5FE6A

Crystal structure of human pcaf bromodomain in complex with fragment zb1916 (fragment 10)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
109
structure length
109
Chain Sequence
RDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Histone acetyltransferase KAT2B
publication title Structure-Based Identification of Inhibitory Fragments Targeting the p300/CBP-Associated Factor Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fe6A00
5DYAA 3G0LA 3UVWA 5EPSA 4MR6A 5COIA 4HXNA 3ZYUA 4NYVA 5E3DA 5E9MA 4BJXA 1F68A 3JVJA 4LZSA 3S91A 5FFVA 5I40A 5D3RA 1EQFA 3I3JA 4A9EA 5E0RA 3AADA 4NYWA 4QSUA 4IOQA 5CUDA 5LJ2A 5CQ6A 4OGJA 3AQAA 5FH6A 5EWCA 4CLBA 3U5KA 4IORA 2R0SA 5DKDA 5LKXA 4O7EA 3P1DA 4YYGA 3RCWA 4NXJA 4A9OA 4LR6A 5E3GA 5DBMA 5FG5A 5EPRA 4YYKA 4CUPA 4Y03A 5CUBA 5D3NA 4TZ2A 5FE9A 2I8NA 5DFBA 5FE1A 4YBSA 4NRAA 3DWYA 5TCMA 5ENIA 3S92A 5HQ7A 5AD2A 4O7FA 2RO1A 4UITA 4WIVA 5CZGA 4YAXA 4YYIA 5LJ1A 5FE2A 5KTUA 5I88A 2OO1A 5I7YA 4YH4A 3HMHA 4NR8A 4PCEA 5HCLA 4UYDA 5I80A 1X0JA 5J0DA 3MB4A 5ENFA 2RNXA 5CUAA 5CUEA 4O70A 4HXSA 4RVRA 4IR3A 4QSWA 2R10A 5F36A 5D0CA 4TS8A 2E3KA 4QR4A 3HMFA 5CQAA 5IGLA 3U5JA 2L84A 5E9YA 5C8GA 5I7XA 5E73A 4LYIA 3K2JA 5KTXA 5HRXA 4BW2A 5H1VA 2RNYA 4CUQA 5C89A 4LDFA 4QC3A 4ALGA 4DONA 5EU1A 3MXFA 5LVQA 3U5LA 4PTBA 4F3IA 4J0SA 4Q0NA 4OGIA 5D7XA 4O7CA 5E74A 5EWVA 5CUGA 3LQJA 4CUSA 3MULA 5FE3A 5HENA 5EM3A 4HBXA 4O76A 5HQ5A 5KTWA 5CQ8A 5EISA 5I1QA 5EWHA 5ETDA 4Z6HA 4TU4A 3U5PA 4HXRA 5C4QA 5CY9A 5L8UA 5CFWA 4HXPA 5DFCA 5FE0A 5FE5A 4J3IA 5CRMA 5E9VA 4TQNA 2L5EA 3HMEA 4YK0A 5EVAA 4NR5A 2F6JA 5CPEA 3P1FA 5DFDA 1JM4B 4QSQA 2D9EA 4LC2A 2RNWA 4MENA 2DVQA 1N72A 4A9NA 4OUFA 5FB0A 5TB6A 4Z1SA 4YH3A 4UYFA 4LRGA 4ZW1A 5IGMA 5L97A 3JVKA 2N9GA 5CUCA 5II2A 3IU5A 5D24A 5EWDA 5CQ4A 4YY4A 5HRWA 4BW3A 3UVDA 3ONIA 2GRCA 4UIUA 5HQ6A 5LUUA 3P1EA 4O74A 5G4RA 4HXLA 4UYHA 4N4IA 2RFJA 4LZ2A 4BW1A 5DY7A 4QSVA 2DVVA 4UYGA 4O77A 4UIWA 4QC1A 4N4HA 4XY8A 2DWWA 4QSXA 5D3LA 3UVXA 4A9FA 4MR4A 3O35A 5E9IA 3D7CA 4KCXA 5A5SA 3U5MA 4LZRA 5DW2A 5FBXA 5EA1A 4N3WA 2DVSA 5DYCA 4O7BA 4AKNA 1WUGA 4TT2A 2R0YA 2E7OA 2MJVB 5HM0A 4XUBA 1E6IA 4UIXA 5A85A 5IIDA 4QY4A 5LJ0A 3O37A 5EK9A 4UIYA 3LQIA 4QR5A 5C87A 4TT6A 5LKUA 5CQ5A 4N4FA 5C7NA 4NR7A 4FLPA 5EV9A 4CURA 5DLXA 5KO4A 3Q2FA 5L8TA 2YEKA 5CQ3A 3LJWA 3P5OA 4QZSA 4NR6A 3O36A 5C85A 4O71A 2YQDA 4QEWA 5H1UA 2DVRA 2KTBB 5A5RA 5IGKA 3U5OA 2FSAA 4HBVA 5ENCA 4Z6IA 5FH7A 4TTEA 4YC9A 5EP7A 4IOOA 4X2IA 4WHWA 5F60A 4HXOA 4A9HA 4HXMA 5F25A 4IR4A 5CS8A 5E7DA 4Z1QA 4NQNA 2YEMA 4TZ8A 3O33A 3UV4A 5ENBA 5F2PA 4TU6A 5L99A 4QBMA 3LXJA 2RI7A 4QYDA 5ENHA 5EICA 2YELA 5D3JA 4MEOA 1WUMA 5F61A 4NQMA 5D26A 5EQ1A 5IG6A 2WP1A 5D25A 4E96A 3MUKA 2G4AA 3UV5A 5HFQA 4LYSA 5A5NA 4CFLA 1JSPB 3SVFA 4MR3A 5L98A 4CFKA 4NUEA 5D3HA 5IBNA 4MEPA 4UYFB 5I29A 5F62A 5KHMA 5KU3A 5DX4A 5A5PA 2WP2A 4CUUA 4QB3A 5F3AA 4Z93A 4PS5A 5K29A 4YYJA 5I83A 3TLPA 3JVLA 4O78A 4QSRA 4QSSA 3G0JA 5CQTA 4NS5A 4LYWA 4TYLA 5H85A 4UYEA 4A9IA 5A7CA 5BT5A 2YYNA 5EPBA 4QUTA 5EGUA 4BW4A 5II1A 4YY6A 2D82A 2YDWA 3FKMX 3P1CA 4A9JA 5L96A 4HXKA 2NXBA 5HRVA 4ALHA 2DKWA 4YATA 5ENJA 4QSPA 4GPJA 4QEVA 4BHWA 4YYMA 4UIZA 3GG3A 5DKCA 4O75A 4YYNA 5LKTA 2E7NA 5G4SA 4NYXA 4A9LA 4PCIA 2RS9B 4O7AA 5CRZA 4XY9A 4ZC9A 3UVYA 5E9LA 5FG4A 5ETBA 4CL9A 4YABA 2F6NA 4YYDA 5ENEA 5LVRA 4QYLA 5FDZA 5HJCA 3SVHA 5AMEA 5D3TA 5D3SA 5BT4A 3UV2A 5A5QA 5H1TA 5ACYA 4QUUA 5IGNA 2DATA 5HELA 4HBYA 3NXBA 3QZVA 4NRCA 3SVGA 4QEUA 4WHUA 2R0VA 5F63A 5HFRA 5AD3A 4A9KA 5FH8A 5FFWA 5CGPA 2L85A 