4TTEA

Crystal structure of atad2a bromodomain complexed with methyl 3-amino-5-(3,5-dimethyl-1,2-oxazol-4-yl)benzoate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
b'SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPase family AAA domain-containing protein 2
publication title Observed bromodomain flexibility reveals histone peptide- and small molecule ligand-compatible forms of ATAD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4tteA00
5H85A 4YABA 4NYXA 4XY8A 4BW1A 4Z1SA 5CQ6A 2R0SA 4WHUA 5CUBA 5D3PA 4QEUA 3UVYA 5C87A 5CUCA 4Z6HA 5A5RA 2WP2A 5CQTA 4YY4A 4CUPA 4HBYA 5HQ7A 3HMEA 3MUKA 5LVRA 1WUGA 4Y03A 3JVMA 4NR4A 4QBMA 4NYVA 4QYDA 5CZGA 5L99A 3DWYA 5CPEA 5A5SA 4QSWA 4IR6A 3G0JA 5E3GA 4TYLA 4TU6A 5A7CA 5IGNA 5FFWA 5H1VA 4UITA 4HXPA 2RNYA 5ENIA 4HBXA 4OUFA 4QC3A 2D9EA 5I1QA 3HMFA 1JSPB 4A9NA 2FSAA 4YYHA 4O75A 5F2PA 3UV4A 4UYHA 2NXBA 5EM3A 5F61A 4C67A 5EWHA 2F6NA 4O70A 4LYIA 2RFJA 4YYDA 4O77A 4ZQLA 5DBMA 4A9LA 5CS8A 4NRCA 3U5OA 5E0RA 4N4IA 3RCWA 4N3WA 4GPJA 3U5LA 2YEKA 5KTUA 4N4FA 5EWDA 5F25A 5E9YA 4KV1A 4IOQA 4BW4A 5KHMA 4Q0OA 5JI8A 4TT2A 5CP5A 5H1UA 4MEOA 4NQNA 3MXFA 4YBTA 4C66A 5F3AA 5HM0A 4HXMA 4UYFB 5DYAA 4PS5A 4ZW1A 5HRVA 3MB3A 4O78A 4O74A 5CTLA 4CFLA 4O7BA 4WHWA 5L98A 3S92A 5AD2A 5EWCA 4MEQA 5KTXA 4LZSA 5CUEA 4TS8A 5D24A 2RI7A 4Z6IA 4O7EA 4YATA 5D0CA 3FKMX 4BJXA 4CL9A 4J1PA 5E7DA 4AKNA 3DAIA 4DONA 4IR5A 5G4RA 4MR3A 5D3LA 4O7CA 5E9KA 4YYKA 5C85A 4OGIA 4QB3A 5FE1A 2DVSA 4YYMA 3NXBA 3ZYUA 5DYCA 4HXOA 4ALGA 5EV9A 5KO4A 3U5NA 3I3JA 5ENCA 5ENBA 2YEMA 5FE9A 5DX4A 4X2IA 4MR6A 1E6IA 3SVGA 4QSUA 3UV2A 4QSQA 5FE4A 5HCLA 3O33A 2R10A 5F63A 3QZSA 5F60A 5D3JA 4IR4A 5L96A 5A81A 4QR5A 5FG5A 5D25A 5HRXA 5CUAA 5EVAA 4NR5A 5LJ2A 4PCEA 5BT3A 4UIXA 4A9HA 2OUOA 3HMHA 5HFQA 3UV5A 5FH6A 4QNSA 5E9IA 5ENGA 5IGKA 2DVQA 5CQ8A 5E73A 4TZ8A 2L5EA 5D3RA 5K29A 4QSSA 2YDWA 5CQ5A 4HBVA 5I29A 5FE8A 4WIVA 5EISA 4YADA 2F6JA 4J3IA 2R0VA 4QY4A 5F1HA 5DLXA 4QSXA 5ENHA 5DLZA 5C4QA 3JVKA 4YK0A 5D3HA 4NRAA 4O76A 4LC2A 2OO1A 5EI4A 4UIUA 4O7AA 4PTBA 5I86A 4BW2A 5HEMA 4YC9A 3IU5A 2YQDA 5A5PA 4LRGA 5LKZA 2YW5A 4J0SA 4O7FA 5EK9A 5ETDA 1ZS5A 5FE7A 5EQ1A 3O34A 3MQMA 5LUUA 1F68A 5ENJA 5KU3A 4UYEA 3UW9A 4UYFA 5CY9A 4HXRA 5G4SA 5FE6A 2L84A 2LSPB 5A85A 4MEPA 4A9JA 5E9MA 3LQHA 5C7NA 4CUSA 5HQ5A 3AQAA 5COIA 5L97A 2DKWA 4TZ2A 1EQFA 2KTBB 2RNWA 5HRWA 5LKTA 5ETBA 5CQ4A 5II1A 5EPRA 4FLPA 4IOOA 3Q2FA 4QSPA 4HXLA 5FH8A 4QC1A 5EWWA 5EICA 4TT4A 5CUDA 5CFWA 5FG4A 4Q0NA 2RNXA 5CRMA 4N4GA 4A9KA 2RS9B 4NQMA 4NUEA 5F5ZA 4NS5A 5L8TA 4XUBA 4YBSA 5E74A 5IGLA 4UIVA 1WUMA 5TCMA 2D82A 2I7KA 2DWWA 5EGUA 4YYJA 3QZTA 3JVJA 2DVRA 4NYWA 5F1LA 3U5KA 4QSVA 4UIYA 5FE2A 3P1DA 4KV4A 5BT5A 4MR4A 4TT6A 4HXSA 5ENEA 4HBWA 5D3SA 5IG6A 3QZVA 5EPSA 5DKHA 3P1EA 5II2A 3G0LA 3AADA 5CRZA 5EWVA 3UVWA 5FE0A 5DFDA 5FG6A 5D3NA 4LR6A 5D26A 4Z93A 5E3DA 5EU1A 4CFKA 5DYUA 4LYWA 5AMFA 4LDFA 4O71A 4YH4A 4YBMA 4LZ2A 5J0DA 5F36A 5LVQA 4BHWA 3O36A 4CLBA 5C8GA 5IGMA 2H60A 5HFRA 5FB0A 5D3TA 4NR6A 5I89A 3P1CA 3P1FA 3UVXA 4QYLA 4TTEA 5H1TA 5LKUA 5I7XA 5A5OA 2YELA 5IIDA 4Z1QA 4YY6A 5F62A 1JM4B 5E9VA 5LJ0A 3O35A 5EP7A 4QUUA 4QUTA 4CURA 2OSSA 5ACYA 4QSTA 4XY9A 5AD3A 4UYDA 4XYAA 5DW1A 3U5PA 4NUCA 4YYGA 4MR5A 4J0RA 5FBXA 5IBNA 3LQJA 4HXKA 4NXJA 4CUUA 4CUQA 5A83A 5CU8A 4ZC9A 3MB4A 4UIZA 2E3KA 4YAXA 3O37A 5BT4A 5LKXA 5I88A 4QR3A 5JWMA 5HLSA 3D7CA 5I7YA 4XUAA 5HENA 5DKDA 4QR4A 3LJWA 5E9LA 2RO1A 4N4HA 5EA1A 4PCIA 4E96A 4RVRA 4HXNA 3U5JA 2I8NA 5KTWA 4IR3A 4UYGA 5DW2A 4UIWA 5DY7A 5ENFA 5A5QA 4A9FA 