5FE6A

Crystal structure of human pcaf bromodomain in complex with fragment zb1916 (fragment 10)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
109
structure length
109
Chain Sequence
RDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT2B
publication title Structure-Based Identification of Inhibitory Fragments Targeting the p300/CBP-Associated Factor Bromodomain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 41
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fe6A00
2I7KA 4GPJA 4CURA 4Q0NA 4CFLA 4TYLA 5DKCA 4Z1QA 5EU1A 2KTBB 4Z93A 4Z1SA 5ENEA 5IBNA 5IG6A 5I80A 5FG4A 4YYKA 5J0DA 5A81A 5HLSA 4J0RA 5CZGA 5HELA 4HXSA 5LVRA 4CLBA 4OGIA 4WIVA 4RVRA 5EISA 4BW2A 4LYWA 5E7DA 3MQMA 5HQ6A 5HRXA 5FB1A 5FBXA 5IIDA 1X0JA 2E3KA 5HQ5A 4CUPA 2YW5A 5H1VA 4UIWA 4IORA 4PS5A 4KV1A 5CS8A 3O35A 5FE4A 5DY7A 4TU4A 4O78A 5CUCA 5F2PA 5KO4A 3G0JA 4BJXA 5F1LA 2I8NA 5EP7A 4QSTA 5CUBA 4O77A 3O36A 5DBMA 4Z6HA 4CUTA 2YEMA 5A5SA 5DFBA 4A9IA 5EPBA 4NR9A 4YH4A 5A83A 4A9NA 3U5NA 3IU6A 4E96A 3Q2FA 1JSPB 3MUKA 5KTXA 5I40A 5I88A 5DYXA 5F3AA 5HENA 3P1EA 4O71A 3FKMX 4MEOA 2D9EA 4O70A 5LKXA 5IGMA 5ETBA 3UVWA 4WHWA 3UVXA 4QR5A 5DKDA 4BW1A 4Z6IA 5E9IA 3LQIA 5A85A 3UV2A 5CQ7A 5FE3A 3S92A 5COIA 5DYAA 3TLPA 5EWWA 5ENBA 5HRVA 4QSRA 5D3RA 4HBXA 5DX4A 4MENA 5ETDA 5A5PA 5BT5A 4YATA 3DAIA 3ONIA 4NYWA 2RNWA 5EWHA 4QC3A 5I83A 5I7XA 5II2A 5FE1A 4HXOA 5LJ2A 4ALHA 3SVHA 5C87A 4IOOA 4J1PA 5BT4A 4QB3A 5CQAA 5F36A 3U5MA 5DLZA 5F1HA 5F25A 4A9KA 5G4SA 4TQNA 5H85A 4IR5A 3U5OA 5HFQA 4QSWA 5EPRA 5EK9A 4QUTA 5F60A 4YAXA 3P1DA 5EWVA 4TZ2A 4O75A 5LKZA 5DYCA 3U5PA 4HXRA 5KTWA 5FE9A 5D3NA 4IR6A 3U5KA 4CUQA 5L97A 4NYXA 5EPSA 5A5OA 5DKHA 3U5JA 4A9OA 4UIXA 5C8GA 4TZ8A 3S91A 4YABA 2DVQA 2RNYA 3ZYUA 4QC1A 5D24A 4ALGA 4QYDA 3JVJA 4N4FA 4QEVA 1ZS5A 2E7NA 5E9MA 5A7CA 4CUSA 5LUUA 5CUEA 4WHUA 4HBWA 4CUUA 4MR4A 5CY9A 4UYFA 5TCMA 4QYLA 4MR6A 2OO1A 5FFVA 4NR7A 4Y03A 5A5RA 5CUAA 4O7EA 5ENJA 5EVAA 5EA1A 5HM0A 4LRGA 3NXBA 4YYMA 2R0YA 4YBMA 4TTEA 5FH8A 4C67A 5E9YA 2G4AA 3RCWA 4UIUA 2DVRA 3HMFA 5EWCA 4N4GA 5FG6A 3AQAA 