5E9KA 4YADA 4YYHA 2LSPB 5DYUA 4YBMA 5BT3A 4CUTA 4ZQLA 5EI4A 4KV4A 4Q0OA 5DW1A 5LKZA 5HLSA 3QZTA 1ZS5A 3DAIA 3O34A 4J1PA 5F5ZA 5FE7A 5I86A 5DYXA 2YW5A 4UIVA 4PKLA 4XYAA 4QSTA 5CU8A 5CP5A 2OUOA 5CQ7A 4KV1A 5DKHA 5JWMA 4XUAA 3U5NA 4NUDA 5AMFA 5JI8A 4NR4A 5FE8A 2OSSA 5A81A 2H60A 4TT4A 4MR5A 4NRBA 5FB1A 5FE6A 5DLZA 4NUCA 4QR3A 5I89A 3LQHA 3UW9A 4J0RA 3Q2EA 4YBTA 5F1LA 3QZSA 4PY6A 3MB3A 4N4GA 5A5OA 5EWWA 4NR9A 5ENGA 5FG6A 3JVMA 4C67A 4C66A 4O72A 5A82A 5CTLA 5FE4A 3MQMA 4IR5A 3IU6A 5HEMA 2I7KA 5F1HA 4HBWA 4MEQA 4A9MA 5FFYA 4QNSA 4IR6A 5A83A 5D3PA
chains in the Genus database with same CATH superfamily
5DYAA 3G0LA 3UVWA 5EPSA 4MR6A 5COIA 4HXNA 3ZYUA 4NYVA 5E3DA 5E9MA 4BJXA 1F68A 3JVJA 4LZSA 3S91A 5FFVA 5I40A 5D3RA 1EQFA 3I3JA 4A9EA 5E0RA 3AADA 4NYWA 4QSUA 4IOQA 5CUDA 5LJ2A 5CQ6A 4OGJA 3AQAA 5FH6A 5EWCA 4CLBA 3U5KA 4IORA 2R0SA 5DKDA 5LKXA 4O7EA 3P1DA 4YYGA 3RCWA 4NXJA 4A9OA 4LR6A 5E3GA 5DBMA 5FG5A 5EPRA 4YYKA 4CUPA 4Y03A 5CUBA 5D3NA 4TZ2A 5FE9A 2I8NA 5DFBA 5FE1A 4YBSA 4NRAA 3DWYA 5TCMA 5ENIA 3S92A 5HQ7A 5AD2A 4O7FA 2RO1A 4UITA 4WIVA 5CZGA 4YAXA 4YYIA 5LJ1A 5FE2A 5KTUA 5I88A 2OO1A 5I7YA 4YH4A 3HMHA 4NR8A 4PCEA 5HCLA 4UYDA 5I80A 1X0JA 5J0DA 3MB4A 5ENFA 2RNXA 5CUAA 5CUEA 4O70A 4HXSA 4RVRA 4IR3A 4QSWA 2R10A 5F36A 5D0CA 4TS8A 2E3KA 4QR4A 3HMFA 5CQAA 5IGLA 3U5JA 2L84A 5E9YA 5C8GA 5I7XA 5E73A 4LYIA 3K2JA 5KTXA 5HRXA 4BW2A 5H1VA 2RNYA 4CUQA 5C89A 4LDFA 4QC3A 4ALGA 4DONA 5EU1A 3MXFA 5LVQA 3U5LA 4PTBA 4F3IA 4J0SA 4Q0NA 4OGIA 5D7XA 4O7CA 5E74A 5EWVA 5CUGA 3LQJA 4CUSA 3MULA 5FE3A 5HENA 5EM3A 4HBXA 4O76A 5HQ5A 5KTWA 5CQ8A 5EISA 5I1QA 5EWHA 5ETDA 4Z6HA 4TU4A 3U5PA 4HXRA 5C4QA 5CY9A 5L8UA 5CFWA 4HXPA 5DFCA 5FE0A 5FE5A 4J3IA 5CRMA 5E9VA 4TQNA 2L5EA 3HMEA 4YK0A 5EVAA 4NR5A 2F6JA 5CPEA 3P1FA 5DFDA 1JM4B 4QSQA 2D9EA 4LC2A 2RNWA 4MENA 2DVQA 1N72A 4A9NA 4OUFA 5FB0A 5TB6A 4Z1SA 4YH3A 4UYFA 4LRGA 4ZW1A 5IGMA 5L97A 3JVKA 2N9GA 5CUCA 5II2A 3IU5A 5D24A 5EWDA 5CQ4A 4YY4A 5HRWA 4BW3A 3UVDA 3ONIA 2GRCA 4UIUA 5HQ6A 5LUUA 3P1EA 4O74A 5G4RA 4HXLA 4UYHA 4N4IA 2RFJA 1PUOA 4LZ2A 4BW1A 5DY7A 4QSVA 2DVVA 4UYGA 4O77A 4UIWA 4QC1A 4N4HA 4XY8A 2DWWA 4QSXA 3VKHA 5D3LA 3UVXA 4A9FA 4MR4A 3O35A 5E9IA 3D7CA 4KCXA 5A5SA 3U5MA 4LZRA 5DW2A 5FBXA 3VKGA 5EA1A 4N3WA 2DVSA 5DYCA 4O7BA 4AKNA 1WUGA 4TT2A 2R0YA 2E7OA 2MJVB 5HM0A 4XUBA 1E6IA 4UIXA 5A85A 5IIDA 4QY4A 5LJ0A 3O37A 5EK9A 4UIYA 3LQIA 4QR5A 5C87A 4TT6A 5LKUA 5CQ5A 4N4FA 5C7NA 4NR7A 4FLPA 4AI6A 5EV9A 4CURA 5DLXA 5KO4A 3Q2FA 5L8TA 2YEKA 5CQ3A 3LJWA 3P5OA 4QZSA 4NR6A 3O36A 5C85A 4O71A 2YQDA 4QEWA 5H1UA 2DVRA 2KTBB 5A5RA 5IGKA 3U5OA 2FSAA 4HBVA 5ENCA 4Z6IA 5FH7A 4TTEA 4YC9A 5EP7A 4IOOA 4X2IA 4WHWA 5F60A 4HXOA 4A9HA 4HXMA 5F25A 4IR4A 5CS8A 5E7DA 4Z1QA 4NQNA 2YEMA 4TZ8A 3O33A 3UV4A 5ENBA 5F2PA 4TU6A 5L99A 4QBMA 3LXJA 4AKHA 2RI7A 4QYDA 5ENHA 5EICA 2YELA 5D3JA 4MEOA 1WUMA 5F61A 4NQMA 5D26A 5EQ1A 5IG6A 2WP1A 5D25A 4E96A 3MUKA 2G4AA 3UV5A 5HFQA 4LYSA 5A5NA 4CFLA 1JSPB 3SVFA 4MR3A 5L98A 4CFKA 4NUEA 5D3HA 5IBNA 4MEPA 4UYFB 5I29A 5F62A 5KHMA 5KU3A 5DX4A 5A5PA 2WP2A 4CUUA 4QB3A 5F3AA 4Z93A 4PS5A 5K29A 4YYJA 5I83A 3TLPA 3JVLA 4O78A 4QSRA 4QSSA 3G0JA 5CQTA 4NS5A 4LYWA 4TYLA 5H85A 4UYEA 4A9IA 5A7CA 5BT5A 2YYNA 5EPBA 4QUTA 2EJNA 5EGUA 4BW4A 5II1A 4YY6A 2D82A 2YDWA 3FKMX 3P1CA 4A9JA 3D1BA 5L96A 4HXKA 2NXBA 5HRVA 4ALHA 2DKWA 4YATA 5ENJA 4QSPA 4GPJA 4QEVA 4BHWA 4YYMA 4UIZA 3GG3A 5DKCA 4O75A 4YYNA 5LKTA 2E7NA 5G4SA 4NYXA 4A9LA 4PCIA 2RS9B 4O7AA 5CRZA 1ZKRA 4XY9A 4ZC9A 3UVYA 5E9LA 5FG4A 5ETBA 4CL9A 4YABA 2F6NA 4YYDA 