4IORA 3P5OA 3UVDA 4ALHA 5CQAA 4LZRA 4PKLA 3IU6A 2GRCA 3GG3A 4KCXA 5HELA 3ONIA 4A9IA 4NR8A 5CQ7A 5FB1A 5DFBA 5A5NA 3MULA 4QSRA 5FE3A 5HQ6A 1X0JA 5AMEA 3LXJA 4QEWA 1N72A 3Q2EA 2DATA 4F3IA 5LJ1A 5DFCA 3TLPA 4NR7A 5FFYA 4A9OA 2R0YA 3U5MA 4BW3A 5DYXA 5EPBA 2E7OA 4YH3A 5C89A 5DKCA 5I83A 5A82A 4TU4A 4LYSA 4TQNA 4YYNA 5TB6A 4NUDA 4CUTA 4QZSA 3JVLA 2G4AA 2YYNA 3SVFA 5CQ3A 4NR9A 4PY6A 5CUGA 2E7NA 5FDZA 5CGPA 4OGJA 5FE5A 4MENA 3LQIA 5FFVA 4NRBA 5HJCA 4O72A 2L85A 5FH7A 5L8UA 4QEVA 4A9EA 5I40A 3SVHA 5D7XA 2MJVB 2WP1A 4A9MA 3K2JA 5I80A 2DVVA 2N9GA 4YYIA 3S91A
chains in the Genus database with same CATH superfamily
5H85A 4YABA 4NYXA 4XY8A 4BW1A 4Z1SA 5CQ6A 2R0SA 4WHUA 5CUBA 5D3PA 4QEUA 3UVYA 5C87A 5CUCA 4Z6HA 5A5RA 2WP2A 5CQTA 4YY4A 4CUPA 4HBYA 5HQ7A 3HMEA 3MUKA 3ERRA 5LVRA 1WUGA 3D1DA 4Y03A 3JVMA 4NR4A 4QBMA 4NYVA 4QYDA 5CZGA 5L99A 3DWYA 5CPEA 5A5SA 4QSWA 4IR6A 3G0JA 5E3GA 4TYLA 4TU6A 5A7CA 5IGNA 5FFWA 5H1VA 4UITA 4HXPA 2RNYA 5ENIA 4HBXA 4OUFA 4QC3A 2D9EA 5I1QA 3HMFA 1JSPB 4A9NA 2FSAA 4YYHA 4O75A 5F2PA 3UV4A 4UYHA 2NXBA 5EM3A 5F61A 4C67A 5EWHA 2F6NA 4O70A 4LYIA 2RFJA 4YYDA 4O77A 4ZQLA 5DBMA 4A9LA 5CS8A 4NRCA 3U5OA 5E0RA 4N4IA 3RCWA 4N3WA 4GPJA 3U5LA 2YEKA 5KTUA 4N4FA 5EWDA 5F25A 5E9YA 4KV1A 4IOQA 4BW4A 5KHMA 4Q0OA 5JI8A 4TT2A 5CP5A 5H1UA 4MEOA 4NQNA 3MXFA 4YBTA 4C66A 5F3AA 5HM0A 4HXMA 4UYFB 5DYAA 4PS5A 4ZW1A 5HRVA 3MB3A 4O78A 4O74A 5CTLA 4CFLA 4O7BA 4WHWA 5L98A 3S92A 5AD2A 5EWCA 4MEQA 5KTXA 3D1BA 4LZSA 5CUEA 4TS8A 5D24A 2RI7A 4Z6IA 4O7EA 4YATA 5D0CA 3FKMX 4BJXA 4CL9A 4J1PA 5E7DA 4AKNA 3DAIA 4DONA 4IR5A 5G4RA 4MR3A 5D3LA 4O7CA 5E9KA 4YYKA 5C85A 4OGIA 4QB3A 5FE1A 2DVSA 4YYMA 3NXBA 3ZYUA 5DYCA 4HXOA 4ALGA 5EV9A 5KO4A 3U5NA 3I3JA 5ENCA 5ENBA 2YEMA 5FE9A 5DX4A 4X2IA 4MR6A 1E6IA 3SVGA 4QSUA 3UV2A 4QSQA 5FE4A 5HCLA 3O33A 2R10A 5F63A 3QZSA 5F60A 5D3JA 4IR4A 5L96A 5A81A 4QR5A 5FG5A 5D25A 5HRXA 5CUAA 5EVAA 4NR5A 5LJ2A 4PCEA 5BT3A 4UIXA 4A9HA 2OUOA 3HMHA 5HFQA 3UV5A 5FH6A 4QNSA 5E9IA 5ENGA 5IGKA 2DVQA 5CQ8A 5E73A 4TZ8A 2L5EA 5D3RA 5K29A 4QSSA 2YDWA 5CQ5A 4HBVA 5I29A 5FE8A 4WIVA 5EISA 4YADA 2F6JA 4J3IA 2R0VA 4QY4A 5F1HA 5DLXA 4QSXA 5ENHA 5DLZA 5C4QA 3JVKA 4YK0A 5D3HA 4NRAA 4O76A 4LC2A 2OO1A 5EI4A 4UIUA 4O7AA 4PTBA 5I86A 4BW2A 5HEMA 4YC9A 3IU5A 2YQDA 5A5PA 4LRGA 5LKZA 2YW5A 4J0SA 4O7FA 5EK9A 5ETDA 1ZS5A 5FE7A 5EQ1A 3O34A 3MQMA 5LUUA 1F68A 5ENJA 5KU3A 4UYEA 3UW9A 4UYFA 5CY9A 4HXRA 5G4SA 5FE6A 2L84A 2LSPB 5A85A 4MEPA 4A9JA 5E9MA 3LQHA 5C7NA 4CUSA 5HQ5A 3AQAA 5COIA 5L97A 2DKWA 4TZ2A 1EQFA 2KTBB 2RNWA 5HRWA 5LKTA 5ETBA 5CQ4A 5II1A 5EPRA 4FLPA 4IOOA 1PUOA 3Q2FA 4QSPA 4HXLA 5FH8A 4QC1A 5EWWA 5EICA 4TT4A 5CUDA 5CFWA 5FG4A 4Q0NA 2RNXA 5CRMA 4N4GA 4A9KA 2RS9B 4NQMA 4NUEA 5F5ZA 4NS5A 5L8TA 4XUBA 4YBSA 5E74A 5IGLA 4UIVA 1WUMA 5TCMA 2D82A 2I7KA 2DWWA 5EGUA 4YYJA 3QZTA 3JVJA 4AKHA 2DVRA 4NYWA 5F1LA 3U5KA 4QSVA 4UIYA 5FE2A 3P1DA 4KV4A 5BT5A 4MR4A 4TT6A 3VKGA 4HXSA 5ENEA 4HBWA 5D3SA 5IG6A 3QZVA 5EPSA 5DKHA 3P1EA 5II2A 3G0LA 3AADA 5CRZA 5EWVA 3UVWA 5FE0A 5DFDA 5FG6A 5D3NA 4LR6A 5D26A 4Z93A 5E3DA 5EU1A 4CFKA 5DYUA 4LYWA 5AMFA 4LDFA 4O71A 4YH4A 4YBMA 4LZ2A 5J0DA 5F36A 5LVQA 4BHWA 3O36A 4CLBA 5C8GA 5IGMA 2H60A 5HFRA 5FB0A 5D3TA 4NR6A 5I89A 3P1CA 3P1FA 3UVXA 1ZKRA 4QYLA 4TTEA 5H1TA 5LKUA 5I7XA 4AKGA 5A5OA 2YELA 5IIDA 4Z1QA 4YY6A 5F62A 1JM4B 5E9VA 5LJ0A 3O35A 5EP7A 4QUUA 4QUTA 2EJNA 4CURA 2OSSA 5ACYA 4QSTA 4XY9A 5AD3A 4UYDA 4XYAA 5DW1A 3U5PA 4NUCA 4YYGA 4MR5A 4J0RA 5FBXA 5IBNA 3LQJA 4HXKA 4NXJA 4CUUA 4CUQA 3VKHA 5A83A 5CU8A 4ZC9A 3MB4A 