4QUUA 3JVLA 5EGUA 4YY6A 5C7NA 5CGPA 4O74A 4HXNA 5CRZA 4UYHA 4A9HA 4NYVA 5FE8A 3GG3A 4YBSA 3HMHA 4YK0A 5FH6A 5I89A 5EWDA 5ENIA 3MB3A 2F6JA 4O7FA 5E9KA 4LDFA 4LR6A 4FLPA 4A9JA 4QNSA 4YYNA 4QSSA 5AMFA 4LYIA 4DONA 5DLXA 5D3JA 4PKLA 3DWYA 2RO1A 5FE7A 4YY4A 3AADA 4N4IA 5F61A 5HQ7A 4N4HA 5FFWA 3O34A 4O76A 5HEMA 5IGNA 5EQ1A 5D3SA 5D7XA 4O72A 4XUBA 4LZSA 5CTLA 4ZQLA 4CL9A 2DWWA 4QZSA 5E74A 1WUGA 5ENHA 3G0LA 4BW4A 5E0RA 4MEPA 5AMEA 4OUFA 2WP2A 5L98A 5DW1A 4C66A 5EV9A 3LXJA 5LKTA 5BT3A 2YQDA 4NRBA 3MULA 2DATA 2RNXA 5IGKA 5ENFA 4N3WA 4QSXA 4XUAA 5E3DA 4UIVA 4HXKA 4QY4A 3UV5A 2D82A 4TT6A 5ACYA 3I3JA 4NRAA 5CPEA 4XY9A 5LVQA 1N72A 5KHMA 4PY6A 5CQ6A 5LJ1A 4MEQA 3SVGA 4QSPA 5HCLA 5CQTA 5LJ0A 4KV4A 4J3IA 5I7YA 4HXLA 5HJCA 2R10A 1JM4B 4HXMA 3JVKA 4IR4A 5HRWA 4UIZA 5AD2A 2MJVB 5EM3A 1WUMA 5FB0A 5C89A 3LJWA 4YYJA 5FDZA 3Q2EA 4F3IA 4IR3A 4QEWA 5II1A 2R0SA 3MXFA 2F6NA 5E73A 5C85A 4TT4A 3LQJA 5A5QA 5CUDA 5HFRA 5D0CA 3MB4A 2L5EA 2E7OA 5ENGA 1F68A 5CUGA 5KTUA 4AKNA 5DFCA 5CQ4A 5D26A 3P1FA 4O7CA 4HBYA 4YBTA 5CQ3A 4NRCA 4QR3A 3QZTA 4MR3A 3QZVA 5D25A 2DVVA 3P5OA 5I29A 5H1UA 4YH3A 4NS5A 4PCIA 2YDWA 2OUOA 5I86A 5KU3A 2FSAA 3UVDA 4MR5A 4X2IA 4UITA 3LQHA 3UV4A 2N9GA 5F5ZA 4YYIA 4UIYA 3U5LA 4TU6A 4BW3A 5JI8A 4TS8A 3JVMA 5TB6A 4UYDA 2RS9B 5L8TA 5D3HA 4YYGA 4YYDA 2GRCA 5CP5A 3IU5A 5L96A 3UVYA 5C4QA 2WP1A 4NQMA 5A5NA 5DW2A 4NUEA 2LSPB 5D3LA 4QBMA 5FE2A 5DFDA 5F62A 5E9VA 5CQ5A 2RFJA 3K2JA 4Q0OA 5FFYA 4NR5A 3QZSA 4NQNA 4PCEA 4LZ2A 3HMEA 2YELA 5AD3A 1E6IA 2DKWA 4TT2A 5CQ8A 5LKUA 5H1TA 4XYAA 3O37A 5JWMA 5L99A 4LC2A 4HXPA 2L85A 5D3PA 4QSVA 4YADA 5F63A 5CRMA 5D3TA 4QR4A 1EQFA 2R0VA 4A9MA 4UYEA 2DVSA 4QSUA 4LYSA 5FG5A 4PTBA 3D7CA 4QSQA 4OGJA 5EICA 5CU8A 3UW9A 4UYGA 5G4RA 4QEUA 5DYUA 5E3GA 3P1CA 4NUDA 4ZC9A 5EI4A 4O7BA 3SVFA 5I1QA 4ZW1A 4XY8A 4J0SA 4O7AA 5L8UA 4BHWA 5FE5A 5A82A 4UYFB 5FE6A 4NUCA 4CFKA 4NR6A 4A9FA 4YC9A 5FH7A 2OSSA 4KCXA 3O33A 2YEKA 4A9EA 2L84A 5E9LA 5CFWA 2YYNA 2H60A 4YYHA 2RI7A 4NR4A 5ENCA 4HBVA 5K29A 4NXJA 5IGLA 4IOQA 5FE0A 4LZRA 4NR8A 2NXBA 4A9LA