5ENEA 5LVRA 4QYLA 5FDZA 5HJCA 3SVHA 5AMEA 5D3TA 5D3SA 5BT4A 3UV2A 5A5QA 5H1TA 4AKIA 5ACYA 4QUUA 5IGNA 2DATA 5HELA 4HBYA 3NXBA 3QZVA 4NRCA 3SVGA 4QEUA 4WHUA 2R0VA 5F63A 5HFRA 5AD3A 4A9KA 5FH8A 5FFWA 5CGPA 2L85A 5E9KA 4YADA 4YYHA 2LSPB 5DYUA 4YBMA 5BT3A 4CUTA 4ZQLA 5EI4A 4KV4A 4Q0OA 5DW1A 5LKZA 5HLSA 3QZTA 1ZS5A 3DAIA 3O34A 4J1PA 5F5ZA 5FE7A 5I86A 5DYXA 2YW5A 4UIVA 4PKLA 4XYAA 4QSTA 5CU8A 5CP5A 2OUOA 5CQ7A 4KV1A 5DKHA 5JWMA 4XUAA 3U5NA 4NUDA 5AMFA 5JI8A 4NR4A 5FE8A 2OSSA 5A81A 2H60A 4TT4A 4MR5A 4NRBA 5FB1A 5FE6A 5DLZA 4NUCA 4QR3A 5I89A 3LQHA 3UW9A 4J0RA 3Q2EA 4YBTA 5F1LA 3QZSA 4PY6A 3MB3A 4AKGA 4N4GA 5A5OA 5EWWA 4NR9A 5ENGA 5FG6A 3JVMA 4C67A 4C66A 4O72A 5A82A 5CTLA 5FE4A 3MQMA 3D1DA 4IR5A 3IU6A 5HEMA 2I7KA 5F1HA 4HBWA 4MEQA 4A9MA 5FFYA 4QNSA 4IR6A 5A83A 3ERRA 5D3PA
chains in the Genus database with same CATH topology
5DYAA 3G0LA 3UVWA 5EPSA 4MR6A 5COIA 4HXNA 3ZYUA 4NYVA 5E3DA 5E9MA 4BJXA 1F68A 3JVJA 4LZSA 3S91A 5FFVA 5I40A 5D3RA 1EQFA 3I3JA 4A9EA 5E0RA 3AADA 4NYWA 4QSUA 4IOQA 5CUDA 5LJ2A 5CQ6A 4OGJA 3AQAA 5FH6A 5EWCA 4CLBA 3U5KA 4IORA 2R0SA 5DKDA 5LKXA 4O7EA 3P1DA 4YYGA 3RCWA 4NXJA 4A9OA 4LR6A 5E3GA 5DBMA 5FG5A 5EPRA 4YYKA 4CUPA 4Y03A 5CUBA 5D3NA 4TZ2A 5FE9A 2I8NA 5DFBA 5FE1A 4YBSA 4NRAA 3DWYA 5TCMA 5ENIA 3S92A 5HQ7A 5AD2A 4O7FA 2RO1A 4UITA 4WIVA 5CZGA 4YAXA 4YYIA 5LJ1A 5FE2A 5KTUA 5I88A 2OO1A 5I7YA 4YH4A 3HMHA 4NR8A 4PCEA 5HCLA 4UYDA 5I80A 1X0JA 5J0DA 3MB4A 5ENFA 2RNXA 5CUAA 5CUEA 4O70A 4HXSA 4RVRA 4IR3A 4QSWA 2R10A 5F36A 5D0CA 4TS8A 2E3KA 4QR4A 3HMFA 5CQAA 5IGLA 3U5JA 2L84A 5E9YA 5C8GA 5I7XA 5E73A 4LYIA 3K2JA 5KTXA 5HRXA 4BW2A 5H1VA 2RNYA 4CUQA 5C89A 4LDFA 4QC3A 4ALGA 4DONA 5EU1A 3MXFA 5LVQA 3U5LA 4PTBA 4F3IA 4J0SA 4Q0NA 4OGIA 5D7XA 4O7CA 5E74A 5EWVA 5CUGA 3LQJA 4CUSA 3MULA 5FE3A 5HENA 5EM3A 4HBXA 4O76A 5HQ5A 5KTWA 5CQ8A 5EISA 5I1QA 5EWHA 5ETDA 4Z6HA 4TU4A 3U5PA 4HXRA 5C4QA 5CY9A 5L8UA 5CFWA 4HXPA 5DFCA 5FE0A 5FE5A 4J3IA 5CRMA 5E9VA 4TQNA 2L5EA 3HMEA 4YK0A 5EVAA 4NR5A 2F6JA 5CPEA 3P1FA 5DFDA 1JM4B 4QSQA 2D9EA 4LC2A 2RNWA 4MENA 2DVQA 1N72A 4A9NA 4OUFA 5FB0A 5TB6A 4Z1SA 4YH3A 4UYFA 4LRGA 4ZW1A 5IGMA 5L97A 3JVKA 2N9GA 5CUCA 5II2A 3IU5A 5D24A 5EWDA 5CQ4A 4YY4A 5HRWA 4BW3A 3UVDA 3ONIA 2GRCA 4UIUA 5HQ6A 5LUUA 3P1EA 4O74A 5G4RA 4HXLA 4UYHA 4N4IA 2RFJA 4LZ2A 4BW1A 5DY7A 4QSVA 2DVVA 4UYGA 4O77A 4UIWA 4QC1A 4N4HA 4XY8A 2DWWA 4QSXA 5D3LA 3UVXA 4A9FA 4MR4A 3O35A 5E9IA 3D7CA 4KCXA 5A5SA 3U5MA 4LZRA 5DW2A 5FBXA 5EA1A 4N3WA 2DVSA 5DYCA 4O7BA 4AKNA 1WUGA 4TT2A 2R0YA 2E7OA 2MJVB 5HM0A 4XUBA 1E6IA 4UIXA 5A85A 5IIDA 4QY4A 5LJ0A 3O37A 5EK9A 4UIYA 3LQIA 4QR5A 5C87A 4TT6A 5LKUA 5CQ5A 4N4FA 5C7NA 4NR7A 4FLPA 5EV9A 4CURA 5DLXA 5KO4A 3Q2FA 5L8TA 2YEKA 5CQ3A 3LJWA 3P5OA 4QZSA 4NR6A 3O36A 5C85A 4O71A 2YQDA 4QEWA 5H1UA 2DVRA 2KTBB 5A5RA 5IGKA 3U5OA 2FSAA 4HBVA 5ENCA 4Z6IA 5FH7A 4TTEA 4YC9A 5EP7A 4IOOA 4X2IA 4WHWA 5F60A 4HXOA 4A9HA 4HXMA 5F25A 4IR4A 5CS8A 5E7DA 4Z1QA 4NQNA 2YEMA 4TZ8A 3O33A 3UV4A 5ENBA 5F2PA 4TU6A 5L99A 4QBMA 3LXJA 2RI7A 4QYDA 5ENHA 5EICA 2YELA 5D3JA 4MEOA 1WUMA 5F61A 4NQMA 5D26A 5EQ1A 5IG6A 2WP1A 5D25A 4E96A 3MUKA 2G4AA 3UV5A 5HFQA 4LYSA 5A5NA 4CFLA 1JSPB 3SVFA 4MR3A 5L98A 4CFKA 4NUEA 5D3HA 5IBNA 4MEPA 4UYFB 5I29A 5F62A 5KHMA 5KU3A 5DX4A 5A5PA 2WP2A 4CUUA 4QB3A 5F3AA 4Z93A 4PS5A 5K29A 4YYJA 5I83A 3TLPA 3JVLA 4O78A 4QSRA 4QSSA 3G0JA 5CQTA 4NS5A 4LYWA 4TYLA 5H85A 4UYEA 4A9IA 5A7CA 5BT5A 2YYNA 5EPBA 4QUTA 5EGUA 4BW4A 5II1A 4YY6A 2D82A 2YDWA 3FKMX 3P1CA 4A9JA 5L96A 4HXKA 2NXBA 5HRVA 4ALHA 2DKWA 4YATA 5ENJA 