4TTEA

Crystal structure of atad2a bromodomain complexed with methyl 3-amino-5-(3,5-dimethyl-1,2-oxazol-4-yl)benzoate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
130
structure length
130
Chain Sequence
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords ATPase family AAA domain-containing protein 2
publication title Observed bromodomain flexibility reveals histone peptide- and small molecule ligand-compatible forms of ATAD2.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 130
sequence length 130
ec nomenclature ec 3.6.1.3: Adenosinetriphosphatase.
pdb deposition date 2014-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4tteA00
5CUDA 5K29A 4UYEA 3HMHA 5FE9A 4XY8A 5IBNA 2DKWA 4UITA 5KTXA 5ENEA 3DWYA 5A82A 5ETDA 4UIXA 2DVRA 4CLBA 5HRVA 3U5JA 4QSPA 4N4HA 5FE6A 5LKXA 5IGKA 4CUTA 3U5MA 5HQ6A 5FE5A 3IU5A 4UIVA 5D3JA 5DFDA 2F6NA 4QSWA 5EICA 2L84A 4UIUA 5DLZA 5AMEA 2DVSA 3P1CA 4QNSA 5LJ2A 3UVYA 4Z1QA 4QSVA 4MR4A 2E7OA 2D9EA 5CQ5A 5F61A 5E74A 4A9LA 5I89A 5A5SA 4ZQLA 3LQJA 4UYHA 5DKDA 5HCLA 4QSRA 5COIA 5KO4A 4ZC9A 5D0CA 4IOQA 3FKMX 2RNWA 2RO1A 2N9GA 5CFWA 2R0VA 3QZSA 4YBSA 5H1UA 4PCEA 1N72A 4HXLA 4LYSA 5CY9A 4RVRA 5FE0A 4O70A 5CU8A 4KV4A 5J0DA 4NR5A 2DVVA 4UIWA 4OUFA 2I7KA 5E9KA 2E7NA 4IOOA 4LZRA 4YYKA 5DYCA 5AMFA 5D3LA 5LKTA 3D7CA 4NRAA 5FE7A 5IIDA 2L5EA 5ENGA 5HFRA 4IORA 4Q0OA 5A7CA 4YC9A 3G0JA 4MR6A 4NRCA 2MJVB 4NR4A 5F25A 3LXJA 4O7CA 5L96A 4YYGA 5L98A 2YELA 3QZTA 4IR3A 4CUPA 5I83A 5I40A 4UIZA 3UW9A 4HXKA 4NXJA 5FE3A 5FG5A 1JSPB 2RI7A 3O37A 4BJXA 4X2IA 5EISA 4O77A 4YBTA 2WP1A 4ALGA 4BHWA 5DKHA 1F68A 3UVXA 5ENFA 5FBXA 4PS5A 5CRMA 3SVHA 4NRBA 4QR3A 5FG6A 4NR7A 4QYDA 5C87A 3P5OA 4Z6IA 5A5PA 5D3SA 4NYVA 4J3IA 4LZ2A 5CGPA 5C8GA 5JI8A 5CZGA 5EPSA 5EQ1A 4O7EA 4BW1A 5F1HA 5I7XA 3P1FA 4QY4A 3P1EA 4NS5A 5C7NA 2R10A 4YADA 4PKLA 4A9FA 3UVWA 5DW2A 5LJ0A 5CP5A 4CUSA 4Z93A 2GRCA 2RNYA 3JVKA 3SVFA 4TTEA 5E0RA 2I8NA 4NUCA 4YABA 3RCWA 4LC2A 4OGJA 3LQHA 4MENA 3MB3A 2E3KA 2YEKA 5F1LA 4E96A 5HENA 4NUEA 4N4IA 5EPBA 1WUMA 1JM4B 4QUTA 4A9EA 1WUGA 5D3PA 5ENHA 5CQAA 5CUBA 4YY6A 5BT4A 2R0SA 4IR6A 4A9JA 2H60A 4BW3A 2FSAA 5AD3A 4WHUA 5EI4A 5EA1A 4CFKA 4YH3A 5DX4A 5I1QA 5A5QA 3O33A 3AQAA 5E7DA 4A9KA 5I7YA 5II1A 3UV4A 4GPJA 5DFBA 4MR5A 4NYWA 5CRZA 4UIYA 5I88A 4O74A 4YY4A 5EWDA 5EWCA 4WHWA 4TZ8A 4YBMA 4QEWA 5F60A 4HXMA 5C85A 4CL9A 5LJ1A 3IU6A 3P1DA 2RNXA 4LYIA 4TT4A 4A9MA 4CUQA 3SVGA 1E6IA 4A9OA 4YYNA 3U5NA 5D24A 2L85A 3TLPA 4O78A 5EV9A 5HEMA 3UV2A 5G4RA 4O75A 4QSTA 4QSUA 5KU3A 5HLSA 5CUGA 2NXBA 4Y03A 5FE1A 5DY7A 2F6JA 4PCIA 4QR5A 4QC1A 4TT2A 3JVMA 4Q0NA 5E9VA 3U5PA 1ZS5A 4CURA 5FE8A 4TS8A 5A5RA 5IGLA 4HBYA 5TCMA 4MR3A 5E73A 4J0RA 5FDZA 5HM0A 4NYXA 5H85A 4HXSA 5D7XA 4O7BA 5CPEA 4ZW1A 5HJCA 3MB4A 4YAXA 5FE2A 5IGNA 4NR6A 5IGMA 2OSSA 2DWWA 3G0LA 5AD2A 2WP2A 5CTLA 5EK9A 4A9IA 3QZVA 4LZSA 5EWVA 4ALHA 4PTBA 5H1TA 5ETBA 4N4GA 4WIVA 4NQMA 5D3RA 5F3AA 5EWWA 5DYXA 4YYMA 4TYLA 5L8TA 4A9NA 4CUUA 3MQMA 5HRXA 5D26A 4QSXA 5F63A 4YH4A 5FB1A 5L99A 4O7AA 5F2PA 5E9YA 4HXOA 3U5KA 2YQDA 4XUBA 3JVLA 3UV5A 5I80A 3Q2FA 2LSPB 2D82A 4XYAA 5FB0A 5E9IA 5ENJA 5I86A 5FE4A 2R0YA 4YYJA 3JVJA 5FH6A 4LYWA 4C66A 5HELA 4HBXA 4MEQA 5DBMA 4NR9A 3ZYUA 5KTUA 4NUDA 3MXFA 5C89A 5L8UA 5G4SA 5HFQA 4HBWA 4O76A 4LDFA 4NR8A 3LQIA 4FLPA 3U5OA 5A83A 1EQFA 4LRGA 5H1VA 5EPRA 3K2JA 3O35A 4HBVA 5A81A 5I29A 4KV1A 5E9LA 5D25A 2YW5A 4YK0A 4DONA 4QBMA 5EP7A 5DFCA 4TT6A 2YEMA 3ONIA 4QEVA 3HMEA 5L97A 4Z6HA 5ACYA 2OUOA 5EM3A 5D3HA 5LKZA 4KCXA 4MEOA 4IR4A 5DLXA 5CQ6A 4F3IA 4UYDA 5LVRA 5CS8A 