4UIZA 2E3KA 4YAXA 3O37A 5BT4A 5LKXA 5I88A 4QR3A 5JWMA 5HLSA 3D7CA 5I7YA 4XUAA 5HENA 5DKDA 4QR4A 3LJWA 5E9LA 2RO1A 4N4HA 5EA1A 4PCIA 4E96A 4RVRA 4HXNA 3U5JA 2I8NA 5KTWA 4IR3A 4UYGA 5DW2A 4UIWA 5DY7A 5ENFA 5A5QA 4A9FA 4IORA 3P5OA 3UVDA 4ALHA 5CQAA 4LZRA 4PKLA 4AI6A 3IU6A 2GRCA 3GG3A 4KCXA 5HELA 3ONIA 4A9IA 4NR8A 5CQ7A 4AKIA 5FB1A 5DFBA 5A5NA 3MULA 4QSRA 5FE3A 5HQ6A 1X0JA 5AMEA 3LXJA 4QEWA 1N72A 3Q2EA 2DATA 4F3IA 5LJ1A 5DFCA 3TLPA 4NR7A 5FFYA 4A9OA 2R0YA 3U5MA 4BW3A 5DYXA 5EPBA 2E7OA 4YH3A 5C89A 5DKCA 5I83A 5A82A 4TU4A 4LYSA 4TQNA 4YYNA 5TB6A 4NUDA 4CUTA 4QZSA 3JVLA 2G4AA 2YYNA 3SVFA 5CQ3A 4NR9A 4PY6A 5CUGA 2E7NA 5FDZA 5CGPA 4OGJA 5FE5A 4MENA 3LQIA 5FFVA 4NRBA 5HJCA 4O72A 2L85A 5FH7A 5L8UA 4QEVA 4A9EA 5I40A 3SVHA 5D7XA 2MJVB 2WP1A 4A9MA 3K2JA 5I80A 2DVVA 2N9GA 4YYIA 3S91A
chains in the Genus database with same CATH topology
5H85A 4YABA 4NYXA 4XY8A 4BW1A 4Z1SA 5CQ6A 2R0SA 4WHUA 5CUBA 5D3PA 4QEUA 3UVYA 5C87A 5CUCA 4Z6HA 5A5RA 2WP2A 5CQTA 4YY4A 4CUPA 4HBYA 5HQ7A 3HMEA 3MUKA 5LVRA 1WUGA 4Y03A 3JVMA 4NR4A 4QBMA 4NYVA 4QYDA 5CZGA 5L99A 3DWYA 5CPEA 5A5SA 4QSWA 4IR6A 3G0JA 5E3GA 4TYLA 4TU6A 5A7CA 5IGNA 5FFWA 5H1VA 4UITA 4HXPA 2RNYA 5ENIA 4HBXA 4OUFA 4QC3A 2D9EA 5I1QA 3HMFA 1JSPB 4A9NA 2FSAA 4YYHA 4O75A 5F2PA 3UV4A 4UYHA 2NXBA 5EM3A 5F61A 4C67A 5EWHA 2F6NA 4O70A 4LYIA 2RFJA 4YYDA 4O77A 4ZQLA 5DBMA 4A9LA 5CS8A 4NRCA 3U5OA 5E0RA 4N4IA 3RCWA 4N3WA 4GPJA 3U5LA 2YEKA 5KTUA 4N4FA 5EWDA 5F25A 5E9YA 4KV1A 4IOQA 4BW4A 5KHMA 4Q0OA 5JI8A 4TT2A 5CP5A 5H1UA 4MEOA 4NQNA 3MXFA 4YBTA 4C66A 5F3AA 5HM0A 4HXMA 4UYFB 5DYAA 4PS5A 4ZW1A 5HRVA 3MB3A 4O78A 4O74A 5CTLA 4CFLA 4O7BA 4WHWA 5L98A 3S92A 5AD2A 5EWCA 4MEQA 5KTXA 4LZSA 5CUEA 4TS8A 5D24A 2RI7A 4Z6IA 4O7EA 4YATA 5D0CA 3FKMX 4BJXA 4CL9A 4J1PA 5E7DA 4AKNA 3DAIA 4DONA 4IR5A 5G4RA 4MR3A 5D3LA 4O7CA 5E9KA 4YYKA 5C85A 4OGIA 4QB3A 5FE1A 2DVSA 4YYMA 3NXBA 3ZYUA 5DYCA 4HXOA 4ALGA 5EV9A 5KO4A 3U5NA 3I3JA 5ENCA 5ENBA 2YEMA 5FE9A 5DX4A 4X2IA 4MR6A 1E6IA 3SVGA 4QSUA 3UV2A 4QSQA 5FE4A 5HCLA 3O33A 2R10A 5F63A 3QZSA 5F60A 5D3JA 4IR4A 5L96A 5A81A 4QR5A 5FG5A 5D25A 5HRXA 5CUAA 5EVAA 4NR5A 5LJ2A 4PCEA 5BT3A 4UIXA 4A9HA 2OUOA 3HMHA 5HFQA 3UV5A 5FH6A 4QNSA 5E9IA 5ENGA 5IGKA 2DVQA 5CQ8A 5E73A 4TZ8A 2L5EA 5D3RA 5K29A 4QSSA 2YDWA 5CQ5A 4HBVA 5I29A 5FE8A 4WIVA 5EISA 4YADA 2F6JA 4J3IA 2R0VA 4QY4A 5F1HA 5DLXA 4QSXA 5ENHA 5DLZA 5C4QA 3JVKA 4YK0A 5D3HA 4NRAA 4O76A 4LC2A 2OO1A 5EI4A 4UIUA 4O7AA 4PTBA 5I86A 4BW2A 5HEMA 4YC9A 3IU5A 2YQDA 5A5PA 4LRGA 5LKZA 2YW5A 4J0SA 4O7FA 5EK9A 5ETDA 1ZS5A 5FE7A 5EQ1A 3O34A 3MQMA 5LUUA 1F68A 5ENJA 5KU3A 4UYEA 3UW9A 4UYFA 5CY9A 4HXRA 5G4SA 5FE6A 2L84A 2LSPB 5A85A 4MEPA 4A9JA 5E9MA 3LQHA 5C7NA 4CUSA 5HQ5A 3AQAA 5COIA 5L97A 2DKWA 4TZ2A 1EQFA 2KTBB 2RNWA 5HRWA 5LKTA 5ETBA 5CQ4A 5II1A 5EPRA 4FLPA 4IOOA 3Q2FA 4QSPA 4HXLA 5FH8A 4QC1A 5EWWA 5EICA 4TT4A 5CUDA 5CFWA 5FG4A 4Q0NA 2RNXA 5CRMA 4N4GA 4A9KA 2RS9B 4NQMA 4NUEA 5F5ZA 4NS5A 5L8TA 4XUBA 4YBSA 5E74A 5IGLA 4UIVA 1WUMA 5TCMA 2D82A 2I7KA 2DWWA 5EGUA 4YYJA 3QZTA 3JVJA 2DVRA 4NYWA 5F1LA 3U5KA 4QSVA 4UIYA 5FE2A 3P1DA 4KV4A 5BT5A 4MR4A 4TT6A 4HXSA 5ENEA 4HBWA 5D3SA 5IG6A 3QZVA 5EPSA 5DKHA 3P1EA 5II2A 3G0LA 3AADA 5CRZA 5EWVA 3UVWA 5FE0A 5DFDA 5FG6A 5D3NA 4LR6A 5D26A 4Z93A 5E3DA 5EU1A 4CFKA 5DYUA 4LYWA 5AMFA 4LDFA 4O71A 4YH4A 4YBMA 4LZ2A 5J0DA 5F36A 5LVQA 4BHWA 3O36A 4CLBA 5C8GA 5IGMA 2H60A 5HFRA 5FB0A 5D3TA 4NR6A 5I89A 3P1CA 3P1FA 3UVXA 4QYLA 4TTEA 5H1TA 5LKUA 5I7XA 5A5OA 2YELA 5IIDA 4Z1QA 4YY6A 5F62A 1JM4B 5E9VA 5LJ0A 3O35A 5EP7A 4QUUA 