1 A;  5CUD A;  4YBT A;  4IR3 A;  3P1E A;  4LYW A;  4UYF B;  5A5S A;  5C89 A;  5G4S A;  5ENB A;  4YYM A;  5KHM A;  4Z6H A;  5KTX A;  5ENE A;  2R0Y A;  5LJ1 A;  4UIT A;  4O70 A;  5FB1 A;  2F6J A;  4BW3 A;  3JVM A;  4QSS A;  5HFQ A;  5FDZ A;  5F61 A;  4YYI A;  3AAD A;  4MR6 A;  3QZV A;  1ZS5 A;  4IR5 A;  4CLB A;  5J0D A;  4QUU A;  4XUA A;  1E6I A;  1EQF A;  4PS5 A;  5F3A A;  5AD3 A;  5HLS A;  5FH8 A;  4QYD A;  4BJX A;  3HMH A;  3QZT A;  5EPB A;  4TYL A;  5EVA A;  5CQT A;  5IGL A;  4CUS A;  1X0J A;  4NQN A;  3Q2F A;  4NXJ A;  3S92 A;  4O77 A;  4IOR A;  3P1F A;  5EWD A;  4A9I A;  5A5N A;  5AD2 A;  2YQD A;  3MUK A;  3ONI A;  5DFB A;  5E9M A;  5HRW A;  3FKM X;  5EWH A;  3JVJ A;  5F1L A;  4HXK A;  3P1D A;  5CZG A;  5CQ7 A;  5A5O A;  5CRZ A;  3K2J A;  3MUL A;  4QB3 A;  2FSA A;  4MEQ A;  5DKC A;  3MB3 A;  5C4Q A;  4ALH A;  4ZC9 A;  5L99 A;  5FE0 A;  4HXS A;  2RNW A;  3S91 A;  4CL9 A;  5FE8 A;  5DW1 A; 
#chains in the Genus database with same CATH topology
 2E7O A;  4YH4 A;  5CY9 A;  5LKT A;  4MEN A;  5FFV A;  2F6N A;  5EK9 A;  3UVD A;  4NUE A;  4QZS A;  5HQ7 A;  4A9E A;  3UV2 A;  2E7N A;  5FE6 A;  5HM0 A;  4A9N A;  4A9H A;  5A85 A;  4HXO A;  5LKU A;  4AKG A;  4WIV A;  4N4H A;  4LYS A;  4BW4 A;  4C67 A;  4O76 A;  3UVX A;  5EPR A;  5A83 A;  4N4G A;  5KO4 A;  5I89 A;  4O78 A;  4XYA A;  4AKH A;  4QEW A;  5IBN A;  4FLP A;  5CQ6 A;  5II2 A;  4YYJ A;  2E3K A;  2N9G A;  4LR6 A;  5ACY A;  2DAT A;  3GG3 A;  2YEK A;  4QUT A;  4UYG A;  4UIY A;  4YAX A;  4Z6I A;  5EA1 A;  5F5Z A;  3U5O A;  3O35 A;  5CGP A;  4HXN A;  5DLX A;  4Z1Q A;  3VKG A;  5LKZ A;  4F3I A;  4OUF A;  3SVG A;  4NR8 A;  5EWC A;  4LZS A;  5D24 A;  5CQ8 A;  3ERR A;  5FE1 A;  3LQH A;  5DX4 A;  4HBY A;  4YYG A;  5H1V A;  2DVR A;  4CUQ A;  4HXR A;  5EV9 A;  4LZ2 A;  1WUG A;  4WHU A;  5HCL A;  5AMF A;  5A7C A;  5A5P A;  4HBV A;  5EIC A;  5DFC A;  5JI8 A;  5L8T A;  5CQ3 A;  5I86 A;  4YYD A;  5COI A;  5D0C A;  5DLZ A;  4YK0 A;  2DVS A;  2R0V A;  4YYK