4O72A 5CQTA 4O7FA 5C4QA 2DVQA 5EU1A 5HQ7A 4TU4A 4QZSA 4OGIA 4UYFB 3U5LA 4QC3A 4QSQA 5LKUA 5DYAA 2G4AA 4J1PA 3AADA 5CUAA 2KTBB 3Q2EA 2RS9B 4A9HA 3LJWA 4LR6A 4QEUA 5F36A 5HRWA 4XY9A 5ENCA 5DKCA 4CFLA 5CQ3A 4UYGA 5D3TA 3GG3A 5TB6A 5LUUA 5A5OA 5HQ5A 2OO1A 5LVQA 4YYDA 5ENIA 4YYIA 5F62A 5CQ7A 3DAIA 4YATA 3I3JA 5E3GA 4HXPA 5ENBA 3MUKA 4N3WA 5F5ZA 5CQ8A 3S91A 5A5NA 5EVAA 4O71A 4AKNA 5FFWA 5E3DA 4QB3A 4QYLA 4BW2A 5DYUA 5DW1A 5KHMA 5IG6A 4PY6A 5EGUA 3O36A 5FFVA 4YYHA 4N4FA 2RFJA 4Z1SA 5JWMA 2YDWA 5FH7A 4XUAA 3O34A 3MULA 5BT5A 5FH8A 5BT3A 5FFYA 4BW4A 5FG4A 4TU6A 5CUEA 5II2A 4C67A 4TQNA 5KTWA 2DATA 4NQNA 2YYNA 3HMFA 4HXNA 4IR5A 4QR4A 4J0SA 4QSSA 5EWHA 1X0JA 3NXBA 4TZ2A 5CUCA 5A85A 4UYFA 3UVDA 4MEPA 4HXRA 5E9MA 5D3NA 4QUUA 3S92A 5CQ4A
chains in the Genus database with same CATH superfamily
5CUDA 5K29A 4UYEA 3HMHA 5FE9A 4XY8A 5IBNA 2DKWA 4UITA 5KTXA 5ENEA 3DWYA 5A82A 5ETDA 4UIXA 2DVRA 4CLBA 5HRVA 3U5JA 4QSPA 4N4HA 5FE6A 2EJNA 5IGKA 5LKXA 4CUTA 3U5MA 5HQ6A 5FE5A 3IU5A 4UIVA 5D3JA 5DFDA 2F6NA 4QSWA 5EICA 2L84A 4UIUA 5DLZA 5AMEA 2DVSA 3P1CA 4QNSA 5LJ2A 3UVYA 4Z1QA 4QSVA 4MR4A 2E7OA 2D9EA 5CQ5A 5F61A 5E74A 4A9LA 5I89A 5A5SA 4ZQLA 3LQJA 4UYHA 5DKDA 5HCLA 4QSRA 5COIA 5KO4A 4ZC9A 5D0CA 4IOQA 3FKMX 2RNWA 2RO1A 2N9GA 5CFWA 2R0VA 3QZSA 4YBSA 5H1UA 4PCEA 1N72A 4HXLA 4LYSA 5CY9A 4RVRA 5FE0A 4O70A 5CU8A 4KV4A 5J0DA 4NR5A 2DVVA 4UIWA 4OUFA 2I7KA 5E9KA 2E7NA 4IOOA 4LZRA 4YYKA 5DYCA 5AMFA 5D3LA 5LKTA 3D7CA 4NRAA 5FE7A 5IIDA 2L5EA 5ENGA 5HFRA 4IORA 4Q0OA 5A7CA 4YC9A 3G0JA 4MR6A 4NRCA 2MJVB 4NR4A 5F25A 3LXJA 4O7CA 5L96A 4YYGA 5L98A 2YELA 3QZTA 4IR3A 4CUPA 5I83A 5I40A 4UIZA 3UW9A 4HXKA 4NXJA 5FE3A 5FG5A 1JSPB 2RI7A 3O37A 4BJXA 4X2IA 5EISA 4O77A 4YBTA 2WP1A 4ALGA 4BHWA 5DKHA 1F68A 3UVXA 5ENFA 5FBXA 4PS5A 5CRMA 3SVHA 4NRBA 4QR3A 5FG6A 4NR7A 4QYDA 5C87A 3P5OA 4Z6IA 5A5PA 5D3SA 4NYVA 4J3IA 4LZ2A 5CGPA 5C8GA 5JI8A 5CZGA 5EPSA 5EQ1A 4O7EA 4BW1A 5F1HA 5I7XA 3P1FA 4QY4A 3P1EA 3D1BA 4NS5A 5C7NA 2R10A 4YADA 4PKLA 4A9FA 3UVWA 5DW2A 5LJ0A 5CP5A 4CUSA 4Z93A 2GRCA 2RNYA 3JVKA 3SVFA 4TTEA 5E0RA 2I8NA 4NUCA 4AI6A 4YABA 3RCWA 4LC2A 4OGJA 3LQHA 4MENA 3MB3A 2E3KA 2YEKA 5F1LA 4E96A 5HENA 4NUEA 4N4IA 5EPBA 1WUMA 1JM4B 4QUTA 4A9EA 1WUGA 5D3PA 5ENHA 5CQAA 5CUBA 4YY6A 5BT4A 2R0SA 4IR6A 4A9JA 2H60A 4BW3A 2FSAA 5AD3A 4WHUA 5EI4A 5EA1A 4CFKA 4YH3A 5DX4A 5I1QA 5A5QA 3O33A 3AQAA 5E7DA 4A9KA 5I7YA 5II1A 3UV4A 4GPJA 5DFBA 4MR5A 4NYWA 5CRZA 4UIYA 5I88A 4O74A 4YY4A 5EWDA 5EWCA 4WHWA 4TZ8A 4YBMA 4QEWA 5F60A 4HXMA 5C85A 3VKGA 4CL9A 5LJ1A 3IU6A 3P1DA 2RNXA 4LYIA 4TT4A 4A9MA 4CUQA 3SVGA 1E6IA 4A9OA 4YYNA 3U5NA 5D24A 2L85A 3TLPA 4O78A 5EV9A 5HEMA 3UV2A 5G4RA 4O75A 4QSTA 4QSUA 5KU3A 5HLSA 5CUGA 2NXBA 4Y03A 5FE1A 5DY7A 2F6JA 4PCIA 4QR5A 4QC1A 4TT2A 3VKHA 3JVMA 4Q0NA 5E9VA 3U5PA 1ZS5A 4CURA 5FE8A 4TS8A 5A5RA 5IGLA 4HBYA 5TCMA 4MR3A 5E73A 4J0RA 5FDZA 5HM0A 4NYXA 5H85A 4HXSA 5D7XA 4O7BA 5CPEA 4ZW1A 5HJCA 3MB4A 4YAXA 5FE2A 5IGNA 1ZKRA 4NR6A 5IGMA 2OSSA 4AKIA 2DWWA 3G0LA 5AD2A 2WP2A 5CTLA 5EK9A 4A9IA 3QZVA 4LZSA 5EWVA 4ALHA 4AKGA 4PTBA 5H1TA 5ETBA 4N4GA 4WIVA 4NQMA 5D3RA 5F3AA 5EWWA 5DYXA 4YYMA 4TYLA 5L8TA 4A9NA 4CUUA 3MQMA 5HRXA 5D26A 4QSXA 5F63A 4YH4A 5FB1A 5L99A 4O7AA 5F2PA 5E9YA 4HXOA 3U5KA 2YQDA 4XUBA 3JVLA 3UV5A 5I80A 3Q2FA 2LSPB 2D82A 4XYAA 5FB0A 5E9IA 5ENJA 5I86A 5FE4A 2R0YA 4YYJA 3JVJA 5FH6A 4LYWA 4C66A 5HELA 4HBXA 4MEQA 5DBMA 4NR9A 3ZYUA 5KTUA 3ERRA 4NUDA 3D1DA 3MXFA 5C89A 5L8UA 5G4SA 5HFQA 4HBWA 4O76A 4LDFA 4NR8A 3LQIA 4FLPA 3U5OA 4AKHA 5A83A 1EQFA 4LRGA 5H1VA 5EPRA 3K2JA 3O35A 4HBVA 