4QUTA 4CURA 2OSSA 5ACYA 4QSTA 4XY9A 5AD3A 4UYDA 4XYAA 5DW1A 3U5PA 4NUCA 4YYGA 4MR5A 4J0RA 5FBXA 5IBNA 3LQJA 4HXKA 4NXJA 4CUUA 4CUQA 5A83A 5CU8A 4ZC9A 3MB4A 4UIZA 2E3KA 4YAXA 3O37A 5BT4A 5LKXA 5I88A 4QR3A 5JWMA 5HLSA 3D7CA 5I7YA 4XUAA 5HENA 5DKDA 4QR4A 3LJWA 5E9LA 2RO1A 4N4HA 5EA1A 4PCIA 4E96A 4RVRA 4HXNA 3U5JA 2I8NA 5KTWA 4IR3A 4UYGA 5DW2A 4UIWA 5DY7A 5ENFA 5A5QA 4A9FA 4IORA 3P5OA 3UVDA 4ALHA 5CQAA 4LZRA 4PKLA 3IU6A 2GRCA 3GG3A 4KCXA 5HELA 3ONIA 4A9IA 4NR8A 5CQ7A 5FB1A 5DFBA 5A5NA 3MULA 4QSRA 5FE3A 5HQ6A 1X0JA 5AMEA 3LXJA 4QEWA 1N72A 3Q2EA 2DATA 4F3IA 5LJ1A 5DFCA 3TLPA 4NR7A 5FFYA 4A9OA 2R0YA 3U5MA 4BW3A 5DYXA 5EPBA 2E7OA 4YH3A 5C89A 5DKCA 5I83A 5A82A 4TU4A 4LYSA 4TQNA 4YYNA 5TB6A 4NUDA 4CUTA 4QZSA 3JVLA 2G4AA 2YYNA 3SVFA 5CQ3A 4NR9A 4PY6A 5CUGA 2E7NA 5FDZA 5CGPA 4OGJA 5FE5A 4MENA 3LQIA 5FFVA 4NRBA 5HJCA 4O72A 2L85A 5FH7A 5L8UA 4QEVA 4A9EA 5I40A 3SVHA 5D7XA 2MJVB 2WP1A 4A9MA 3K2JA 5I80A 2DVVA 2N9GA 4YYIA 3S91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H85 A;  4YAB A;  4NYX A;  4XY8 A;  4BW1 A;  4Z1S A;  5CQ6 A;  2R0S A;  4WHU A;  5CUB A;  5D3P A;  4QEU A;  3UVY A;  5C87 A;  5CUC A;  4Z6H A;  5A5R A;  2WP2 A;  5CQT A;  4YY4 A;  4CUP A;  4HBY A;  5HQ7 A;  3HME A;  3MUK A;  5LVR A;  1WUG A;  4Y03 A;  3JVM A;  4NR4 A;  4QBM A;  4NYV A;  4QYD A;  5CZG A;  5L99 A;  3DWY A;  5CPE A;  5A5S A;  4QSW A;  4IR6 A;  3G0J A;  5E3G A;  4TYL A;  4TU6 A;  5A7C A;  5IGN A;  5FFW A;  5H1V A;  4UIT A;  4HXP A;  2RNY A;  5ENI A;  4HBX A;  4OUF A;  4QC3 A;  2D9E A;  5I1Q A;  3HMF A;  1JSP B;  4A9N A;  2FSA A;  4YYH A;  4O75 A;  5F2P A;  3UV4 A;  4UYH A;  2NXB A;  5EM3 A;  5F61 A;  4C67 A;  5EWH A;  2F6N A;  4O70 A;  4LYI A;  2RFJ A;  4YYD A;  4O77 A;  4ZQL A;  5DBM A;  4A9L A;  5CS8 A;  4NRC A;  3U5O A;  5E0R A;  4N4I A;  3RCW A;  4N3W A;  4GPJ A;  3U5L A;  2YEK A;  5KTU A;  4N4F A;  5EWD A;  5F25 A;  5E9Y A;  4KV1 A;  4IOQ A;  4BW4 A;  5KHM A;  4Q0O A;  5JI8 A;  4TT2 A;  5CP5 A;  5H1U A;  4MEO A;  4NQN A;  3MXF A;  4YBT A;  4C66 A;  5F3A A;  5HM0 A;  4HXM A;  4UYF B;  5DYA A;  4PS5 A;  4ZW1 A;  5HRV A;  3MB3 A;  4O78 A;  4O74 A;  5CTL A;  4CFL A;  4O7B A;  4WHW A;  5L98 A;  3S92 A;  5AD2 A;  5EWC A;  4MEQ A;  5KTX A;  4LZS A;  5CUE A;  4TS8 A;  5D24 A;  2RI7 A;  4Z6I A;  4O7E A;  4YAT A;  5D0C A;  3FKM X;  4BJX A;  4CL9 A;  4J1P A;  5E7D A;  4AKN A;  3DAI A;  4DON A;  4IR5 A;  5G4R A;  4MR3 A;  5D3L A;  4O7C A;  5E9K A;  4YYK A;  5C85 A;  4OGI A;  4QB3 A;  5FE1 A;  2DVS A;  4YYM A;  3NXB A;  3ZYU A;  5DYC A;  4HXO A;  4ALG A;  5EV9 A;  5KO4 A;  3U5N A;  3I3J A;  5ENC A;  5ENB A;  2YEM A;  5FE9 A;  5DX4 A;  4X2I A;  4MR6 A;  1E6I A;  3SVG A;  4QSU A;  3UV2 A;  4QSQ A;  5FE4 A;  5HCL A;  3O33 A;  2R10 A;  5F63 A;  3QZS A;  5F60 A;  5D3J A;  4IR4 A;  5L96 A;  5A81 A;  4QR5 A;  5FG5 A;  5D25 A;  5HRX A;  5CUA A;  5EVA A;  4NR5 A;  5LJ2 A;  4PCE A;  5BT3 A;  4UIX A;  4A9H A;  2OUO A;  3HMH A;  5HFQ A;  3UV5 A;  5FH6 A;  4QNS A;  5E9I A;  5ENG A;  5IGK A;  2DVQ A;  5CQ8 A;  5E73 A;  4TZ8 A;  2L5E A;  5D3R A;  5K29 A;  4QSS A;  2YDW A;  5CQ5 A;  4HBV A;  5I29 A;  5FE8 A;  4WIV A;  5EIS A;  4YAD A;  2F6J A;  4J3I A;  2R0V A;  4QY4 A;  5F1H A;  5DLX A;  4QSX A;  5ENH A;  5DLZ A;  5C4Q A;  3JVK A;  4YK0 A;  5D3H A;  4NRA A;  4O76 A;  4LC2 A;  2OO1 A;  5EI4 A;  4UIU A;  4O7A A;  4PTB A;  5I86 A;  4BW2 A;  5HEM A;  4YC9 A;  3IU5 A;  2YQD A;  5A5P A;  4LRG A;  5LKZ A;  2YW5 A;  4J0S A;  4O7F A;  5EK9 A;  5ETD A;  