A;  5D3T A;  2KTB B;  4NR6 A;  5CTL A;  4A9L A;  5A81 A;  4NYX A;  1PUO A;  3VKH A;  5C85 A;  4J0R A;  4TZ8 A;  4QEV A;  2MJV B;  5FFY A;  5DY7 A;  3JVL A;  5EWV A;  5BT5 A;  5E3G A;  4IR4 A;  3P5O A;  3G0J A;  1N72 A;  5EP7 A;  4BHW A;  2L5E A;  4YYN A;  5E9V A;  4CUU A;  4A9K A;  5CS8 A;  2G4A A;  5FE9 A;  4QYL A;  5D3P A;  5E9L A;  4LDF A;  3DAI A;  4QY4 A;  4NR7 A;  5CUE A;  4Z1S A;  5HEM A;  3HME A;  5E0R A;  4E96 A;  5CRM A;  4OGJ A;  3P1C A;  5CQA A;  4TTE A;  2OO1 A;  3LQJ A;  5BT4 A;  2OSS A;  3RCW A;  4QC1 A;  5F1H A;  4A9O A;  4A9F A;  5DYC A;  2I7K A;  2RS9 B;  4LRG A;  3U5L A;  3U5M A;  5D3N A;  5E3D A;  3D1B A;  2WP2 A;  3MXF A;  2OUO A;  5CU8 A;  3Q2E A;  5IG6 A;  4X2I A;  4QSR A;  1WUM A;  4UIU A;  4J3I A;  1JM4 B;  4PY6 A;  4QR5 A;  2WP1 A;  3TLP A;  5TB6 A;  3I3J A;  5F2P A;  5F62 A;  5HQ5 A;  2RI7 A;  4NQM A;  3UV4 A;  5CQ4 A;  4YY4 A;  3AQA A;  5C7N A;  2LSP B;  5H1U A;  5D3S A;  3DWY A;  5CQ5 A;  4PKL A;  5ENH A;  5G4R A;  4UYH A;  4NRA A;  4HXL A;  4O72 A;  4UYF A;  4NR9 A;  5L96 A;  3O34 A;  4QR3 A;  5ENF A;  4CUR A;  4QR4 A;  5ETD A;  4J0S A;  5EGU A;  4O74 A;  5DW2 A;  4BW1 A;  5DYU A;  5CUA A;  5LJ2 A;  4AKI A;  5IGN A;  2NXB A;  3LQI A;  4UIX A;  4UIV A;  4NRC A;  4DON A;  4YC9 A;  5L8U A;  5FE2 A;  4O71 A;  4C66 A;  5D7X A;  4QSQ A;  5LUU A;  5E73 A;  4Y03 A;  4YY6 A;  5II1 A;  5H1T A;  5EU1 A;  4TZ2 A;  5D3J A;  4N4I A;  4N3W A;  4O7F A;  4RVR A;  4TT6 A;  4MR5 A;  3D7C A;  5LJ0 A;  3NXB A;  5D3H A;  5CUB A;  5AME A;  2RNY A;  5D3L A;  5F60 A;  5ENC A;  3UVY A;  5D3R A;  4N4F A;  4UIZ A;  4Q0N A;  5DKD A;  3SVF A;  2RO1 A;  5HFR A;  5L98 A;  5TCM A;  4MEO A;  3ZYU A;  5JWM A;  4KV4 A;  5HRX A;  4QSW A;  5KTU A;  2YDW A;  5E9Y A;  5IGK A;  5EWW A;  5HEL A;  5FE5 A;  5HQ6 A;  2YEM A;  5D25 A;  2D9E A;  4NYV A;  5FBX A;  4MR3 A;  4LZR A;  5ENG A;  4BW2 A;  3JVK A;  2DVV A;  4YAB A;  4QSX A;  3O37 A;  4PCE A;  5I40 A;  4KCX A;  4TT4 A;  4YH3 A;  4NYW A;  4QBM A;  