5A81A 5I29A 4KV1A 5E9LA 5D25A 2YW5A 4YK0A 4DONA 4QBMA 5EP7A 5DFCA 4TT6A 2YEMA 3ONIA 4QEVA 3HMEA 5L97A 4Z6HA 5ACYA 2OUOA 5EM3A 5D3HA 5LKZA 4KCXA 4MEOA 4IR4A 5DLXA 5CQ6A 4F3IA 4UYDA 5LVRA 5CS8A 4O72A 5CQTA 4O7FA 5C4QA 2DVQA 5EU1A 5HQ7A 4TU4A 4QZSA 4OGIA 4UYFB 3U5LA 4QC3A 4QSQA 5LKUA 5DYAA 2G4AA 4J1PA 3AADA 5CUAA 2KTBB 3Q2EA 2RS9B 4A9HA 3LJWA 4LR6A 4QEUA 5F36A 5HRWA 4XY9A 5ENCA 5DKCA 4CFLA 5CQ3A 4UYGA 5D3TA 3GG3A 5TB6A 5LUUA 5A5OA 5HQ5A 2OO1A 5LVQA 4YYDA 5ENIA 4YYIA 5F62A 5CQ7A 3DAIA 4YATA 3I3JA 5E3GA 4HXPA 5ENBA 3MUKA 4N3WA 5F5ZA 5CQ8A 3S91A 5A5NA 5EVAA 4O71A 4AKNA 5FFWA 5E3DA 4QB3A 4QYLA 4BW2A 5DYUA 5DW1A 5KHMA 5IG6A 4PY6A 5EGUA 3O36A 5FFVA 4YYHA 4N4FA 2RFJA 4Z1SA 5JWMA 2YDWA 5FH7A 4XUAA 3O34A 3MULA 5BT5A 5FH8A 5BT3A 5FFYA 4BW4A 5FG4A 4TU6A 1PUOA 5CUEA 5II2A 4C67A 4TQNA 5KTWA 2DATA 4NQNA 2YYNA 3HMFA 4HXNA 4IR5A 4QR4A 4J0SA 4QSSA 5EWHA 1X0JA 3NXBA 4TZ2A 5CUCA 5A85A 4UYFA 3UVDA 4MEPA 4HXRA 5E9MA 5D3NA 4QUUA 3S92A 5CQ4A
chains in the Genus database with same CATH topology
5CUDA 5K29A 4UYEA 3HMHA 5FE9A 4XY8A 5IBNA 2DKWA 4UITA 5KTXA 5ENEA 3DWYA 5A82A 5ETDA 4UIXA 2DVRA 4CLBA 5HRVA 3U5JA 4QSPA 4N4HA 5FE6A 5LKXA 5IGKA 4CUTA 3U5MA 5HQ6A 5FE5A 3IU5A 4UIVA 5D3JA 5DFDA 2F6NA 4QSWA 5EICA 2L84A 4UIUA 5DLZA 5AMEA 2DVSA 3P1CA 4QNSA 5LJ2A 3UVYA 4Z1QA 4QSVA 4MR4A 2E7OA 2D9EA 5CQ5A 5F61A 5E74A 4A9LA 5I89A 5A5SA 4ZQLA 3LQJA 4UYHA 5DKDA 5HCLA 4QSRA 5COIA 5KO4A 4ZC9A 5D0CA 4IOQA 3FKMX 2RNWA 2RO1A 2N9GA 5CFWA 2R0VA 3QZSA 4YBSA 5H1UA 4PCEA 1N72A 4HXLA 4LYSA 5CY9A 4RVRA 5FE0A 4O70A 5CU8A 4KV4A 5J0DA 4NR5A 2DVVA 4UIWA 4OUFA 2I7KA 5E9KA 2E7NA 4IOOA 4LZRA 4YYKA 5DYCA 5AMFA 5D3LA 5LKTA 3D7CA 4NRAA 5FE7A 5IIDA 2L5EA 5ENGA 5HFRA 4IORA 4Q0OA 5A7CA 4YC9A 3G0JA 4MR6A 4NRCA 2MJVB 4NR4A 5F25A 3LXJA 4O7CA 5L96A 4YYGA 5L98A 2YELA 3QZTA 4IR3A 4CUPA 5I83A 5I40A 4UIZA 3UW9A 4HXKA 4NXJA 5FE3A 5FG5A 1JSPB 2RI7A 3O37A 4BJXA 4X2IA 5EISA 4O77A 4YBTA 2WP1A 4ALGA 4BHWA 5DKHA 1F68A 3UVXA 5ENFA 5FBXA 4PS5A 5CRMA 3SVHA 4NRBA 4QR3A 5FG6A 4NR7A 4QYDA 5C87A 3P5OA 4Z6IA 5A5PA 5D3SA 4NYVA 4J3IA 4LZ2A 5CGPA 5C8GA 5JI8A 5CZGA 5EPSA 5EQ1A 4O7EA 4BW1A 5F1HA 5I7XA 3P1FA 4QY4A 3P1EA 4NS5A 5C7NA 2R10A 4YADA 4PKLA 4A9FA 3UVWA 5DW2A 5LJ0A 5CP5A 4CUSA 4Z93A 2GRCA 2RNYA 3JVKA 3SVFA 4TTEA 5E0RA 2I8NA 4NUCA 4YABA 3RCWA 4LC2A 4OGJA 3LQHA 4MENA 3MB3A 2E3KA 2YEKA 5F1LA 4E96A 5HENA 4NUEA 4N4IA 5EPBA 1WUMA 1JM4B 4QUTA 4A9EA 1WUGA 5D3PA 5ENHA 5CQAA 5CUBA 4YY6A 5BT4A 2R0SA 4IR6A 4A9JA 2H60A 4BW3A 2FSAA 5AD3A 4WHUA 5EI4A 5EA1A 4CFKA 4YH3A 5DX4A 5I1QA 5A5QA 3O33A 3AQAA 5E7DA 4A9KA 5I7YA 5II1A 3UV4A 4GPJA 5DFBA 4MR5A 4NYWA 5CRZA 4UIYA 5I88A 4O74A 4YY4A 5EWDA 5EWCA 4WHWA 4TZ8A 4YBMA 4QEWA 5F60A 4HXMA 5C85A 4CL9A 5LJ1A 3IU6A 3P1DA 2RNXA 4LYIA 4TT4A 4A9MA 4CUQA 3SVGA 1E6IA 4A9OA 4YYNA 3U5NA 5D24A 2L85A 3TLPA 4O78A 5EV9A 5HEMA 3UV2A 5G4RA 4O75A 4QSTA 4QSUA 5KU3A 5HLSA 5CUGA 2NXBA 4Y03A 5FE1A 5DY7A 2F6JA 4PCIA 4QR5A 4QC1A 4TT2A 3JVMA 4Q0NA 5E9VA 3U5PA 1ZS5A 4CURA 5FE8A 4TS8A 5A5RA 5IGLA 4HBYA 5TCMA 4MR3A 5E73A 4J0RA 5FDZA 5HM0A 4NYXA 5H85A 4HXSA 5D7XA 4O7BA 5CPEA 4ZW1A 5HJCA 3MB4A 4YAXA 5FE2A 5IGNA 4NR6A 5IGMA 2OSSA 2DWWA 3G0LA 5AD2A 2WP2A 5CTLA 5EK9A 4A9IA 3QZVA 4LZSA 5EWVA 4ALHA 4PTBA 5H1TA 5ETBA 4N4GA 4WIVA 4NQMA 5D3RA 5F3AA 5EWWA 5DYXA 4YYMA 4TYLA 5L8TA 4A9NA 4CUUA 3MQMA 5HRXA 5D26A 4QSXA 5F63A 4YH4A 5FB1A 5L99A 4O7AA 5F2PA 5E9YA 4HXOA 3U5KA 2YQDA 4XUBA 3JVLA 3UV5A 5I80A 3Q2FA 2LSPB 2D82A 4XYAA 5FB0A 5E9IA 5ENJA 5I86A 5FE4A 2R0YA 4YYJA 3JVJA 5FH6A 4LYWA 4C66A 5HELA 4HBXA 4MEQA 5DBMA 4NR9A 3ZYUA 