1ZS5 A;  5FE7 A;  5EQ1 A;  3O34 A;  3MQM A;  5LUU A;  1F68 A;  5ENJ A;  5KU3 A;  4UYE A;  3UW9 A;  4UYF A;  5CY9 A;  4HXR A;  5G4S A;  5FE6 A;  2L84 A;  2LSP B;  5A85 A;  4MEP A;  4A9J A;  5E9M A;  3LQH A;  5C7N A;  4CUS A;  5HQ5 A;  3AQA A;  5COI A;  5L97 A;  2DKW A;  4TZ2 A;  1EQF A;  2KTB B;  2RNW A;  5HRW A;  5LKT A;  5ETB A;  5CQ4 A;  5II1 A;  5EPR A;  4FLP A;  4IOO A;  3Q2F A;  4QSP A;  4HXL A;  5FH8 A;  4QC1 A;  5EWW A;  5EIC A;  4TT4 A;  5CUD A;  5CFW A;  5FG4 A;  4Q0N A;  2RNX A;  5CRM A;  4N4G A;  4A9K A;  2RS9 B;  4NQM A;  4NUE A;  5F5Z A;  4NS5 A;  5L8T A;  4XUB A;  4YBS A;  5E74 A;  5IGL A;  4UIV A;  1WUM A;  5TCM A;  2D82 A;  2I7K A;  2DWW A;  5EGU A;  4YYJ A;  3QZT A;  3JVJ A;  2DVR A;  4NYW A;  5F1L A;  3U5K A;  4QSV A;  4UIY A;  5FE2 A;  3P1D A;  4KV4 A;  5BT5 A;  4MR4 A;  4TT6 A;  4HXS A;  5ENE A;  4HBW A;  5D3S A;  5IG6 A;  3QZV A;  5EPS A;  5DKH A;  3P1E A;  5II2 A;  3G0L A;  3AAD A;  5CRZ A;  5EWV A;  3UVW A;  5FE0 A;  5DFD A;  5FG6 A;  5D3N A;  4LR6 A;  5D26 A;  4Z93 A;  5E3D A;  5EU1 A;  4CFK A;  5DYU A;  4LYW A;  5AMF A;  4LDF A;  4O71 A;  4YH4 A;  4YBM A;  4LZ2 A;  5J0D A;  5F36 A;  5LVQ A;  4BHW A;  3O36 A;  4CLB A;  5C8G A;  5IGM A;  2H60 A;  5HFR A;  5FB0 A;  5D3T A;  4NR6 A;  5I89 A;  3P1C A;  3P1F A;  3UVX A;  4QYL A;  4TTE A;  5H1T A;  5LKU A;  5I7X A;  5A5O A;  2YEL A;  5IID A;  4Z1Q A;  4YY6 A;  5F62 A;  1JM4 B;  5E9V A;  5LJ0 A;  3O35 A;  5EP7 A;  4QUU A;  4QUT A;  4CUR A;  2OSS A;  5ACY A;  4QST A;  4XY9 A;  5AD3 A;  4UYD A;  4XYA A;  5DW1 A;  3U5P A;  4NUC A;  4YYG A;  4MR5 A;  4J0R A;  5FBX A;  5IBN A;  3LQJ A;  4HXK A;  4NXJ A;  4CUU A;  4CUQ A;  5A83 A;  5CU8 A;  4ZC9 A;  3MB4 A;  4UIZ A;  2E3K A;  4YAX A;  3O37 A;  5BT4 A;  5LKX A;  5I88 A;  4QR3 A;  5JWM A;  5HLS A;  3D7C A;  5I7Y A;  4XUA A;  5HEN A;  5DKD A;  4QR4 A;  3LJW A;  5E9L A;  2RO1 A;  4N4H A;  5EA1 A;  4PCI A;  4E96 A;  4RVR A;  4HXN A;  3U5J A;  2I8N A;  5KTW A;  4IR3 A;  4UYG A;  5DW2 A;  4UIW A;  5DY7 A;  5ENF A;  5A5Q A;  4A9F A;  4IOR A;  3P5O A;  3UVD A;  4ALH A;  5CQA A;  4LZR A;  4PKL A;  3IU6 A;  2GRC A;  3GG3 A;  4KCX A;  5HEL A;  3ONI A;  4A9I A;  4NR8 A;  5CQ7 A;  5FB1 A;  5DFB A;  5A5N A;  3MUL A;  4QSR A;  5FE3 A;  5HQ6 A;  1X0J A;  5AME A;  3LXJ A;  4QEW A;  1N72 A;  3Q2E A;  2DAT A;  4F3I A;  5LJ1 A;  5DFC A;  3TLP A;  4NR7 A;  5FFY A;  4A9O A;  2R0Y A;  3U5M A;  4BW3 A;  5DYX A;  5EPB A;  2E7O A;  4YH3 A;  5C89 A;  5DKC A;  5I83 A;  5A82 A;  4TU4 A;  4LYS A;  4TQN A;  4YYN A;  5TB6 A;  4NUD A;  4CUT A;  4QZS A;  3JVL A;  2G4A A;  2YYN A;  3SVF A;  5CQ3 A;  4NR9 A;  4PY6 A;  5CUG A;  2E7N A;  5FDZ A;  5CGP A;  4OGJ A;  5FE5 A;  4MEN A;  3LQI A;  5FFV A;  4NRB A;  5HJC A;  4O72 A;  2L85 A;  5FH7 A;  5L8U A;  4QEV A;  4A9E A;  5I40 A;  3SVH A;  5D7X A;  2MJV B;  2WP1 A;  4A9M A;  3K2J A;  5I80 A;  2DVV A;  2N9G A;  4YYI A;  3S91 A; 
#chains in the Genus database with same CATH topology