4UYE A;  4QSU A;  4PTB A;  3LXJ A;  5EIS A;  3O33 A;  4IOQ A;  4TQN A;  4UYD A;  4HXM A;  5HRV A;  4CUT A;  2YYN A;  4YBS A;  2GRC A;  3MB4 A;  4NUD A;  5DFD A;  5CUC A;  5L97 A;  5C8G A;  4PCI A;  4XY9 A;  4ALG A;  5F63 A;  5FE4 A;  3U5N A;  2YW5 A;  3MQM A;  4TU6 A;  4CFL A;  3UW9 A;  2R10 A;  4HXP A;  2I8N A;  4O75 A;  5BT3 A;  4GPJ A;  4NS5 A;  5E74 A;  5FE7 A;  4MR4 A;  4O7E A;  4XY8 A;  3QZS A;  5I7X A;  3HMF A;  2YEL A;  4QST A;  4Z93 A;  5EPS A;  4ZW1 A;  5I1Q A;  5E7D A;  5FG5 A;  4YBM A;  5I88 A;  4TT2 A;  2R0S A;  4YAD A;  5ETB A;  4NR5 A;  5ENJ A;  1ZKR A;  5DYX A;  4QC3 A;  1F68 A;  4A9M A;  5FE3 A;  4A9J A;  4CUP A;  4NR4 A;  3SVH A;  4J1P A;  5CPE A;  4O7C A;  3O36 A;  5H85 A;  5I83 A;  4XUB A;  4AI6 A;  5LKX A;  5E9K A;  4Q0O A;  5ENI A;  3IU5 A;  3G0L A;  3U5J A;  4O7A A;  5DYA A;  3UV5 A;  4NUC A;  3U5K A;  5KU3 A;  3IU6 A;  3U5P A;  5F36 A;  2L85 A;  5E9I A;  5EQ1 A;  5K29 A;  1JSP B;  4OGI A;  5F25 A;  5LVR A;  5I7Y A;  5FH6 A;  5IGM A;  5I29 A;  5DKH A;  2DWW A;  5A82 A;  2DVQ A;  4IOO A;  2D82 A;  4QEU A;  4UIW A;  4YYH A;  5CFW A;  4ZQL A;  4TU4 A;  4LC2 A;  2RNX A;  5HJC A;  5I80 A;  4LYI A;  2L84 A;  5FB0 A;  3UVW A;  5DBM A;  2RFJ A;  5A5R A;  4QSV A;  4NRB A;  5LVQ A;  4QSP A;  2DKW A;  3LJW A;  5KTW A;  4MEP A;  5FG4 A;  5EM3 A;  5FH7 A;  4YAT A;  4IR6 A;  5HEN A;  5C87 A;  4HBX A;  5EI4 A;  3D1D A;  5CUG A;  5IID A;  4HBW A;  4CFK A;  5D26 A;  5A5Q A;  2H60 A;  4O7B A;  4QNS A;  4WHW A;  5CP5 A;  5FFW A;  4AKN A;  5FG6 A;  4TS8 A;  4KV1 A;  5CUD A;  2EJN A;  4YBT A;  4IR3 A;  3P1E A;  4LYW A;  4UYF B;  5A5S A;  5C89 A;  5G4S A;  5ENB A;  4YYM A;  5KHM A;  4Z6H A;  5KTX A;  5ENE A;  2R0Y A;  5LJ1 A;  4UIT A;  4O70 A;  5FB1 A;  2F6J A;  4BW3 A;  3JVM A;  4QSS A;  5HFQ A;  5FDZ A;  5F61 A;  4YYI A;  3AAD A;  4MR6 A;  3QZV A;  1ZS5 A;  4IR5 A;  4CLB A;  5J0D A;  4QUU A;  4XUA A;  1E6I A;  1EQF A;  4PS5 A;  5F3A A;  5AD3 A;  5HLS A;  5FH8 A;  4QYD A;  4BJX A;  3HMH