chains in the Genus database with same CATH superfamily
2I7KA 4GPJA 4CURA 4Q0NA 4CFLA 4TYLA 5DKCA 4Z1QA 5EU1A 2KTBB 4Z93A 4Z1SA 5ENEA 5IBNA 5IG6A 5I80A 5FG4A 4YYKA 5J0DA 5A81A 5HLSA 4J0RA 5CZGA 5HELA 4HXSA 5LVRA 4CLBA 1PUOA 4OGIA 4WIVA 4RVRA 5EISA 4BW2A 4LYWA 5E7DA 3D1BA 3MQMA 5HQ6A 5HRXA 5FB1A 5FBXA 5IIDA 1X0JA 2E3KA 5HQ5A 4CUPA 2YW5A 5H1VA 4UIWA 4IORA 4PS5A 4KV1A 5CS8A 3O35A 5FE4A 5DY7A 4TU4A 4O78A 5CUCA 5F2PA 5KO4A 3G0JA 4BJXA 5F1LA 2I8NA 5EP7A 4QSTA 5CUBA 4O77A 4AKHA 3O36A 5DBMA 4Z6HA 4CUTA 2YEMA 5A5SA 5DFBA 4A9IA 5EPBA 4NR9A 4YH4A 5A83A 4A9NA 3U5NA 3IU6A 4E96A 3Q2FA 1JSPB 3MUKA 5KTXA 5I40A 5I88A 5DYXA 5F3AA 4AKGA 5HENA 3P1EA 4O71A 3FKMX 4MEOA 2D9EA 4O70A 5LKXA 5IGMA 5ETBA 3UVWA 4WHWA 3UVXA 4QR5A 5DKDA 4BW1A 4Z6IA 5E9IA 3LQIA 5A85A 3UV2A 5CQ7A 5FE3A 3S92A 5COIA 5DYAA 3TLPA 5EWWA 5ENBA 5HRVA 4QSRA 5D3RA 4HBXA 5DX4A 4MENA 5ETDA 5A5PA 5BT5A 4YATA 3DAIA 3ONIA 4NYWA 2RNWA 5EWHA 4QC3A 5I83A 5I7XA 5II2A 5FE1A 4AI6A 4HXOA 5LJ2A 4ALHA 3SVHA 5C87A 4IOOA 4J1PA 5BT4A 4QB3A 5CQAA 5F36A 3U5MA 5DLZA 5F1HA 5F25A 4A9KA 5G4SA 4TQNA 5H85A 4IR5A 3U5OA 5HFQA 4QSWA 5EPRA 5EK9A 4QUTA 5F60A 4YAXA 3P1DA 5EWVA 4TZ2A 4O75A 5LKZA 5DYCA 3U5PA 4HXRA 5KTWA 5FE9A 5D3NA 4IR6A 3U5KA 4CUQA 5L97A 4NYXA 5EPSA 3ERRA 5A5OA 5DKHA 3U5JA 4A9OA 4UIXA 5C8GA 4TZ8A 3S91A 4YABA 2DVQA 2RNYA 3ZYUA 4QC1A 5D24A 4ALGA 4QYDA 3JVJA 4N4FA 4QEVA 1ZS5A 2E7NA 5E9MA 5A7CA 4CUSA 5LUUA 5CUEA 4WHUA 4HBWA 4CUUA 4MR4A 5CY9A 4UYFA 5TCMA 4QYLA 4MR6A 2OO1A 5FFVA 4NR7A 4Y03A 5A5RA 5CUAA 4O7EA 3D1DA 5ENJA 5EVAA 5EA1A 3VKHA 5HM0A 4LRGA 3NXBA 4YYMA 2R0YA 4YBMA 4TTEA 5FH8A 4C67A 5E9YA 2G4AA 3RCWA 4UIUA 2DVRA 3HMFA 5EWCA 4N4GA 5FG6A 3AQAA 4QUUA 3JVLA 5EGUA 4YY6A 5C7NA 5CGPA 4O74A 4HXNA 5CRZA 4UYHA 4A9HA 4NYVA 5FE8A 3GG3A 4YBSA 3HMHA 4YK0A 5FH6A 5I89A 5EWDA 5ENIA 3MB3A 2F6JA 4O7FA 1ZKRA 5E9KA 4AKIA 4LDFA 4LR6A 4FLPA 4A9JA 4QNSA 4YYNA 4QSSA 5AMFA 4LYIA 4DONA 5DLXA 5D3JA 4PKLA 3DWYA 2RO1A 5FE7A 4YY4A 3AADA 4N4IA 5F61A 5HQ7A 4N4HA 5FFWA 3O34A 4O76A 5HEMA 5IGNA 5EQ1A 5D3SA 5D7XA 4O72A 4XUBA 4LZSA 5CTLA 4ZQLA 4CL9A 2DWWA 4QZSA 5E74A 1WUGA 5ENHA 3G0LA 