 5H85 A;  4YAB A;  4NYX A;  4XY8 A;  4BW1 A;  4Z1S A;  5CQ6 A;  2R0S A;  4WHU A;  5CUB A;  5D3P A;  4QEU A;  3UVY A;  5C87 A;  5CUC A;  4Z6H A;  5A5R A;  2WP2 A;  5CQT A;  4YY4 A;  4CUP A;  4HBY A;  5HQ7 A;  3HME A;  3MUK A;  3ERR A;  5LVR A;  1WUG A;  3D1D A;  4Y03 A;  3JVM A;  4NR4 A;  4QBM A;  4NYV A;  4QYD A;  5CZG A;  5L99 A;  3DWY A;  5CPE A;  5A5S A;  4QSW A;  4IR6 A;  3G0J A;  5E3G A;  4TYL A;  4TU6 A;  5A7C A;  5IGN A;  5FFW A;  5H1V A;  4UIT A;  4HXP A;  2RNY A;  5ENI A;  4HBX A;  4OUF A;  4QC3 A;  2D9E A;  5I1Q A;  3HMF A;  1JSP B;  4A9N A;  2FSA A;  4YYH A;  4O75 A;  5F2P A;  3UV4 A;  4UYH A;  2NXB A;  5EM3 A;  5F61 A;  4C67 A;  5EWH A;  2F6N A;  4O70 A;  4LYI A;  2RFJ A;  4YYD A;  4O77 A;  4ZQL A;  5DBM A;  4A9L A;  5CS8 A;  4NRC A;  3U5O A;  5E0R A;  4N4I A;  3RCW A;  4N3W A;  4GPJ A;  3U5L A;  2YEK A;  5KTU A;  4N4F A;  5EWD A;  5F25 A;  5E9Y A;  4KV1 A;  4IOQ A;  4BW4 A;  5KHM A;  4Q0O A;  5JI8 A;  4TT2 A;  5CP5 A;  5H1U A;  4MEO A;  4NQN A;  3MXF A;  4YBT A;  4C66 A;  5F3A A;  5HM0 A;  4HXM A;  4UYF B;  5DYA A;  4PS5 A;  4ZW1 A;  5HRV A;  3MB3 A;  4O78 A;  4O74 A;  5CTL A;  4CFL A;  4O7B A;  4WHW A;  5L98 A;  3S92 A;  5AD2 A;  5EWC A;  4MEQ A;  5KTX A;  3D1B A;  4LZS A;  5CUE A;  4TS8 A;  5D24 A;  2RI7 A;  4Z6I A;  4O7E A;  4YAT A;  5D0C A;  3FKM X;  4BJX A;  4CL9 A;  4J1P A;  5E7D A;  4AKN A;  3DAI A;  4DON A;  4IR5 A;  5G4R A;  4MR3 A;  5D3L A;  4O7C A;  5E9K A;  4YYK A;  5C85 A;  4OGI A;  4QB3 A;  5FE1 A;  2DVS A;  4YYM A;  3NXB A;  3ZYU A;  5DYC A;  4HXO A;  4ALG A;  5EV9 A;  5KO4 A;  3U5N A;  3I3J A;  5ENC A;  5ENB A;  2YEM A;  5FE9 A;  5DX4 A;  4X2I A;  4MR6 A;  1E6I A;  3SVG A;  4QSU A;  3UV2 A;  4QSQ A;  5FE4 A;  5HCL A;  3O33 A;  2R10 A;  5F63 A;  3QZS A;  5F60 A;  5D3J A;  4IR4 A;  5L96 A;  5A81 A;  4QR5 A;  5FG5 A;  5D25 A;  5HRX A;  5CUA A;  5EVA A;  4NR5 A;  5LJ2 A;  4PCE A;  5BT3 A;  4UIX A;  4A9H A;  2OUO A;  3HMH A;  5HFQ A;  3UV5 A;  5FH6 A;  4QNS A;  5E9I A;  5ENG A;  5IGK A;  2DVQ A;  5CQ8 A;  5E73 A;  4TZ8 A;  2L5E A;  5D3R A;  5K29 A;  4QSS A;  2YDW A;  5CQ5 A;  4HBV A;  5I29 A;  5FE8 A;  4WIV A;  5EIS A;  4YAD A;  2F6J A;  4J3I A;  2R0V A;  4QY4 A;  5F1H A;  5DLX A;  4QSX A;  5ENH A;  5DLZ A;  5C4Q A;  3JVK A;  4YK0 A;  5D3H A;  4NRA A;  4O76 A;  4LC2 A;  2OO1 A;  5EI4 A;  4UIU A;  4O7A A;  4PTB A;  5I86 A;  4BW2 A;  5HEM A;  4YC9 A;  3IU5 A;  2YQD A;  5A5P A;  4LRG A;  5LKZ A;  2YW5 A;  4J0S A;  4O7F A;  5EK9 A;  5ETD A;  1ZS5 A;  5FE7 A;  5EQ1 A;  3O34 A;  3MQM A;  5LUU A;  1F68 A;  5ENJ A;  5KU3 A;  4UYE A;  3UW9 A;  4UYF A;  5CY9 A;  4HXR A;  5G4S A;  5FE6 A;  2L84 A;  2LSP B;  5A85 A;  4MEP A;  4A9J A;  5E9M A;  3LQH A;  5C7N A;  4CUS A;  5HQ5 A;  3AQA A;  5COI A;  5L97 A;  2DKW A;  4TZ2 A;  1EQF A;  2KTB B;  2RNW A;  5HRW A;  5LKT A;  5ETB A;  5CQ4 A;  5II1 A;  5EPR A;  4FLP A;  4IOO A;  1PUO A;  3Q2F A;  4QSP A;  4HXL A;  5FH8 A;  4QC1 A;  5EWW A;  5EIC A;  4TT4 A;  5CUD A;  5CFW A;  5FG4 A;  4Q0N A;  2RNX A;  5CRM A;  4N4G A;  4A9K A;  2RS9 B;  4NQM A;  4NUE A;  5F5Z A;  4NS5 A;  5L8T A;  4XUB A;  4YBS A;  5E74 A;  5IGL A;  4UIV A;  1WUM A;  5TCM A;  2D82 A;  2I7K A;  2DWW A;  5EGU A;  4YYJ A;  3QZT A;  3JVJ A;  4AKH A;  2DVR A;  4NYW A;  5F1L A;  3U5K A;  4QSV A;  4UIY A;  5FE2 A;  3P1D A;  4KV4 A;  5BT5 A;  4MR4 A;  4TT6 A;  3VKG A;  4HXS A;  5ENE A;  4HBW A;  5D3S A;  5IG6 A;  3QZV A;  5EPS A;  5DKH A;  3P1E A;  5II2 A;  3G0L A;  3AAD A;  5CRZ A;  5EWV A;  3UVW A;  5FE0 A;  5DFD A;  5FG6 A;  5D3N A;  4LR6 A;  5D26 A;  4Z93 A;  5E3D A;  5EU1 A;  4CFK A;  5DYU A;  4LYW A;  5AMF A;  4LDF A;  4O71 A;  4YH4 A;  4YBM A;  4LZ2 A;  5J0D A;  5F36 A;  5LVQ A;  4BHW A;  3O36 A;  4CLB A;  5C8G A;  5IGM A;  2H60 A;  5HFR A;  5FB0 A;  5D3T A;  4NR6 A;  5I89 A;  3P1C A;  3P1F A;  3UVX A;  1ZKR A;  4QYL A;  4TTE A;  5H1T A;  5LKU A;  5I7X A;  4AKG A;  5A5O A;  2YEL A;  5IID A;  4Z1Q A;  4YY6 A;  5F62 A;  1JM4 B;  5E9V A;  5LJ0 A;  3O35 A;  5EP7 A;  4QUU