A;  3QZT A;  5EPB A;  4TYL A;  5EVA A;  5CQT A;  5IGL A;  4CUS A;  1X0J A;  4NQN A;  3Q2F A;  4NXJ A;  3S92 A;  4O77 A;  4IOR A;  3P1F A;  5EWD A;  4A9I A;  5A5N A;  5AD2 A;  2YQD A;  3MUK A;  3ONI A;  5DFB A;  5E9M A;  5HRW A;  3FKM X;  5EWH A;  3JVJ A;  5F1L A;  4HXK A;  3P1D A;  5CZG A;  5CQ7 A;  5A5O A;  5CRZ A;  3K2J A;  3MUL A;  4QB3 A;  2FSA A;  4MEQ A;  5DKC A;  3MB3 A;  5C4Q A;  4ALH A;  4ZC9 A;  5L99 A;  5FE0 A;  4HXS A;  2RNW A;  3S91 A;  4CL9 A;  5FE8 A;  5DW1 A; 
#chains in the Genus database with same CATH homology
 2E7O A;  4YH4 A;  5CY9 A;  5LKT A;  4MEN A;  5FFV A;  2F6N A;  5EK9 A;  3UVD A;  4NUE A;  4QZS A;  5HQ7 A;  4A9E A;  3UV2 A;  2E7N A;  5FE6 A;  5HM0 A;  4A9N A;  4A9H A;  5A85 A;  4HXO A;  5LKU A;  4WIV A;  4N4H A;  4LYS A;  4BW4 A;  4C67 A;  4O76 A;  3UVX A;  5EPR A;  5A83 A;  4N4G A;  5KO4 A;  5I89 A;  4O78 A;  4XYA A;  4QEW A;  5IBN A;  4FLP A;  5CQ6 A;  5II2 A;  4YYJ A;  2E3K A;  2N9G A;  4LR6 A;  5ACY A;  2DAT A;  3GG3 A;  2YEK A;  4QUT A;  4UYG A;  4UIY A;  4YAX A;  4Z6I A;  5EA1 A;  5F5Z A;  3U5O A;  3O35 A;  5CGP A;  4HXN A;  5DLX A;  4Z1Q A;  5LKZ A;  4F3I A;  4OUF A;  3SVG A;  4NR8 A;  5EWC A;  4LZS A;  5D24 A;  5CQ8 A;  5FE1 A;  3LQH A;  5DX4 A;  4HBY A;  4YYG A;  5H1V A;  2DVR A;  4CUQ A;  4HXR A;  5EV9 A;  4LZ2 A;  1WUG A;  4WHU A;  5HCL A;  5AMF A;  5A7C A;  5A5P A;  4HBV A;  5EIC A;  5DFC A;  5JI8 A;  5L8T A;  5CQ3 A;  5I86 A;  4YYD A;  5COI A;  5D0C A;  5DLZ A;  4YK0 A;  2DVS A;  2R0V A;  4YYK A;  5D3T A;  2KTB B;  4NR6 A;  5CTL A;  4A9L A;  5A81 A;  4NYX A;  5C85 A;  4J0R A;  4TZ8 A;  4QEV A;  2MJV B;  5FFY A;  5DY7 A;  3JVL A;  5EWV A;  5BT5 A;  5E3G A;  4IR4 A;  3P5O A;  3G0J A;  1N72 A;  5EP7 A;  4BHW A;  2L5E A;  4YYN A;  5E9V A;  4CUU A;  4A9K A;  5CS8 A;  2G4A A;  5FE9 A;  4QYL A;  5D3P A;  5E9L A;  4LDF A;  3DAI A;  4QY4 A;  4NR7 A;  5CUE A;  4Z1S A;  5HEM A;  3HME A;  5E0R A;  4E96 A;  5CRM A;  4OGJ A;  3P1C A;  5CQA A;  4TTE A;  2OO1 