4QSPA 4GPJA 4QEVA 4BHWA 4YYMA 4UIZA 3GG3A 5DKCA 4O75A 4YYNA 5LKTA 2E7NA 5G4SA 4NYXA 4A9LA 4PCIA 2RS9B 4O7AA 5CRZA 4XY9A 4ZC9A 3UVYA 5E9LA 5FG4A 5ETBA 4CL9A 4YABA 2F6NA 4YYDA 5ENEA 5LVRA 4QYLA 5FDZA 5HJCA 3SVHA 5AMEA 5D3TA 5D3SA 5BT4A 3UV2A 5A5QA 5H1TA 5ACYA 4QUUA 5IGNA 2DATA 5HELA 4HBYA 3NXBA 3QZVA 4NRCA 3SVGA 4QEUA 4WHUA 2R0VA 5F63A 5HFRA 5AD3A 4A9KA 5FH8A 5FFWA 5CGPA 2L85A 5E9KA 4YADA 4YYHA 2LSPB 5DYUA 4YBMA 5BT3A 4CUTA 4ZQLA 5EI4A 4KV4A 4Q0OA 5DW1A 5LKZA 5HLSA 3QZTA 1ZS5A 3DAIA 3O34A 4J1PA 5F5ZA 5FE7A 5I86A 5DYXA 2YW5A 4UIVA 4PKLA 4XYAA 4QSTA 5CU8A 5CP5A 2OUOA 5CQ7A 4KV1A 5DKHA 5JWMA 4XUAA 3U5NA 4NUDA 5AMFA 5JI8A 4NR4A 5FE8A 2OSSA 5A81A 2H60A 4TT4A 4MR5A 4NRBA 5FB1A 5FE6A 5DLZA 4NUCA 4QR3A 5I89A 3LQHA 3UW9A 4J0RA 3Q2EA 4YBTA 5F1LA 3QZSA 4PY6A 3MB3A 4N4GA 5A5OA 5EWWA 4NR9A 5ENGA 5FG6A 3JVMA 4C67A 4C66A 4O72A 5A82A 5CTLA 5FE4A 3MQMA 4IR5A 3IU6A 5HEMA 2I7KA 5F1HA 4HBWA 4MEQA 4A9MA 5FFYA 4QNSA 4IR6A 5A83A 5D3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DYA A;  3G0L A;  3UVW A;  5EPS A;  4MR6 A;  5COI A;  4HXN A;  3ZYU A;  4NYV A;  5E3D A;  5E9M A;  4BJX A;  1F68 A;  3JVJ A;  4LZS A;  3S91 A;  5FFV A;  5I40 A;  5D3R A;  1EQF A;  3I3J A;  4A9E A;  5E0R A;  3AAD A;  4NYW A;  4QSU A;  4IOQ A;  5CUD A;  5LJ2 A;  5CQ6 A;  4OGJ A;  3AQA A;  5FH6 A;  5EWC A;  4CLB A;  3U5K A;  4IOR A;  2R0S A;  5DKD A;  5LKX A;  4O7E A;  3P1D A;  4YYG A;  3RCW A;  4NXJ A;  4A9O A;  4LR6 A;  5E3G A;  5DBM A;  5FG5 A;  5EPR A;  4YYK A;  4CUP A;  4Y03 A;  5CUB A;  5D3N A;  4TZ2 A;  5FE9 A;  2I8N A;  5DFB A;  5FE1 A;  4YBS A;  4NRA A;  3DWY A;  5TCM A;  5ENI A;  3S92 A;  5HQ7 A;  5AD2 A;  4O7F A;  2RO1 A;  4UIT A;  4WIV A;  5CZG A;  4YAX A;  4YYI A;  5LJ1 A;  5FE2 A;  5KTU A;  5I88 A;  2OO1 A;  5I7Y A;  4YH4 A;  3HMH A;  4NR8 A;  4PCE A;  5HCL A;  4UYD A;  5I80 A;  1X0J A;  5J0D A;  3MB4 A;  5ENF A;  2RNX A;  5CUA A;  5CUE A;  4O70 A;  4HXS A;  4RVR A;  4IR3 A;  4QSW A;  2R10 A;  5F36 A;  5D0C A;  4TS8 A;  2E3K A;  4QR4 A;  3HMF A;  5CQA A;  5IGL A;  3U5J A;  2L84 A;  5E9Y A;  5C8G A;  5I7X A;  5E73 A;  4LYI A;  3K2J A;  5KTX A;  5HRX A;  4BW2 A;  5H1V A;  2RNY A;  4CUQ A;  5C89 A;  4LDF A;  4QC3 A;  4ALG A;  4DON A;  5EU1 A;  3MXF A;  5LVQ A;  3U5L A;  4PTB A;  4F3I A;  4J0S A;  4Q0N A;  4OGI A;  5D7X A;  4O7C A;  5E74 A;  5EWV A;  5CUG A;  3LQJ A;  4CUS A;  3MUL A;  5FE3 A;  5HEN A;  5EM3 A;  4HBX A;  4O76 A;  5HQ5 A;  5KTW A;  5CQ8 A;  5EIS A;  5I1Q A;  5EWH A;  5ETD A;  4Z6H A;  4TU4 A;  3U5P A;  4HXR A;  5C4Q A;  5CY9 A;  5L8U A;  5CFW A;  4HXP A;  5DFC A;  5FE0 A;  5FE5 A;  4J3I A;  5CRM A;  5E9V A;  4TQN A;  2L5E A;  3HME A;  4YK0 A;  5EVA A;  4NR5 A;  2F6J A;  5CPE A;  3P1F A;  5DFD A;  1JM4 B;  4QSQ A;  2D9E A;  4LC2 A;  2RNW A;  4MEN A;  2DVQ A;  1N72 A;  4A9N A;  4OUF A;  5FB0 A;  5TB6 A;  4Z1S A;  4YH3 A;  4UYF A;  4LRG A;  4ZW1 A;  5IGM A;  5L97 A;  3JVK A;  2N9G A;  5CUC A;  5II2 A;  3IU5 A;  5D24 A;  5EWD A;  5CQ4 A;  4YY4 A;  5HRW A;  4BW3 A;  3UVD A;  3ONI A;  2GRC A;  4UIU A;  5HQ6 A;  5LUU A;  3P1E A;  4O74 A;  5G4R A;  4HXL A;  4UYH A;  4N4I A;  2RFJ A;  4LZ2 A;  4BW1 A;  5DY7 A;  4QSV A;  2DVV A;  4UYG A;  4O77 A;  4UIW A;  4QC1 A;  4N4H A;  4XY8 A;  2DWW A;  4QSX A;  5D3L A;  3UVX A;  4A9F A;  4MR4 A;  3O35 A;  5E9I A;  3D7C A;  4KCX A;  5A5S A;  3U5M A;  4LZR A;  5DW2 A;  5FBX A;  5EA1 A;  4N3W A;  2DVS A;  5DYC A;  4O7B A;  4AKN A;  1WUG A;  4TT2 A;  2R0Y A;  2E7O A;  2MJV B;  5HM0 A;  4XUB