A;  4QUT A;  2EJN A;  4CUR A;  2OSS A;  5ACY A;  4QST A;  4XY9 A;  5AD3 A;  4UYD A;  4XYA A;  5DW1 A;  3U5P A;  4NUC A;  4YYG A;  4MR5 A;  4J0R A;  5FBX A;  5IBN A;  3LQJ A;  4HXK A;  4NXJ A;  4CUU A;  4CUQ A;  3VKH A;  5A83 A;  5CU8 A;  4ZC9 A;  3MB4 A;  4UIZ A;  2E3K A;  4YAX A;  3O37 A;  5BT4 A;  5LKX A;  5I88 A;  4QR3 A;  5JWM A;  5HLS A;  3D7C A;  5I7Y A;  4XUA A;  5HEN A;  5DKD A;  4QR4 A;  3LJW A;  5E9L A;  2RO1 A;  4N4H A;  5EA1 A;  4PCI A;  4E96 A;  4RVR A;  4HXN A;  3U5J A;  2I8N A;  5KTW A;  4IR3 A;  4UYG A;  5DW2 A;  4UIW A;  5DY7 A;  5ENF A;  5A5Q A;  4A9F A;  4IOR A;  3P5O A;  3UVD A;  4ALH A;  5CQA A;  4LZR A;  4PKL A;  4AI6 A;  3IU6 A;  2GRC A;  3GG3 A;  4KCX A;  5HEL A;  3ONI A;  4A9I A;  4NR8 A;  5CQ7 A;  4AKI A;  5FB1 A;  5DFB A;  5A5N A;  3MUL A;  4QSR A;  5FE3 A;  5HQ6 A;  1X0J A;  5AME A;  3LXJ A;  4QEW A;  1N72 A;  3Q2E A;  2DAT A;  4F3I A;  5LJ1 A;  5DFC A;  3TLP A;  4NR7 A;  5FFY A;  4A9O A;  2R0Y A;  3U5M A;  4BW3 A;  5DYX A;  5EPB A;  2E7O A;  4YH3 A;  5C89 A;  5DKC A;  5I83 A;  5A82 A;  4TU4 A;  4LYS A;  4TQN A;  4YYN A;  5TB6 A;  4NUD A;  4CUT A;  4QZS A;  3JVL A;  2G4A A;  2YYN A;  3SVF A;  5CQ3 A;  4NR9 A;  4PY6 A;  5CUG A;  2E7N A;  5FDZ A;  5CGP A;  4OGJ A;  5FE5 A;  4MEN A;  3LQI A;  5FFV A;  4NRB A;  5HJC A;  4O72 A;  2L85 A;  5FH7 A;  5L8U A;  4QEV A;  4A9E A;  5I40 A;  3SVH A;  5D7X A;  2MJV B;  2WP1 A;  4A9M A;  3K2J A;  5I80 A;  2DVV A;  2N9G A;  4YYI A;  3S91 A; 
#chains in the Genus database with same CATH homology
 5H85 A;  4YAB A;  4NYX A;  4XY8 A;  4BW1 A;  4Z1S A;  5CQ6 A;  2R0S A;  4WHU A;  5CUB A;  5D3P A;  4QEU A;  3UVY A;  5C87 A;  5CUC A;  4Z6H A;  5A5R A;  2WP2 A;  5CQT A;  4YY4 A;  4CUP A;  4HBY A;  5HQ7 A;  3HME A;  3MUK A;  5LVR A;  1WUG A;  4Y03 A;  3JVM A;  4NR4 A;  4QBM A;  4NYV A;  4QYD A;  5CZG A;  5L99 A;  3DWY A;  5CPE A;  5A5S A;  4QSW A;  4IR6 A;  3G0J A;  5E3G A;  4TYL A;  4TU6 A;  5A7C A;  5IGN A;  5FFW A;  5H1V A;  4UIT A;  4HXP A;  2RNY A;  5ENI A;  4HBX A;  4OUF A;  4QC3 A;  2D9E A;  5I1Q A;  3HMF A;  1JSP B;  4A9N A;  2FSA A;  4YYH A;  4O75 A;  5F2P A;  3UV4 A;  4UYH A;  2NXB A;  5EM3 A;  5F61 A;  4C67 A;  5EWH A;  2F6N A;  4O70 A;  4LYI A;  2RFJ A;  4YYD A;  4O77 A;  4ZQL A;  5DBM A;  4A9L A;  5CS8 A;  4NRC A;  3U5O A;  5E0R A;  4N4I A;  3RCW A;  4N3W A;  4GPJ A;  3U5L A;  2YEK A;  5KTU A;  4N4F A;  5EWD A;  5F25 A;  5E9Y A;  4KV1 A;  4IOQ A;  4BW4 A;  5KHM A;  4Q0O A;  5JI8 A;  4TT2 A;  5CP5 A;  5H1U A;  4MEO A;  4NQN A;  3MXF A;  4YBT A;  4C66 A;  5F3A A;  5HM0 A;  4HXM A;  4UYF B;  5DYA A;  4PS5 A;  4ZW1 A;  5HRV A;  3MB3 A;  4O78 A;  4O74 A;  5CTL A;  4CFL A;  4O7B A;  4WHW A;  5L98 A;  3S92 A;  5AD2 A;  5EWC A;  4MEQ A;  5KTX A;  4LZS A;  5CUE A;  4TS8 A;  5D24 A;  2RI7 A;  4Z6I A;  4O7E A;  4YAT A;  5D0C A;  3FKM X;  4BJX A;  4CL9 A;  4J1P A;  5E7D A;  4AKN A;  3DAI A;  4DON A;  4IR5 A;  5G4R A;  4MR3 A;  5D3L A;  4O7C A;  5E9K A;  4YYK A;  5C85 A;  4OGI A;  4QB3 A;  5FE1 A;  2DVS A;  4YYM A;  3NXB A;  3ZYU A;  5DYC A;  4HXO A;  4ALG A;  5EV9 A;  5KO4 A;  3U5N A;  3I3J A;  5ENC A;  5ENB A;  2YEM A;  5FE9 A;  5DX4 A;  4X2I A;  4MR6 A;  1E6I A;  3SVG A;  4QSU A;  3UV2 A;  4QSQ A;  5FE4 A;  5HCL A;  3O33 A;  2R10 A;  5F63 A;  3QZS A;  5F60 A;  5D3J A;  4IR4 A;  5L96 A;  5A81 A;  4QR5 A;  5FG5 A;  5D25 A;  5HRX A;  5CUA A;  5EVA A;  4NR5 A;  5LJ2 A;  4PCE A;  5BT3 A;  4UIX A;  4A9H A;  2OUO A;  3HMH A;  5HFQ A;  3UV5 A;  