5KTUA 4NUDA 3MXFA 5C89A 5L8UA 5G4SA 5HFQA 4HBWA 4O76A 4LDFA 4NR8A 3LQIA 4FLPA 3U5OA 5A83A 1EQFA 4LRGA 5H1VA 5EPRA 3K2JA 3O35A 4HBVA 5A81A 5I29A 4KV1A 5E9LA 5D25A 2YW5A 4YK0A 4DONA 4QBMA 5EP7A 5DFCA 4TT6A 2YEMA 3ONIA 4QEVA 3HMEA 5L97A 4Z6HA 5ACYA 2OUOA 5EM3A 5D3HA 5LKZA 4KCXA 4MEOA 4IR4A 5DLXA 5CQ6A 4F3IA 4UYDA 5LVRA 5CS8A 4O72A 5CQTA 4O7FA 5C4QA 2DVQA 5EU1A 5HQ7A 4TU4A 4QZSA 4OGIA 4UYFB 3U5LA 4QC3A 4QSQA 5LKUA 5DYAA 2G4AA 4J1PA 3AADA 5CUAA 2KTBB 3Q2EA 2RS9B 4A9HA 3LJWA 4LR6A 4QEUA 5F36A 5HRWA 4XY9A 5ENCA 5DKCA 4CFLA 5CQ3A 4UYGA 5D3TA 3GG3A 5TB6A 5LUUA 5A5OA 5HQ5A 2OO1A 5LVQA 4YYDA 5ENIA 4YYIA 5F62A 5CQ7A 3DAIA 4YATA 3I3JA 5E3GA 4HXPA 5ENBA 3MUKA 4N3WA 5F5ZA 5CQ8A 3S91A 5A5NA 5EVAA 4O71A 4AKNA 5FFWA 5E3DA 4QB3A 4QYLA 4BW2A 5DYUA 5DW1A 5KHMA 5IG6A 4PY6A 5EGUA 3O36A 5FFVA 4YYHA 4N4FA 2RFJA 4Z1SA 5JWMA 2YDWA 5FH7A 4XUAA 3O34A 3MULA 5BT5A 5FH8A 5BT3A 5FFYA 4BW4A 5FG4A 4TU6A 5CUEA 5II2A 4C67A 4TQNA 5KTWA 2DATA 4NQNA 2YYNA 3HMFA 4HXNA 4IR5A 4QR4A 4J0SA 4QSSA 5EWHA 1X0JA 3NXBA 4TZ2A 5CUCA 5A85A 4UYFA 3UVDA 4MEPA 4HXRA 5E9MA 5D3NA 4QUUA 3S92A 5CQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CUD A;  5K29 A;  4UYE A;  3HMH A;  5FE9 A;  4XY8 A;  5IBN A;  2DKW A;  4UIT A;  5KTX A;  5ENE A;  3DWY A;  5A82 A;  5ETD A;  4UIX A;  2DVR A;  4CLB A;  5HRV A;  3U5J A;  4QSP A;  4N4H A;  5FE6 A;  5LKX A;  5IGK A;  4CUT A;  3U5M A;  5HQ6 A;  5FE5 A;  3IU5 A;  4UIV A;  5D3J A;  5DFD A;  2F6N A;  4QSW A;  5EIC A;  2L84 A;  4UIU A;  5DLZ A;  5AME A;  2DVS A;  3P1C A;  4QNS A;  5LJ2 A;  3UVY A;  4Z1Q A;  4QSV A;  4MR4 A;  2E7O A;  2D9E A;  5CQ5 A;  5F61 A;  5E74 A;  4A9L A;  5I89 A;  5A5S A;  4ZQL A;  3LQJ A;  4UYH A;  5DKD A;  5HCL A;  4QSR A;  5COI A;  5KO4 A;  4ZC9 A;  5D0C A;  4IOQ A;  3FKM X;  2RNW A;  2RO1 A;  2N9G A;  5CFW A;  2R0V A;  3QZS A;  4YBS A;  5H1U A;  4PCE A;  1N72 A;  4HXL A;  4LYS A;  5CY9 A;  4RVR A;  5FE0 A;  4O70 A;  5CU8 A;  4KV4 A;  5J0D A;  4NR5 A;  2DVV A;  4UIW A;  4OUF A;  2I7K A;  5E9K A;  2E7N A;  4IOO A;  4LZR A;  4YYK A;  5DYC A;  5AMF A;  5D3L A;  5LKT A;  3D7C A;  4NRA A;  5FE7 A;  5IID A;  2L5E A;  5ENG A;  5HFR A;  4IOR A;  4Q0O A;  5A7C A;  4YC9 A;  3G0J A;  4MR6 A;  4NRC A;  2MJV B;  4NR4 A;  5F25 A;  3LXJ A;  4O7C A;  5L96 A;  4YYG A;  5L98 A;  2YEL A;  3QZT A;  4IR3 A;  4CUP A;  5I83 A;  5I40 A;  4UIZ A;  3UW9 A;  4HXK A;  4NXJ A;  5FE3 A;  5FG5 A;  1JSP B;  2RI7 A;  3O37 A;  4BJX A;  4X2I A;  5EIS A;  4O77 A;  4YBT A;  2WP1 A;  4ALG A;  4BHW A;  5DKH A;  1F68 A;  3UVX A;  5ENF A;  5FBX A;  4PS5 A;  5CRM A;  3SVH A;  4NRB A;  4QR3 A;  5FG6 A;  4NR7 A;  4QYD A;  5C87 A;  3P5O A;  4Z6I A;  5A5P A;  5D3S A;  4NYV A;  4J3I A;  4LZ2 A;  5CGP A;  5C8G A;  5JI8 A;  5CZG A;  5EPS A;  5EQ1 A;  4O7E A;  4BW1 A;  5F1H A;  5I7X A;  3P1F A;  4QY4 A;  3P1E A;  4NS5 A;  5C7N A;  2R10 A;  4YAD A;  4PKL A;  4A9F A;  3UVW A;  5DW2 A;  5LJ0 A;  5CP5 A;  4CUS A;  4Z93 A;  2GRC A;  2RNY A;  3JVK A;  3SVF A;  4TTE A;  5E0R A;  2I8N A;  4NUC A;  4YAB A;  3RCW A;  4LC2 A;  4OGJ A;  3LQH A;  4MEN A;  3MB3 A;  2E3K A;  2YEK A;  5F1L A;  4E96 A;  5HEN A;  4NUE A;  4N4I A;  5EPB A;  1WUM A;  1JM4 B;  4QUT A;  4A9E A;  1WUG A;  5D3P A;  5ENH A;  5CQA A;  5CUB A;  4YY6 A;  5BT4 A;  2R0S A;  4IR6 A;  4A9J A;  2H60 A;  4BW3 A;  2FSA A;  5AD3 A;  4WHU A;  5EI4 A;  5EA1 A;  4CFK A;  4YH3 A;  5DX4 A;  5I1Q A;  5A5Q A;  3O33 A;  3AQA A;  5E7D A;  4A9K A;  5I7Y A;  5II1 A;  3UV4 A;  4GPJ A;  5DFB A;  4MR5 A;  4NYW A;  5CRZ A;  4UIY A;  