A;  1E6I A;  4UIX A;  5A85 A;  5IID A;  4QY4 A;  5LJ0 A;  3O37 A;  5EK9 A;  4UIY A;  3LQI A;  4QR5 A;  5C87 A;  4TT6 A;  5LKU A;  5CQ5 A;  4N4F A;  5C7N A;  4NR7 A;  4FLP A;  5EV9 A;  4CUR A;  5DLX A;  5KO4 A;  3Q2F A;  5L8T A;  2YEK A;  5CQ3 A;  3LJW A;  3P5O A;  4QZS A;  4NR6 A;  3O36 A;  5C85 A;  4O71 A;  2YQD A;  4QEW A;  5H1U A;  2DVR A;  2KTB B;  5A5R A;  5IGK A;  3U5O A;  2FSA A;  4HBV A;  5ENC A;  4Z6I A;  5FH7 A;  4TTE A;  4YC9 A;  5EP7 A;  4IOO A;  4X2I A;  4WHW A;  5F60 A;  4HXO A;  4A9H A;  4HXM A;  5F25 A;  4IR4 A;  5CS8 A;  5E7D A;  4Z1Q A;  4NQN A;  2YEM A;  4TZ8 A;  3O33 A;  3UV4 A;  5ENB A;  5F2P A;  4TU6 A;  5L99 A;  4QBM A;  3LXJ A;  2RI7 A;  4QYD A;  5ENH A;  5EIC A;  2YEL A;  5D3J A;  4MEO A;  1WUM A;  5F61 A;  4NQM A;  5D26 A;  5EQ1 A;  5IG6 A;  2WP1 A;  5D25 A;  4E96 A;  3MUK A;  2G4A A;  3UV5 A;  5HFQ A;  4LYS A;  5A5N A;  4CFL A;  1JSP B;  3SVF A;  4MR3 A;  5L98 A;  4CFK A;  4NUE A;  5D3H A;  5IBN A;  4MEP A;  4UYF B;  5I29 A;  5F62 A;  5KHM A;  5KU3 A;  5DX4 A;  5A5P A;  2WP2 A;  4CUU A;  4QB3 A;  5F3A A;  4Z93 A;  4PS5 A;  5K29 A;  4YYJ A;  5I83 A;  3TLP A;  3JVL A;  4O78 A;  4QSR A;  4QSS A;  3G0J A;  5CQT A;  4NS5 A;  4LYW A;  4TYL A;  5H85 A;  4UYE A;  4A9I A;  5A7C A;  5BT5 A;  2YYN A;  5EPB A;  4QUT A;  5EGU A;  4BW4 A;  5II1 A;  4YY6 A;  2D82 A;  2YDW A;  3FKM X;  3P1C A;  4A9J A;  5L96 A;  4HXK A;  2NXB A;  5HRV A;  4ALH A;  2DKW A;  4YAT A;  5ENJ A;  4QSP A;  4GPJ A;  4QEV A;  4BHW A;  4YYM A;  4UIZ A;  3GG3 A;  5DKC A;  4O75 A;  4YYN A;  5LKT A;  2E7N A;  5G4S A;  4NYX A;  4A9L A;  4PCI A;  2RS9 B;  4O7A A;  5CRZ A;  4XY9 A;  4ZC9 A;  3UVY A;  5E9L A;  5FG4 A;  5ETB A;  4CL9 A;  4YAB A;  2F6N A;  4YYD A;  5ENE A;  5LVR A;  4QYL A;  5FDZ A;  5HJC A;  3SVH A;  5AME A;  5D3T A;  5D3S A;  5BT4 A;  3UV2 A;  5A5Q A;  5H1T A;  5ACY A;  4QUU A;  5IGN A;  2DAT A;  5HEL A;  4HBY A;  3NXB A;  3QZV A;  4NRC A;  3SVG A;  4QEU A;  4WHU A;  2R0V A;  5F63 A;  5HFR A;  5AD3 A;  4A9K A;  5FH8 A;  5FFW A;  5CGP A;  2L85 A;  5E9K A;  4YAD A;  4YYH A;  2LSP B;  5DYU A;  4YBM A;  5BT3 A;  4CUT A;  4ZQL A;  5EI4 A;  4KV4 A;  4Q0O A;  5DW1 A;  5LKZ A;  5HLS A;  3QZT A;  1ZS5 A;  3DAI A;  3O34 A;  4J1P A;  5F5Z A;  5FE7 A;  5I86 A;  5DYX A;  2YW5 A;  4UIV A;  4PKL A;  4XYA A;  4QST A;  5CU8 A;  5CP5 A;  2OUO A;  5CQ7 A;  4KV1 A;  5DKH A;  5JWM A;  4XUA A;  3U5N A;  4NUD A;  5AMF A;  5JI8 A;  4NR4 A;  5FE8 A;  2OSS A;  5A81 A;  2H60 A;  4TT4 A;  4MR5 A;  4NRB A;  5FB1 A;  5FE6 A;  5DLZ A;  4NUC A;  4QR3 A;  5I89 A;  3LQH A;  3UW9 A;  4J0R A;  3Q2E A;  4YBT A;  5F1L A;  3QZS A;  4PY6 A;  3MB3 A;  4N4G A;  5A5O A;  5EWW A;  4NR9 A;  5ENG A;  5FG6 A;  3JVM A;  4C67 A;  4C66 A;  4O72 A;  5A82 A;  5CTL A;  5FE4 A;  3MQM A;  4IR5 A;  3IU6 A;  5HEM A;  2I7K A;  5F1H A;  4HBW A;  4MEQ A;  4A9M A;  5FFY A;  4QNS A;  4IR6 A;  5A83 A;  5D3P A; 
#chains in the Genus database with same CATH topology
 5DYA A;  3G0L A;  3UVW A;  5EPS A;  4MR6 A;  5COI A;  4HXN A;  3ZYU A;  4NYV A;  5E3D A;  5E9M A;  4BJX A;  1F68 A;  3JVJ A;  4LZS A;  3S91 A;  5FFV A;  5I40 A;  5D3R A;  1EQF A;  3I3J A;  4A9E A;  5E0R A;  3AAD A;  4NYW A;  4QSU A;  4IOQ A;  5CUD A;  5LJ2 A;  5CQ6 A;  4OGJ A;  3AQA A;  5FH6 A;  5EWC A;  4CLB A;  3U5K A;  4IOR A;  2R0S A;  5DKD A;  5LKX A;  4O7E A;  3P1D A;  4YYG A;  3RCW A;  4NXJ A;  4A9O A;  4LR6 A;  5E3G A;  5DBM A;  5FG5 A;  5EPR A;  4YYK A;  4CUP A;  4Y03 A;  5CUB A;  5D3N A;  