A;  3LQJ A;  5BT4 A;  2OSS A;  3RCW A;  4QC1 A;  5F1H A;  4A9O A;  4A9F A;  5DYC A;  2I7K A;  2RS9 B;  4LRG A;  3U5L A;  3U5M A;  5D3N A;  5E3D A;  2WP2 A;  3MXF A;  2OUO A;  5CU8 A;  3Q2E A;  5IG6 A;  4X2I A;  4QSR A;  1WUM A;  4UIU A;  4J3I A;  1JM4 B;  4PY6 A;  4QR5 A;  2WP1 A;  3TLP A;  5TB6 A;  3I3J A;  5F2P A;  5F62 A;  5HQ5 A;  2RI7 A;  4NQM A;  3UV4 A;  5CQ4 A;  4YY4 A;  3AQA A;  5C7N A;  2LSP B;  5H1U A;  5D3S A;  3DWY A;  5CQ5 A;  4PKL A;  5ENH A;  5G4R A;  4UYH A;  4NRA A;  4HXL A;  4O72 A;  4UYF A;  4NR9 A;  5L96 A;  3O34 A;  4QR3 A;  5ENF A;  4CUR A;  4QR4 A;  5ETD A;  4J0S A;  5EGU A;  4O74 A;  5DW2 A;  4BW1 A;  5DYU A;  5CUA A;  5LJ2 A;  5IGN A;  2NXB A;  3LQI A;  4UIX A;  4UIV A;  4NRC A;  4DON A;  4YC9 A;  5L8U A;  5FE2 A;  4O71 A;  4C66 A;  5D7X A;  4QSQ A;  5LUU A;  5E73 A;  4Y03 A;  4YY6 A;  5II1 A;  5H1T A;  5EU1 A;  4TZ2 A;  5D3J A;  4N4I A;  4N3W A;  4O7F A;  4RVR A;  4TT6 A;  4MR5 A;  3D7C A;  5LJ0 A;  3NXB A;  5D3H A;  5CUB A;  5AME A;  2RNY A;  5D3L A;  5F60 A;  5ENC A;  3UVY A;  5D3R A;  4N4F A;  4UIZ A;  4Q0N A;  5DKD A;  3SVF A;  2RO1 A;  5HFR A;  5L98 A;  5TCM A;  4MEO A;  3ZYU A;  5JWM A;  4KV4 A;  5HRX A;  4QSW A;  5KTU A;  2YDW A;  5E9Y A;  5IGK A;  5EWW A;  5HEL A;  5FE5 A;  5HQ6 A;  2YEM A;  5D25 A;  2D9E A;  4NYV A;  5FBX A;  4MR3 A;  4LZR A;  5ENG A;  4BW2 A;  3JVK A;  2DVV A;  4YAB A;  4QSX A;  3O37 A;  4PCE A;  5I40 A;  4KCX A;  4TT4 A;  4YH3 A;  4NYW A;  4QBM A;  4UYE A;  4QSU A;  4PTB A;  3LXJ A;  5EIS A;  3O33 A;  4IOQ A;  4TQN A;  4UYD A;  4HXM A;  5HRV A;  4CUT A;  2YYN A;  4YBS A;  2GRC A;  3MB4 A;  4NUD A;  5DFD A;  5CUC A;  5L97 A;  5C8G A;  4PCI A;  4XY9 A;  4ALG A;  5F63 A;  5FE4 A;  3U5N A;  2YW5 A;  3MQM A;  4TU6 A;  4CFL A;  3UW9 A;  2R10 A;  4HXP A;  2I8N A;  4O75 A;  5BT3 A;  4GPJ A;  4NS5 A;  5E74 A;  5FE7 A;  4MR4 A;  4O7E A;  4XY8 A;  3QZS A;  5I7X A;  3HMF A;  2YEL A;  4QST A;  4Z93 A;  5EPS A;  4ZW1 A;  5I1Q A;  5E7D A;  5FG5 A;  