5I88 A;  4O74 A;  4YY4 A;  5EWD A;  5EWC A;  4WHW A;  4TZ8 A;  4YBM A;  4QEW A;  5F60 A;  4HXM A;  5C85 A;  4CL9 A;  5LJ1 A;  3IU6 A;  3P1D A;  2RNX A;  4LYI A;  4TT4 A;  4A9M A;  4CUQ A;  3SVG A;  1E6I A;  4A9O A;  4YYN A;  3U5N A;  5D24 A;  2L85 A;  3TLP A;  4O78 A;  5EV9 A;  5HEM A;  3UV2 A;  5G4R A;  4O75 A;  4QST A;  4QSU A;  5KU3 A;  5HLS A;  5CUG A;  2NXB A;  4Y03 A;  5FE1 A;  5DY7 A;  2F6J A;  4PCI A;  4QR5 A;  4QC1 A;  4TT2 A;  3JVM A;  4Q0N A;  5E9V A;  3U5P A;  1ZS5 A;  4CUR A;  5FE8 A;  4TS8 A;  5A5R A;  5IGL A;  4HBY A;  5TCM A;  4MR3 A;  5E73 A;  4J0R A;  5FDZ A;  5HM0 A;  4NYX A;  5H85 A;  4HXS A;  5D7X A;  4O7B A;  5CPE A;  4ZW1 A;  5HJC A;  3MB4 A;  4YAX A;  5FE2 A;  5IGN A;  4NR6 A;  5IGM A;  2OSS A;  2DWW A;  3G0L A;  5AD2 A;  2WP2 A;  5CTL A;  5EK9 A;  4A9I A;  3QZV A;  4LZS A;  5EWV A;  4ALH A;  4PTB A;  5H1T A;  5ETB A;  4N4G A;  4WIV A;  4NQM A;  5D3R A;  5F3A A;  5EWW A;  5DYX A;  4YYM A;  4TYL A;  5L8T A;  4A9N A;  4CUU A;  3MQM A;  5HRX A;  5D26 A;  4QSX A;  5F63 A;  4YH4 A;  5FB1 A;  5L99 A;  4O7A A;  5F2P A;  5E9Y A;  4HXO A;  3U5K A;  2YQD A;  4XUB A;  3JVL A;  3UV5 A;  5I80 A;  3Q2F A;  2LSP B;  2D82 A;  4XYA A;  5FB0 A;  5E9I A;  5ENJ A;  5I86 A;  5FE4 A;  2R0Y A;  4YYJ A;  3JVJ A;  5FH6 A;  4LYW A;  4C66 A;  5HEL A;  4HBX A;  4MEQ A;  5DBM A;  4NR9 A;  3ZYU A;  5KTU A;  4NUD A;  3MXF A;  5C89 A;  5L8U A;  5G4S A;  5HFQ A;  4HBW A;  4O76 A;  4LDF A;  4NR8 A;  3LQI A;  4FLP A;  3U5O A;  5A83 A;  1EQF A;  4LRG A;  5H1V A;  5EPR A;  3K2J A;  3O35 A;  4HBV A;  5A81 A;  5I29 A;  4KV1 A;  5E9L A;  5D25 A;  2YW5 A;  4YK0 A;  4DON A;  4QBM A;  5EP7 A;  5DFC A;  4TT6 A;  2YEM A;  3ONI A;  4QEV A;  3HME A;  5L97 A;  4Z6H A;  5ACY A;  2OUO A;  5EM3 A;  5D3H A;  5LKZ A;  4KCX A;  4MEO A;  4IR4 A;  5DLX A;  5CQ6 A;  4F3I A;  4UYD A;  5LVR A;  5CS8 A;  4O72 A;  5CQT A;  4O7F A;  5C4Q A;  2DVQ A;  5EU1 A;  5HQ7 A;  4TU4 A;  4QZS A;  4OGI A;  4UYF B;  3U5L A;  4QC3 A;  4QSQ A;  5LKU A;  5DYA A;  2G4A A;  4J1P A;  3AAD A;  5CUA A;  2KTB B;  3Q2E A;  2RS9 B;  4A9H A;  3LJW A;  4LR6 A;  4QEU A;  5F36 A;  5HRW A;  4XY9 A;  5ENC A;  5DKC A;  4CFL A;  5CQ3 A;  4UYG A;  5D3T A;  3GG3 A;  5TB6 A;  5LUU A;  5A5O A;  5HQ5 A;  2OO1 A;  5LVQ A;  4YYD A;  5ENI A;  4YYI A;  5F62 A;  5CQ7 A;  3DAI A;  4YAT A;  3I3J A;  5E3G A;  4HXP A;  5ENB A;  3MUK A;  4N3W A;  5F5Z A;  5CQ8 A;  3S91 A;  5A5N A;  5EVA A;  4O71 A;  4AKN A;  5FFW A;  5E3D A;  4QB3 A;  4QYL A;  4BW2 A;  5DYU A;  5DW1 A;  5KHM A;  5IG6 A;  4PY6 A;  5EGU A;  3O36 A;  5FFV A;  4YYH A;  4N4F A;  2RFJ A;  4Z1S A;  5JWM A;  2YDW A;  5FH7 A;  4XUA A;  3O34 A;  3MUL A;  5BT5 A;  5FH8 A;  5BT3 A;  5FFY A;  4BW4 A;  5FG4 A;  4TU6 A;  5CUE A;  5II2 A;  4C67 A;  4TQN A;  5KTW A;  2DAT A;  4NQN A;  2YYN A;  3HMF A;  4HXN A;  4IR5 A;  4QR4 A;  4J0S A;  4QSS A;  5EWH A;  1X0J A;  3NXB A;  4TZ2 A;  5CUC A;  5A85 A;  4UYF A;  3UVD A;  4MEP A;  4HXR A;  5E9M A;  5D3N A;  4QUU A;  3S92 A;  5CQ4 A; 
#chains in the Genus database with same CATH topology