4TZ2 A;  5FE9 A;  2I8N A;  5DFB A;  5FE1 A;  4YBS A;  4NRA A;  3DWY A;  5TCM A;  5ENI A;  3S92 A;  5HQ7 A;  5AD2 A;  4O7F A;  2RO1 A;  4UIT A;  4WIV A;  5CZG A;  4YAX A;  4YYI A;  5LJ1 A;  5FE2 A;  5KTU A;  5I88 A;  2OO1 A;  5I7Y A;  4YH4 A;  3HMH A;  4NR8 A;  4PCE A;  5HCL A;  4UYD A;  5I80 A;  1X0J A;  5J0D A;  3MB4 A;  5ENF A;  2RNX A;  5CUA A;  5CUE A;  4O70 A;  4HXS A;  4RVR A;  4IR3 A;  4QSW A;  2R10 A;  5F36 A;  5D0C A;  4TS8 A;  2E3K A;  4QR4 A;  3HMF A;  5CQA A;  5IGL A;  3U5J A;  2L84 A;  5E9Y A;  5C8G A;  5I7X A;  5E73 A;  4LYI A;  3K2J A;  5KTX A;  5HRX A;  4BW2 A;  5H1V A;  2RNY A;  4CUQ A;  5C89 A;  4LDF A;  4QC3 A;  4ALG A;  4DON A;  5EU1 A;  3MXF A;  5LVQ A;  3U5L A;  4PTB A;  4F3I A;  4J0S A;  4Q0N A;  4OGI A;  5D7X A;  4O7C A;  5E74 A;  5EWV A;  5CUG A;  3LQJ A;  4CUS A;  3MUL A;  5FE3 A;  5HEN A;  5EM3 A;  4HBX A;  4O76 A;  5HQ5 A;  5KTW A;  5CQ8 A;  5EIS A;  5I1Q A;  5EWH A;  5ETD A;  4Z6H A;  4TU4 A;  3U5P A;  4HXR A;  5C4Q A;  5CY9 A;  5L8U A;  5CFW A;  4HXP A;  5DFC A;  5FE0 A;  5FE5 A;  4J3I A;  5CRM A;  5E9V A;  4TQN A;  2L5E A;  3HME A;  4YK0 A;  5EVA A;  4NR5 A;  2F6J A;  5CPE A;  3P1F A;  5DFD A;  1JM4 B;  4QSQ A;  2D9E A;  4LC2 A;  2RNW A;  4MEN A;  2DVQ A;  1N72 A;  4A9N A;  4OUF A;  5FB0 A;  5TB6 A;  4Z1S A;  4YH3 A;  4UYF A;  4LRG A;  4ZW1 A;  5IGM A;  5L97 A;  3JVK A;  2N9G A;  5CUC A;  5II2 A;  3IU5 A;  5D24 A;  5EWD A;  5CQ4 A;  4YY4 A;  5HRW A;  4BW3 A;  3UVD A;  3ONI A;  2GRC A;  4UIU A;  5HQ6 A;  5LUU A;  3P1E A;  4O74 A;  5G4R A;  4HXL A;  4UYH A;  4N4I A;  2RFJ A;  1PUO A;  4LZ2 A;  4BW1 A;  5DY7 A;  4QSV A;  2DVV A;  4UYG A;  4O77 A;  4UIW A;  4QC1 A;  4N4H A;  4XY8 A;  2DWW A;  4QSX A;  3VKH A;  5D3L A;  3UVX A;  4A9F A;  4MR4 A;  3O35 A;  5E9I A;  3D7C A;  4KCX A;  5A5S A;  3U5M A;  4LZR A;  5DW2 A;  5FBX A;  3VKG A;  5EA1 A;  4N3W A;  2DVS A;  5DYC A;  4O7B A;  4AKN A;  1WUG A;  4TT2 A;  2R0Y A;  2E7O A;  2MJV B;  5HM0 A;  4XUB A;  1E6I A;  4UIX A;  5A85 A;  5IID A;  4QY4 A;  5LJ0 A;  3O37 A;  5EK9 A;  4UIY A;  3LQI A;  4QR5 A;  5C87 A;  4TT6 A;  5LKU A;  5CQ5 A;  4N4F A;  5C7N A;  4NR7 A;  4FLP A;  4AI6 A;  5EV9 A;  4CUR A;  5DLX A;  5KO4 A;  3Q2F A;  5L8T A;  2YEK A;  5CQ3 A;  3LJW A;  3P5O A;  4QZS A;  4NR6 A;  3O36 A;  5C85 A;  4O71 A;  2YQD A;  4QEW A;  5H1U A;  2DVR A;  2KTB B;  5A5R A;  5IGK A;  3U5O A;  2FSA A;  4HBV A;  5ENC A;  4Z6I A;  5FH7 A;  4TTE A;  4YC9 A;  5EP7 A;  4IOO A;  4X2I A;  4WHW A;  5F60 A;  4HXO A;  4A9H A;  4HXM A;  5F25 A;  4IR4 A;  5CS8 A;  5E7D A;  4Z1Q A;  4NQN A;  2YEM A;  4TZ8 A;  3O33 A;  3UV4 A;  5ENB A;  5F2P A;  4TU6 A;  5L99 A;  4QBM A;  3LXJ A;  4AKH A;  2RI7 A;  4QYD A;  5ENH A;  5EIC A;  2YEL A;  5D3J A;  4MEO A;  1WUM A;  5F61 A;  4NQM A;  5D26 A;  5EQ1 A;  5IG6 A;  2WP1 A;  5D25 A;  4E96 A;  3MUK A;  2G4A A;  3UV5 A;  5HFQ A;  4LYS A;  5A5N A;  4CFL A;  1JSP B;  3SVF A;  4MR3 A;  5L98 A;  4CFK A;  4NUE A;  5D3H A;  5IBN A;  4MEP A;  4UYF B;  5I29 A;  5F62 A;  5KHM A;  5KU3 A;  5DX4 A;  5A5P A;  2WP2 A;  4CUU A;  4QB3 A;  5F3A A;  4Z93 A;  4PS5 A;  5K29 A;  4YYJ A;  5I83 A;  3TLP A;  3JVL A;  4O78 A;  4QSR A;  4QSS A;  3G0J A;  5CQT A;  4NS5 A;  4LYW A;  4TYL A;  5H85 A;  4UYE A;  4A9I A;  5A7C A;  5BT5 A;  2YYN A;  5EPB A;  4QUT A;  2EJN A;  5EGU A;  4BW4 A;  5II1 A;  4YY6 A;  2D82 A;  2YDW A;  3FKM X;  3P1C A;  4A9J A;  3D1B A;  5L96 A;  4HXK A;  2NXB A;  5HRV A;  4ALH A;  2DKW A;  4YAT A;  5ENJ A;  4QSP