4YBM A;  5I88 A;  4TT2 A;  2R0S A;  4YAD A;  5ETB A;  4NR5 A;  5ENJ A;  5DYX A;  4QC3 A;  1F68 A;  4A9M A;  5FE3 A;  4A9J A;  4CUP A;  4NR4 A;  3SVH A;  4J1P A;  5CPE A;  4O7C A;  3O36 A;  5H85 A;  5I83 A;  4XUB A;  5LKX A;  5E9K A;  4Q0O A;  5ENI A;  3IU5 A;  3G0L A;  3U5J A;  4O7A A;  5DYA A;  3UV5 A;  4NUC A;  3U5K A;  5KU3 A;  3IU6 A;  3U5P A;  5F36 A;  2L85 A;  5E9I A;  5EQ1 A;  5K29 A;  1JSP B;  4OGI A;  5F25 A;  5LVR A;  5I7Y A;  5FH6 A;  5IGM A;  5I29 A;  5DKH A;  2DWW A;  5A82 A;  2DVQ A;  4IOO A;  2D82 A;  4QEU A;  4UIW A;  4YYH A;  5CFW A;  4ZQL A;  4TU4 A;  4LC2 A;  2RNX A;  5HJC A;  5I80 A;  4LYI A;  2L84 A;  5FB0 A;  3UVW A;  5DBM A;  2RFJ A;  5A5R A;  4QSV A;  4NRB A;  5LVQ A;  4QSP A;  2DKW A;  3LJW A;  5KTW A;  4MEP A;  5FG4 A;  5EM3 A;  5FH7 A;  4YAT A;  4IR6 A;  5HEN A;  5C87 A;  4HBX A;  5EI4 A;  5IID A;  5CUG A;  4HBW A;  4CFK A;  5D26 A;  5A5Q A;  2H60 A;  4O7B A;  4QNS A;  4WHW A;  5CP5 A;  5FFW A;  4AKN A;  5FG6 A;  4TS8 A;  4KV1 A;  5CUD A;  4YBT A;  4IR3 A;  3P1E A;  4LYW A;  4UYF B;  5A5S A;  5C89 A;  5G4S A;  5ENB A;  4YYM A;  5KHM A;  4Z6H A;  5KTX A;  5ENE A;  2R0Y A;  5LJ1 A;  4UIT A;  4O70 A;  5FB1 A;  2F6J A;  4BW3 A;  3JVM A;  4QSS A;  5HFQ A;  5FDZ A;  5F61 A;  4YYI A;  3AAD A;  4MR6 A;  3QZV A;  1ZS5 A;  4IR5 A;  4CLB A;  5J0D A;  4QUU A;  4XUA A;  1E6I A;  1EQF A;  4PS5 A;  5F3A A;  5AD3 A;  5HLS A;  5FH8 A;  4QYD A;  4BJX A;  3HMH A;  3QZT A;  5EPB A;  4TYL A;  5EVA A;  5CQT A;  5IGL A;  4CUS A;  1X0J A;  4NQN A;  3Q2F A;  4NXJ A;  3S92 A;  4O77 A;  4IOR A;  3P1F A;  5EWD A;  4A9I A;  5A5N A;  5AD2 A;  2YQD A;  3MUK A;  3ONI A;  5DFB A;  5E9M A;  5HRW A;  3FKM X;  5EWH A;  3JVJ A;  5F1L A;  4HXK A;  3P1D A;  5CZG A;  5CQ7 A;  5A5O A;  5CRZ A;  3K2J A;  3MUL A;  4QB3 A;  2FSA A;  4MEQ A;  5DKC A;  3MB3 A;  5C4Q A;  4ALH A;  4ZC9 A;  5L99 A;  5FE0 A;  4HXS A;  2RNW A;  3S91 A;  4CL9 A;  5FE8 A;  5DW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...