 5CUD A;  5K29 A;  4UYE A;  3HMH A;  5FE9 A;  4XY8 A;  5IBN A;  2DKW A;  4UIT A;  5KTX A;  5ENE A;  3DWY A;  5A82 A;  5ETD A;  4UIX A;  2DVR A;  4CLB A;  5HRV A;  3U5J A;  4QSP A;  4N4H A;  5FE6 A;  2EJN A;  5IGK A;  5LKX A;  4CUT A;  3U5M A;  5HQ6 A;  5FE5 A;  3IU5 A;  4UIV A;  5D3J A;  5DFD A;  2F6N A;  4QSW A;  5EIC A;  2L84 A;  4UIU A;  5DLZ A;  5AME A;  2DVS A;  3P1C A;  4QNS A;  5LJ2 A;  3UVY A;  4Z1Q A;  4QSV A;  4MR4 A;  2E7O A;  2D9E A;  5CQ5 A;  5F61 A;  5E74 A;  4A9L A;  5I89 A;  5A5S A;  4ZQL A;  3LQJ A;  4UYH A;  5DKD A;  5HCL A;  4QSR A;  5COI A;  5KO4 A;  4ZC9 A;  5D0C A;  4IOQ A;  3FKM X;  2RNW A;  2RO1 A;  2N9G A;  5CFW A;  2R0V A;  3QZS A;  4YBS A;  5H1U A;  4PCE A;  1N72 A;  4HXL A;  4LYS A;  5CY9 A;  4RVR A;  5FE0 A;  4O70 A;  5CU8 A;  4KV4 A;  5J0D A;  4NR5 A;  2DVV A;  4UIW A;  4OUF A;  2I7K A;  5E9K A;  2E7N A;  4IOO A;  4LZR A;  4YYK A;  5DYC A;  5AMF A;  5D3L A;  5LKT A;  3D7C A;  4NRA A;  5FE7 A;  5IID A;  2L5E A;  5ENG A;  5HFR A;  4IOR A;  4Q0O A;  5A7C A;  4YC9 A;  3G0J A;  4MR6 A;  4NRC A;  2MJV B;  4NR4 A;  5F25 A;  3LXJ A;  4O7C A;  5L96 A;  4YYG A;  5L98 A;  2YEL A;  3QZT A;  4IR3 A;  4CUP A;  5I83 A;  5I40 A;  4UIZ A;  3UW9 A;  4HXK A;  4NXJ A;  5FE3 A;  5FG5 A;  1JSP B;  2RI7 A;  3O37 A;  4BJX A;  4X2I A;  5EIS A;  4O77 A;  4YBT A;  2WP1 A;  4ALG A;  4BHW A;  5DKH A;  1F68 A;  3UVX A;  5ENF A;  5FBX A;  4PS5 A;  5CRM A;  3SVH A;  4NRB A;  4QR3 A;  5FG6 A;  4NR7 A;  4QYD A;  5C87 A;  3P5O A;  4Z6I A;  5A5P A;  5D3S A;  4NYV A;  4J3I A;  4LZ2 A;  5CGP A;  5C8G A;  5JI8 A;  5CZG A;  5EPS A;  5EQ1 A;  4O7E A;  4BW1 A;  5F1H A;  5I7X A;  3P1F A;  4QY4 A;  3P1E A;  3D1B A;  4NS5 A;  5C7N A;  2R10 A;  4YAD A;  4PKL A;  4A9F A;  3UVW A;  5DW2 A;  5LJ0 A;  5CP5 A;  4CUS A;  4Z93 A;  2GRC A;  2RNY A;  3JVK A;  3SVF A;  4TTE A;  5E0R A;  2I8N A;  4NUC A;  4AI6 A;  4YAB A;  3RCW A;  4LC2 A;  4OGJ A;  3LQH A;  4MEN A;  3MB3 A;  2E3K A;  2YEK A;  5F1L A;  4E96 A;  5HEN A;  4NUE A;  4N4I A;  5EPB A;  1WUM A;  1JM4 B;  4QUT A;  4A9E A;  1WUG A;  5D3P A;  5ENH A;  5CQA A;  5CUB A;  4YY6 A;  5BT4 A;  2R0S A;  4IR6 A;  4A9J A;  2H60 A;  4BW3 A;  2FSA A;  5AD3 A;  4WHU A;  5EI4 A;  5EA1 A;  4CFK A;  4YH3 A;  5DX4 A;  5I1Q A;  5A5Q A;  3O33 A;  3AQA A;  5E7D A;  4A9K A;  5I7Y A;  5II1 A;  3UV4 A;  4GPJ A;  5DFB A;  4MR5 A;  4NYW A;  5CRZ A;  4UIY A;  5I88 A;  4O74 A;  4YY4 A;  5EWD A;  5EWC A;  4WHW A;  4TZ8 A;  4YBM A;  4QEW A;  5F60 A;  4HXM A;  5C85 A;  3VKG A;  4CL9 A;  5LJ1 A;  3IU6 A;  3P1D A;  2RNX A;  4LYI A;  4TT4 A;  4A9M A;  4CUQ A;  3SVG A;  1E6I A;  4A9O A;  4YYN A;  3U5N A;  5D24 A;  2L85 A;  3TLP A;  4O78 A;  5EV9 A;  5HEM A;  3UV2 A;  5G4R A;  4O75 A;  4QST A;  4QSU A;  5KU3 A;  5HLS A;  5CUG A;  2NXB A;  4Y03 A;  5FE1 A;  5DY7 A;  2F6J A;  4PCI A;  4QR5 A;  4QC1 A;  4TT2 A;  3VKH A;  3JVM A;  4Q0N A;  5E9V A;  3U5P A;  1ZS5 A;  4CUR A;  5FE8 A;  4TS8 A;  5A5R A;  5IGL A;  4HBY A;  5TCM A;  4MR3 A;  5E73 A;  4J0R A;  5FDZ A;  5HM0 A;  4NYX A;  5H85 A;  4HXS A;  5D7X A;  4O7B A;  5CPE A;  4ZW1 A;  5HJC A;  3MB4 A;  4YAX A;  5FE2 A;  5IGN A;  1ZKR A;  4NR6 A;  5IGM A;  2OSS A;  4AKI A;  2DWW A;  3G0L A;  5AD2 A;  2WP2 A;  5CTL A;  5EK9 A;  4A9I A;  3QZV A;  4LZS A;  5EWV A;  4ALH A;  4AKG A;  4PTB A;  5H1T A;  5ETB A;  4N4G A;  4WIV A;  4NQM A;  5D3R A;  5F3A A;  5EWW A;  5DYX A;  4YYM A;  4TYL A;  5L8T A;  4A9N A;  4CUU A;  3MQM A;  5HRX A;  5D26 A;  4QSX A;  5F63 A;  4YH4 A;  5FB1 A;  5L99 A;  4O7A A;  5F2P A;  5E9Y A;  4HXO A;  3U5K A;  2YQD A;  4XUB A;  3JVL A;  3UV5 A;  5I80 A;  3Q2F A;  2LSP B;  2D82 A;  4XYA A;  5FB0 A;  5E9I A;  5ENJ A;  5I86 A;  5FE4 A;  2R0Y A;  4YYJ A;  3JVJ A;  5FH6 A;  4LYW A;  4C66 A;  5HEL A;  4HBX A;  4MEQ A;  5DBM A;  4NR9 A;  3ZYU A;  5KTU A;  3ERR A;  4NUD A;  3D1D A;  3MXF A;  5C89 A;  5L8U A;  5G4S A;  5HFQ A;  4HBW A;  4O76 A;  4LDF A;  4NR8 A;  3LQI A;  4FLP A;  3U5O