A;  4GPJ A;  4QEV A;  4BHW A;  4YYM A;  4UIZ A;  3GG3 A;  5DKC A;  4O75 A;  4YYN A;  5LKT A;  2E7N A;  5G4S A;  4NYX A;  4A9L A;  4PCI A;  2RS9 B;  4O7A A;  5CRZ A;  1ZKR A;  4XY9 A;  4ZC9 A;  3UVY A;  5E9L A;  5FG4 A;  5ETB A;  4CL9 A;  4YAB A;  2F6N A;  4YYD A;  5ENE A;  5LVR A;  4QYL A;  5FDZ A;  5HJC A;  3SVH A;  5AME A;  5D3T A;  5D3S A;  5BT4 A;  3UV2 A;  5A5Q A;  5H1T A;  4AKI A;  5ACY A;  4QUU A;  5IGN A;  2DAT A;  5HEL A;  4HBY A;  3NXB A;  3QZV A;  4NRC A;  3SVG A;  4QEU A;  4WHU A;  2R0V A;  5F63 A;  5HFR A;  5AD3 A;  4A9K A;  5FH8 A;  5FFW A;  5CGP A;  2L85 A;  5E9K A;  4YAD A;  4YYH A;  2LSP B;  5DYU A;  4YBM A;  5BT3 A;  4CUT A;  4ZQL A;  5EI4 A;  4KV4 A;  4Q0O A;  5DW1 A;  5LKZ A;  5HLS A;  3QZT A;  1ZS5 A;  3DAI A;  3O34 A;  4J1P A;  5F5Z A;  5FE7 A;  5I86 A;  5DYX A;  2YW5 A;  4UIV A;  4PKL A;  4XYA A;  4QST A;  5CU8 A;  5CP5 A;  2OUO A;  5CQ7 A;  4KV1 A;  5DKH A;  5JWM A;  4XUA A;  3U5N A;  4NUD A;  5AMF A;  5JI8 A;  4NR4 A;  5FE8 A;  2OSS A;  5A81 A;  2H60 A;  4TT4 A;  4MR5 A;  4NRB A;  5FB1 A;  5FE6 A;  5DLZ A;  4NUC A;  4QR3 A;  5I89 A;  3LQH A;  3UW9 A;  4J0R A;  3Q2E A;  4YBT A;  5F1L A;  3QZS A;  4PY6 A;  3MB3 A;  4AKG A;  4N4G A;  5A5O A;  5EWW A;  4NR9 A;  5ENG A;  5FG6 A;  3JVM A;  4C67 A;  4C66 A;  4O72 A;  5A82 A;  5CTL A;  5FE4 A;  3MQM A;  3D1D A;  4IR5 A;  3IU6 A;  5HEM A;  2I7K A;  5F1H A;  4HBW A;  4MEQ A;  4A9M A;  5FFY A;  4QNS A;  4IR6 A;  5A83 A;  3ERR A;  5D3P A; 
#chains in the Genus database with same CATH homology
 5DYA A;  3G0L A;  3UVW A;  5EPS A;  4MR6 A;  5COI A;  4HXN A;  3ZYU A;  4NYV A;  5E3D A;  5E9M A;  4BJX A;  1F68 A;  3JVJ A;  4LZS A;  3S91 A;  5FFV A;  5I40 A;  5D3R A;  1EQF A;  3I3J A;  4A9E A;  5E0R A;  3AAD A;  4NYW A;  4QSU A;  4IOQ A;  5CUD A;  5LJ2 A;  5CQ6 A;  4OGJ A;  3AQA A;  5FH6 A;  5EWC A;  4CLB A;  3U5K A;  4IOR A;  2R0S A;  5DKD A;  5LKX A;  4O7E A;  3P1D A;  4YYG A;  3RCW A;  4NXJ A;  4A9O A;  4LR6 A;  5E3G A;  5DBM A;  5FG5 A;  5EPR A;  4YYK A;  4CUP A;  4Y03 A;  5CUB A;  5D3N A;  4TZ2 A;  5FE9 A;  2I8N A;  5DFB A;  5FE1 A;  4YBS A;  4NRA A;  3DWY A;  5TCM A;  5ENI A;  3S92 A;  5HQ7 A;  5AD2 A;  4O7F A;  2RO1 A;  4UIT A;  4WIV A;  5CZG A;  4YAX A;  4YYI A;  5LJ1 A;  5FE2 A;  5KTU A;  5I88 A;  2OO1 A;  5I7Y A;  4YH4 A;  3HMH A;  4NR8 A;  4PCE A;  5HCL A;  4UYD A;  5I80 A;  1X0J A;  5J0D A;  3MB4 A;  5ENF A;  2RNX A;  5CUA A;  5CUE A;  4O70 A;  4HXS A;  4RVR A;  4IR3 A;  4QSW A;  2R10 A;  5F36 A;  5D0C A;  4TS8 A;  2E3K A;  4QR4 A;  3HMF A;  5CQA A;  5IGL A;  3U5J A;  2L84 A;  5E9Y A;  5C8G A;  5I7X A;  5E73 A;  4LYI A;  3K2J A;  5KTX A;  5HRX A;  4BW2 A;  5H1V A;  2RNY A;  4CUQ A;  5C89 A;  4LDF A;  4QC3 A;  4ALG A;  4DON A;  5EU1 A;  3MXF A;  5LVQ A;  3U5L A;  4PTB A;  4F3I A;  4J0S A;  4Q0N A;  4OGI A;  5D7X A;  4O7C A;  5E74 A;  5EWV A;  5CUG A;  3LQJ A;  4CUS A;  3MUL A;  5FE3 A;  5HEN A;  5EM3 A;  4HBX A;  4O76 A;  5HQ5 A;  5KTW A;  5CQ8 A;  5EIS A;  5I1Q A;  5EWH A;  5ETD A;  4Z6H A;  4TU4 A;  3U5P A;  4HXR A;  5C4Q A;  5CY9 A;  5L8U A;  5CFW A;  4HXP A;  5DFC A;  5FE0 A;  5FE5 A;  4J3I A;  5CRM A;  5E9V A;  4TQN A;  2L5E A;  3HME A;  4YK0 A;  5EVA A;  4NR5 A;  2F6J A;  5CPE A;  3P1F A;  5DFD A;  1JM4 B;  4QSQ A;  2D9E A;  4LC2 A;  2RNW A;  4MEN A;  2DVQ A;  1N72 A;  4A9N A;  4OUF A;  5FB0 A;  5TB6 A;  4Z1S A;  4YH3 A;  4UYF A;  4LRG A;  4ZW1 A;  5IGM A;  5L97 A;  3JVK A;  2N9G A;  5CUC A;  5II2 A;  3IU5 A;  5D24 A;  