5FH6 A;  4QNS A;  5E9I A;  5ENG A;  5IGK A;  2DVQ A;  5CQ8 A;  5E73 A;  4TZ8 A;  2L5E A;  5D3R A;  5K29 A;  4QSS A;  2YDW A;  5CQ5 A;  4HBV A;  5I29 A;  5FE8 A;  4WIV A;  5EIS A;  4YAD A;  2F6J A;  4J3I A;  2R0V A;  4QY4 A;  5F1H A;  5DLX A;  4QSX A;  5ENH A;  5DLZ A;  5C4Q A;  3JVK A;  4YK0 A;  5D3H A;  4NRA A;  4O76 A;  4LC2 A;  2OO1 A;  5EI4 A;  4UIU A;  4O7A A;  4PTB A;  5I86 A;  4BW2 A;  5HEM A;  4YC9 A;  3IU5 A;  2YQD A;  5A5P A;  4LRG A;  5LKZ A;  2YW5 A;  4J0S A;  4O7F A;  5EK9 A;  5ETD A;  1ZS5 A;  5FE7 A;  5EQ1 A;  3O34 A;  3MQM A;  5LUU A;  1F68 A;  5ENJ A;  5KU3 A;  4UYE A;  3UW9 A;  4UYF A;  5CY9 A;  4HXR A;  5G4S A;  5FE6 A;  2L84 A;  2LSP B;  5A85 A;  4MEP A;  4A9J A;  5E9M A;  3LQH A;  5C7N A;  4CUS A;  5HQ5 A;  3AQA A;  5COI A;  5L97 A;  2DKW A;  4TZ2 A;  1EQF A;  2KTB B;  2RNW A;  5HRW A;  5LKT A;  5ETB A;  5CQ4 A;  5II1 A;  5EPR A;  4FLP A;  4IOO A;  3Q2F A;  4QSP A;  4HXL A;  5FH8 A;  4QC1 A;  5EWW A;  5EIC A;  4TT4 A;  5CUD A;  5CFW A;  5FG4 A;  4Q0N A;  2RNX A;  5CRM A;  4N4G A;  4A9K A;  2RS9 B;  4NQM A;  4NUE A;  5F5Z A;  4NS5 A;  5L8T A;  4XUB A;  4YBS A;  5E74 A;  5IGL A;  4UIV A;  1WUM A;  5TCM A;  2D82 A;  2I7K A;  2DWW A;  5EGU A;  4YYJ A;  3QZT A;  3JVJ A;  2DVR A;  4NYW A;  5F1L A;  3U5K A;  4QSV A;  4UIY A;  5FE2 A;  3P1D A;  4KV4 A;  5BT5 A;  4MR4 A;  4TT6 A;  4HXS A;  5ENE A;  4HBW A;  5D3S A;  5IG6 A;  3QZV A;  5EPS A;  5DKH A;  3P1E A;  5II2 A;  3G0L A;  3AAD A;  5CRZ A;  5EWV A;  3UVW A;  5FE0 A;  5DFD A;  5FG6 A;  5D3N A;  4LR6 A;  5D26 A;  4Z93 A;  5E3D A;  5EU1 A;  4CFK A;  5DYU A;  4LYW A;  5AMF A;  4LDF A;  4O71 A;  4YH4 A;  4YBM A;  4LZ2 A;  5J0D A;  5F36 A;  5LVQ A;  4BHW A;  3O36 A;  4CLB A;  5C8G A;  5IGM A;  2H60 A;  5HFR A;  5FB0 A;  5D3T A;  4NR6 A;  5I89 A;  3P1C A;  3P1F A;  3UVX A;  4QYL A;  4TTE A;  5H1T A;  5LKU A;  5I7X A;  5A5O A;  2YEL A;  5IID A;  4Z1Q A;  4YY6 A;  5F62 A;  1JM4 B;  5E9V A;  5LJ0 A;  3O35 A;  5EP7 A;  4QUU A;  4QUT A;  4CUR A;  2OSS A;  5ACY A;  4QST A;  4XY9 A;  5AD3 A;  4UYD A;  4XYA A;  5DW1 A;  3U5P A;  4NUC A;  4YYG A;  4MR5 A;  4J0R A;  5FBX A;  5IBN A;  3LQJ A;  4HXK A;  4NXJ A;  4CUU A;  4CUQ A;  5A83 A;  5CU8 A;  4ZC9 A;  3MB4 A;  4UIZ A;  2E3K A;  4YAX A;  3O37 A;  5BT4 A;  5LKX A;  5I88 A;  4QR3 A;  5JWM A;  5HLS A;  3D7C A;  5I7Y A;  4XUA A;  5HEN A;  5DKD A;  4QR4 A;  3LJW A;  5E9L A;  2RO1 A;  4N4H A;  5EA1 A;  4PCI A;  4E96 A;  4RVR A;  4HXN A;  3U5J A;  2I8N A;  5KTW A;  4IR3 A;  4UYG A;  5DW2 A;  4UIW A;  5DY7 A;  5ENF A;  5A5Q A;  4A9F A;  4IOR A;  3P5O A;  3UVD A;  4ALH A;  5CQA A;  4LZR A;  4PKL A;  3IU6 A;  2GRC A;  3GG3 A;  4KCX A;  5HEL A;  3ONI A;  4A9I A;  4NR8 A;  5CQ7 A;  5FB1 A;  5DFB A;  5A5N A;  3MUL A;  4QSR A;  5FE3 A;  5HQ6 A;  1X0J A;  5AME A;  3LXJ A;  4QEW A;  1N72 A;  3Q2E A;  2DAT A;  4F3I A;  5LJ1 A;  5DFC A;  3TLP A;  4NR7 A;  5FFY A;  4A9O A;  2R0Y A;  3U5M A;  4BW3 A;  5DYX A;  5EPB A;  2E7O A;  4YH3 A;  5C89 A;  5DKC A;  5I83 A;  5A82 A;  4TU4 A;  4LYS A;  4TQN A;  4YYN A;  5TB6 A;  4NUD A;  4CUT A;  4QZS A;  3JVL A;  2G4A A;  2YYN A;  3SVF A;  5CQ3 A;  4NR9 A;  4PY6 A;  5CUG A;  2E7N A;  5FDZ A;  5CGP A;  4OGJ A;  5FE5 A;  4MEN A;  3LQI A;  5FFV A;  4NRB A;  5HJC A;  4O72 A;  2L85 A;  5FH7 A;  5L8U A;  4QEV A;  4A9E A;  5I40 A;  3SVH A;  5D7X A;  2MJV B;  2WP1 A;  4A9M A;  3K2J A;  5I80 A;  2DVV A;  2N9G A;  4YYI A;  3S91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...