A;  4AKH A;  5A83 A;  1EQF A;  4LRG A;  5H1V A;  5EPR A;  3K2J A;  3O35 A;  4HBV A;  5A81 A;  5I29 A;  4KV1 A;  5E9L A;  5D25 A;  2YW5 A;  4YK0 A;  4DON A;  4QBM A;  5EP7 A;  5DFC A;  4TT6 A;  2YEM A;  3ONI A;  4QEV A;  3HME A;  5L97 A;  4Z6H A;  5ACY A;  2OUO A;  5EM3 A;  5D3H A;  5LKZ A;  4KCX A;  4MEO A;  4IR4 A;  5DLX A;  5CQ6 A;  4F3I A;  4UYD A;  5LVR A;  5CS8 A;  4O72 A;  5CQT A;  4O7F A;  5C4Q A;  2DVQ A;  5EU1 A;  5HQ7 A;  4TU4 A;  4QZS A;  4OGI A;  4UYF B;  3U5L A;  4QC3 A;  4QSQ A;  5LKU A;  5DYA A;  2G4A A;  4J1P A;  3AAD A;  5CUA A;  2KTB B;  3Q2E A;  2RS9 B;  4A9H A;  3LJW A;  4LR6 A;  4QEU A;  5F36 A;  5HRW A;  4XY9 A;  5ENC A;  5DKC A;  4CFL A;  5CQ3 A;  4UYG A;  5D3T A;  3GG3 A;  5TB6 A;  5LUU A;  5A5O A;  5HQ5 A;  2OO1 A;  5LVQ A;  4YYD A;  5ENI A;  4YYI A;  5F62 A;  5CQ7 A;  3DAI A;  4YAT A;  3I3J A;  5E3G A;  4HXP A;  5ENB A;  3MUK A;  4N3W A;  5F5Z A;  5CQ8 A;  3S91 A;  5A5N A;  5EVA A;  4O71 A;  4AKN A;  5FFW A;  5E3D A;  4QB3 A;  4QYL A;  4BW2 A;  5DYU A;  5DW1 A;  5KHM A;  5IG6 A;  4PY6 A;  5EGU A;  3O36 A;  5FFV A;  4YYH A;  4N4F A;  2RFJ A;  4Z1S A;  5JWM A;  2YDW A;  5FH7 A;  4XUA A;  3O34 A;  3MUL A;  5BT5 A;  5FH8 A;  5BT3 A;  5FFY A;  4BW4 A;  5FG4 A;  4TU6 A;  1PUO A;  5CUE A;  5II2 A;  4C67 A;  4TQN A;  5KTW A;  2DAT A;  4NQN A;  2YYN A;  3HMF A;  4HXN A;  4IR5 A;  4QR4 A;  4J0S A;  4QSS A;  5EWH A;  1X0J A;  3NXB A;  4TZ2 A;  5CUC A;  5A85 A;  4UYF A;  3UVD A;  4MEP A;  4HXR A;  5E9M A;  5D3N A;  4QUU A;  3S92 A;  5CQ4 A; 
#chains in the Genus database with same CATH homology
 5CUD A;  5K29 A;  4UYE A;  3HMH A;  5FE9 A;  4XY8 A;  5IBN A;  2DKW A;  4UIT A;  5KTX A;  5ENE A;  3DWY A;  5A82 A;  5ETD A;  4UIX A;  2DVR A;  4CLB A;  5HRV A;  3U5J A;  4QSP A;  4N4H A;  5FE6 A;  5LKX A;  5IGK A;  4CUT A;  3U5M A;  5HQ6 A;  5FE5 A;  3IU5 A;  4UIV A;  5D3J A;  5DFD A;  2F6N A;  4QSW A;  5EIC A;  2L84 A;  4UIU A;  5DLZ A;  5AME A;  2DVS A;  3P1C A;  4QNS A;  5LJ2 A;  3UVY A;  4Z1Q A;  4QSV A;  4MR4 A;  2E7O A;  2D9E A;  5CQ5 A;  5F61 A;  5E74 A;  4A9L A;  5I89 A;  5A5S A;  4ZQL A;  3LQJ A;  4UYH A;  5DKD A;  5HCL A;  4QSR A;  5COI A;  5KO4 A;  4ZC9 A;  5D0C A;  4IOQ A;  3FKM X;  2RNW A;  2RO1 A;  2N9G A;  5CFW A;  2R0V A;  3QZS A;  4YBS A;  5H1U A;  4PCE A;  1N72 A;  4HXL A;  4LYS A;  5CY9 A;  4RVR A;  5FE0 A;  4O70 A;  5CU8 A;  4KV4 A;  5J0D A;  4NR5 A;  2DVV A;  4UIW A;  4OUF A;  2I7K A;  5E9K A;  2E7N A;  4IOO A;  4LZR A;  4YYK A;  5DYC A;  5AMF A;  5D3L A;  5LKT A;  3D7C A;  4NRA A;  5FE7 A;  5IID A;  2L5E A;  5ENG A;  5HFR A;  4IOR A;  4Q0O A;  5A7C A;  4YC9 A;  3G0J A;  4MR6 A;  4NRC A;  2MJV B;  4NR4 A;  5F25 A;  3LXJ A;  4O7C A;  5L96 A;  4YYG A;  5L98 A;  2YEL A;  3QZT A;  4IR3 A;  4CUP A;  5I83 A;  5I40 A;  4UIZ A;  3UW9 A;  4HXK A;  4NXJ A;  5FE3 A;  5FG5 A;  1JSP B;  2RI7 A;  3O37 A;  4BJX A;  4X2I A;  5EIS A;  4O77 A;  4YBT A;  2WP1 A;  4ALG A;  4BHW A;  5DKH A;  1F68 A;  3UVX A;  5ENF A;  5FBX A;  4PS5 A;  5CRM A;  3SVH A;  4NRB A;  4QR3 A;  5FG6 A;  4NR7 A;  4QYD A;  5C87 A;  3P5O A;  4Z6I A;  5A5P A;  5D3S A;  4NYV A;  4J3I A;  4LZ2 A;  5CGP A;  5C8G A;  5JI8 A;  5CZG A;  5EPS A;  5EQ1 A;  4O7E A;  4BW1 A;  5F1H A;  5I7X A;  3P1F A;  4QY4 A;  3P1E A;  4NS5 A;  5C7N A;  2R10 A;  4YAD A;  4PKL A;  4A9F A;  3UVW A;  5DW2 A;  5LJ0 A;  5CP5 A;  4CUS A;  4Z93 A;  2GRC A;  2RNY A;  3JVK A;  3SVF A;  4TTE A;  5E0R A;  2I8N A;  4NUC A;  4YAB A;  3RCW A;  4LC2 A;  4OGJ A;  3LQH A;  4MEN A;  