5EWD A;  5CQ4 A;  4YY4 A;  5HRW A;  4BW3 A;  3UVD A;  3ONI A;  2GRC A;  4UIU A;  5HQ6 A;  5LUU A;  3P1E A;  4O74 A;  5G4R A;  4HXL A;  4UYH A;  4N4I A;  2RFJ A;  4LZ2 A;  4BW1 A;  5DY7 A;  4QSV A;  2DVV A;  4UYG A;  4O77 A;  4UIW A;  4QC1 A;  4N4H A;  4XY8 A;  2DWW A;  4QSX A;  5D3L A;  3UVX A;  4A9F A;  4MR4 A;  3O35 A;  5E9I A;  3D7C A;  4KCX A;  5A5S A;  3U5M A;  4LZR A;  5DW2 A;  5FBX A;  5EA1 A;  4N3W A;  2DVS A;  5DYC A;  4O7B A;  4AKN A;  1WUG A;  4TT2 A;  2R0Y A;  2E7O A;  2MJV B;  5HM0 A;  4XUB A;  1E6I A;  4UIX A;  5A85 A;  5IID A;  4QY4 A;  5LJ0 A;  3O37 A;  5EK9 A;  4UIY A;  3LQI A;  4QR5 A;  5C87 A;  4TT6 A;  5LKU A;  5CQ5 A;  4N4F A;  5C7N A;  4NR7 A;  4FLP A;  5EV9 A;  4CUR A;  5DLX A;  5KO4 A;  3Q2F A;  5L8T A;  2YEK A;  5CQ3 A;  3LJW A;  3P5O A;  4QZS A;  4NR6 A;  3O36 A;  5C85 A;  4O71 A;  2YQD A;  4QEW A;  5H1U A;  2DVR A;  2KTB B;  5A5R A;  5IGK A;  3U5O A;  2FSA A;  4HBV A;  5ENC A;  4Z6I A;  5FH7 A;  4TTE A;  4YC9 A;  5EP7 A;  4IOO A;  4X2I A;  4WHW A;  5F60 A;  4HXO A;  4A9H A;  4HXM A;  5F25 A;  4IR4 A;  5CS8 A;  5E7D A;  4Z1Q A;  4NQN A;  2YEM A;  4TZ8 A;  3O33 A;  3UV4 A;  5ENB A;  5F2P A;  4TU6 A;  5L99 A;  4QBM A;  3LXJ A;  2RI7 A;  4QYD A;  5ENH A;  5EIC A;  2YEL A;  5D3J A;  4MEO A;  1WUM A;  5F61 A;  4NQM A;  5D26 A;  5EQ1 A;  5IG6 A;  2WP1 A;  5D25 A;  4E96 A;  3MUK A;  2G4A A;  3UV5 A;  5HFQ A;  4LYS A;  5A5N A;  4CFL A;  1JSP B;  3SVF A;  4MR3 A;  5L98 A;  4CFK A;  4NUE A;  5D3H A;  5IBN A;  4MEP A;  4UYF B;  5I29 A;  5F62 A;  5KHM A;  5KU3 A;  5DX4 A;  5A5P A;  2WP2 A;  4CUU A;  4QB3 A;  5F3A A;  4Z93 A;  4PS5 A;  5K29 A;  4YYJ A;  5I83 A;  3TLP A;  3JVL A;  4O78 A;  4QSR A;  4QSS A;  3G0J A;  5CQT A;  4NS5 A;  4LYW A;  4TYL A;  5H85 A;  4UYE A;  4A9I A;  5A7C A;  5BT5 A;  2YYN A;  5EPB A;  4QUT A;  5EGU A;  4BW4 A;  5II1 A;  4YY6 A;  2D82 A;  2YDW A;  3FKM X;  3P1C A;  4A9J A;  5L96 A;  4HXK A;  2NXB A;  5HRV A;  4ALH A;  2DKW A;  4YAT A;  5ENJ A;  4QSP A;  4GPJ A;  4QEV A;  4BHW A;  4YYM A;  4UIZ A;  3GG3 A;  5DKC A;  4O75 A;  4YYN A;  5LKT A;  2E7N A;  5G4S A;  4NYX A;  4A9L A;  4PCI A;  2RS9 B;  4O7A A;  5CRZ A;  4XY9 A;  4ZC9 A;  3UVY A;  5E9L A;  5FG4 A;  5ETB A;  4CL9 A;  4YAB A;  2F6N A;  4YYD A;  5ENE A;  5LVR A;  4QYL A;  5FDZ A;  5HJC A;  3SVH A;  5AME A;  5D3T A;  5D3S A;  5BT4 A;  3UV2 A;  5A5Q A;  5H1T A;  5ACY A;  4QUU A;  5IGN A;  2DAT A;  5HEL A;  4HBY A;  3NXB A;  3QZV A;  4NRC A;  3SVG A;  4QEU A;  4WHU A;  2R0V A;  5F63 A;  5HFR A;  5AD3 A;  4A9K A;  5FH8 A;  5FFW A;  5CGP A;  2L85 A;  5E9K A;  4YAD A;  4YYH A;  2LSP B;  5DYU A;  4YBM A;  5BT3 A;  4CUT A;  4ZQL A;  5EI4 A;  4KV4 A;  4Q0O A;  5DW1 A;  5LKZ A;  5HLS A;  3QZT A;  1ZS5 A;  3DAI A;  3O34 A;  4J1P A;  5F5Z A;  5FE7 A;  5I86 A;  5DYX A;  2YW5 A;  4UIV A;  4PKL A;  4XYA A;  4QST A;  5CU8 A;  5CP5 A;  2OUO A;  5CQ7 A;  4KV1 A;  5DKH A;  5JWM A;  4XUA A;  3U5N A;  4NUD A;  5AMF A;  5JI8 A;  4NR4 A;  5FE8 A;  2OSS A;  5A81 A;  2H60 A;  4TT4 A;  4MR5 A;  4NRB A;  5FB1 A;  5FE6 A;  5DLZ A;  4NUC A;  4QR3 A;  5I89 A;  3LQH A;  3UW9 A;  4J0R A;  3Q2E A;  4YBT A;  5F1L A;  3QZS A;  4PY6 A;  3MB3 A;  4N4G A;  5A5O A;  5EWW A;  4NR9 A;  5ENG A;  5FG6 A;  3JVM A;  4C67 A;  4C66 A;  4O72 A;  5A82 A;  5CTL A;  5FE4 A;  3MQM A;  4IR5 A;  3IU6 A;  5HEM A;  2I7K A;  5F1H A;  4HBW A;  4MEQ A;  4A9M A;  5FFY A;  4QNS A;  4IR6 A;  5A83 A;  5D3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...