3MB3 A;  2E3K A;  2YEK A;  5F1L A;  4E96 A;  5HEN A;  4NUE A;  4N4I A;  5EPB A;  1WUM A;  1JM4 B;  4QUT A;  4A9E A;  1WUG A;  5D3P A;  5ENH A;  5CQA A;  5CUB A;  4YY6 A;  5BT4 A;  2R0S A;  4IR6 A;  4A9J A;  2H60 A;  4BW3 A;  2FSA A;  5AD3 A;  4WHU A;  5EI4 A;  5EA1 A;  4CFK A;  4YH3 A;  5DX4 A;  5I1Q A;  5A5Q A;  3O33 A;  3AQA A;  5E7D A;  4A9K A;  5I7Y A;  5II1 A;  3UV4 A;  4GPJ A;  5DFB A;  4MR5 A;  4NYW A;  5CRZ A;  4UIY A;  5I88 A;  4O74 A;  4YY4 A;  5EWD A;  5EWC A;  4WHW A;  4TZ8 A;  4YBM A;  4QEW A;  5F60 A;  4HXM A;  5C85 A;  4CL9 A;  5LJ1 A;  3IU6 A;  3P1D A;  2RNX A;  4LYI A;  4TT4 A;  4A9M A;  4CUQ A;  3SVG A;  1E6I A;  4A9O A;  4YYN A;  3U5N A;  5D24 A;  2L85 A;  3TLP A;  4O78 A;  5EV9 A;  5HEM A;  3UV2 A;  5G4R A;  4O75 A;  4QST A;  4QSU A;  5KU3 A;  5HLS A;  5CUG A;  2NXB A;  4Y03 A;  5FE1 A;  5DY7 A;  2F6J A;  4PCI A;  4QR5 A;  4QC1 A;  4TT2 A;  3JVM A;  4Q0N A;  5E9V A;  3U5P A;  1ZS5 A;  4CUR A;  5FE8 A;  4TS8 A;  5A5R A;  5IGL A;  4HBY A;  5TCM A;  4MR3 A;  5E73 A;  4J0R A;  5FDZ A;  5HM0 A;  4NYX A;  5H85 A;  4HXS A;  5D7X A;  4O7B A;  5CPE A;  4ZW1 A;  5HJC A;  3MB4 A;  4YAX A;  5FE2 A;  5IGN A;  4NR6 A;  5IGM A;  2OSS A;  2DWW A;  3G0L A;  5AD2 A;  2WP2 A;  5CTL A;  5EK9 A;  4A9I A;  3QZV A;  4LZS A;  5EWV A;  4ALH A;  4PTB A;  5H1T A;  5ETB A;  4N4G A;  4WIV A;  4NQM A;  5D3R A;  5F3A A;  5EWW A;  5DYX A;  4YYM A;  4TYL A;  5L8T A;  4A9N A;  4CUU A;  3MQM A;  5HRX A;  5D26 A;  4QSX A;  5F63 A;  4YH4 A;  5FB1 A;  5L99 A;  4O7A A;  5F2P A;  5E9Y A;  4HXO A;  3U5K A;  2YQD A;  4XUB A;  3JVL A;  3UV5 A;  5I80 A;  3Q2F A;  2LSP B;  2D82 A;  4XYA A;  5FB0 A;  5E9I A;  5ENJ A;  5I86 A;  5FE4 A;  2R0Y A;  4YYJ A;  3JVJ A;  5FH6 A;  4LYW A;  4C66 A;  5HEL A;  4HBX A;  4MEQ A;  5DBM A;  4NR9 A;  3ZYU A;  5KTU A;  4NUD A;  3MXF A;  5C89 A;  5L8U A;  5G4S A;  5HFQ A;  4HBW A;  4O76 A;  4LDF A;  4NR8 A;  3LQI A;  4FLP A;  3U5O A;  5A83 A;  1EQF A;  4LRG A;  5H1V A;  5EPR A;  3K2J A;  3O35 A;  4HBV A;  5A81 A;  5I29 A;  4KV1 A;  5E9L A;  5D25 A;  2YW5 A;  4YK0 A;  4DON A;  4QBM A;  5EP7 A;  5DFC A;  4TT6 A;  2YEM A;  3ONI A;  4QEV A;  3HME A;  5L97 A;  4Z6H A;  5ACY A;  2OUO A;  5EM3 A;  5D3H A;  5LKZ A;  4KCX A;  4MEO A;  4IR4 A;  5DLX A;  5CQ6 A;  4F3I A;  4UYD A;  5LVR A;  5CS8 A;  4O72 A;  5CQT A;  4O7F A;  5C4Q A;  2DVQ A;  5EU1 A;  5HQ7 A;  4TU4 A;  4QZS A;  4OGI A;  4UYF B;  3U5L A;  4QC3 A;  4QSQ A;  5LKU A;  5DYA A;  2G4A A;  4J1P A;  3AAD A;  5CUA A;  2KTB B;  3Q2E A;  2RS9 B;  4A9H A;  3LJW A;  4LR6 A;  4QEU A;  5F36 A;  5HRW A;  4XY9 A;  5ENC A;  5DKC A;  4CFL A;  5CQ3 A;  4UYG A;  5D3T A;  3GG3 A;  5TB6 A;  5LUU A;  5A5O A;  5HQ5 A;  2OO1 A;  5LVQ A;  4YYD A;  5ENI A;  4YYI A;  5F62 A;  5CQ7 A;  3DAI A;  4YAT A;  3I3J A;  5E3G A;  4HXP A;  5ENB A;  3MUK A;  4N3W A;  5F5Z A;  5CQ8 A;  3S91 A;  5A5N A;  5EVA A;  4O71 A;  4AKN A;  5FFW A;  5E3D A;  4QB3 A;  4QYL A;  4BW2 A;  5DYU A;  5DW1 A;  5KHM A;  5IG6 A;  4PY6 A;  5EGU A;  3O36 A;  5FFV A;  4YYH A;  4N4F A;  2RFJ A;  4Z1S A;  5JWM A;  2YDW A;  5FH7 A;  4XUA A;  3O34 A;  3MUL A;  5BT5 A;  5FH8 A;  5BT3 A;  5FFY A;  4BW4 A;  5FG4 A;  4TU6 A;  5CUE A;  5II2 A;  4C67 A;  4TQN A;  5KTW A;  2DAT A;  4NQN A;  2YYN A;  3HMF A;  4HXN A;  4IR5 A;  4QR4 A;  4J0S A;  4QSS A;  5EWH A;  1X0J A;  3NXB A;  4TZ2 A;  5CUC A;  5A85 A;  4UYF A;  3UVD A;  4MEP A;  4HXR A;  5E9M A;  5D3N A;  4QUU A;  3S92 A;  5CQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...