4BW4A 5E0RA 4MEPA 5AMEA 4OUFA 2WP2A 5L98A 5DW1A 4C66A 5EV9A 3LXJA 5LKTA 5BT3A 2YQDA 4NRBA 3MULA 2DATA 2RNXA 5IGKA 5ENFA 4N3WA 4QSXA 4XUAA 5E3DA 4UIVA 4HXKA 4QY4A 3UV5A 2D82A 4TT6A 5ACYA 3I3JA 4NRAA 5CPEA 4XY9A 5LVQA 1N72A 5KHMA 4PY6A 5CQ6A 5LJ1A 4MEQA 3SVGA 4QSPA 5HCLA 5CQTA 5LJ0A 4KV4A 4J3IA 5I7YA 4HXLA 5HJCA 2R10A 1JM4B 4HXMA 3JVKA 4IR4A 5HRWA 4UIZA 5AD2A 2MJVB 5EM3A 1WUMA 3VKGA 5FB0A 5C89A 3LJWA 4YYJA 5FDZA 3Q2EA 4F3IA 4IR3A 4QEWA 5II1A 2R0SA 3MXFA 2F6NA 5E73A 5C85A 4TT4A 3LQJA 5A5QA 5CUDA 5HFRA 5D0CA 3MB4A 2L5EA 2E7OA 5ENGA 1F68A 5CUGA 5KTUA 4AKNA 5DFCA 5CQ4A 5D26A 3P1FA 4O7CA 4HBYA 4YBTA 5CQ3A 4NRCA 4QR3A 3QZTA 4MR3A 3QZVA 5D25A 2DVVA 3P5OA 5I29A 5H1UA 4YH3A 4NS5A 4PCIA 2YDWA 2OUOA 5I86A 5KU3A 2FSAA 3UVDA 4MR5A 4X2IA 4UITA 3LQHA 3UV4A 2N9GA 5F5ZA 4YYIA 4UIYA 3U5LA 4TU6A 4BW3A 5JI8A 4TS8A 3JVMA 5TB6A 4UYDA 2RS9B 5L8TA 5D3HA 4YYGA 4YYDA 2EJNA 2GRCA 3IU5A 5CP5A 5L96A 3UVYA 5C4QA 2WP1A 4NQMA 5A5NA 5DW2A 4NUEA 2LSPB 5D3LA 4QBMA 5FE2A 5DFDA 5F62A 5E9VA 5CQ5A 2RFJA 3K2JA 4Q0OA 5FFYA 4NR5A 3QZSA 4NQNA 4PCEA 4LZ2A 3HMEA 2YELA 5AD3A 1E6IA 2DKWA 4TT2A 5CQ8A 5LKUA 5H1TA 4XYAA 3O37A 5JWMA 5L99A 4LC2A 4HXPA 2L85A 5D3PA 4QSVA 4YADA 5F63A 5CRMA 5D3TA 4QR4A 1EQFA 2R0VA 4A9MA 4UYEA 2DVSA 4QSUA 4LYSA 5FG5A 4PTBA 3D7CA 4QSQA 4OGJA 5EICA 5CU8A 3UW9A 4UYGA 5G4RA 4QEUA 5DYUA 5E3GA 3P1CA 4NUDA 4ZC9A 5EI4A 4O7BA 3SVFA 5I1QA 4ZW1A 4XY8A 4J0SA 4O7AA 5L8UA 4BHWA 5FE5A 5A82A 4UYFB 5FE6A 4NUCA 4CFKA 4NR6A 4A9FA 4YC9A 5FH7A 2OSSA 4KCXA 3O33A 2YEKA 4A9EA 2L84A 5E9LA 5CFWA 2YYNA 2H60A 4YYHA 2RI7A 4NR4A 5ENCA 4HBVA 5K29A 4NXJA 5IGLA 4IOQA 5FE0A 4LZRA 4NR8A 2NXBA 4A9LA
chains in the Genus database with same CATH topology
2I7KA 4GPJA 4CURA 4Q0NA 4CFLA 4TYLA 5DKCA 4Z1QA 5EU1A 2KTBB 4Z93A 4Z1SA 5ENEA 5IBNA 5IG6A 5I80A 5FG4A 4YYKA 5J0DA 5A81A 5HLSA 4J0RA 5CZGA 5HELA 4HXSA 5LVRA 4CLBA 4OGIA 4WIVA 4RVRA 5EISA 4BW2A 4LYWA 5E7DA 3MQMA 5HQ6A 5HRXA 5FB1A 5FBXA 5IIDA 1X0JA 2E3KA 5HQ5A 4CUPA 2YW5A 5H1VA 4UIWA 4IORA 4PS5A 4KV1A 5CS8A 3O35A 5FE4A 5DY7A 4TU4A 4O78A 5CUCA 5F2PA 5KO4A 3G0JA 4BJXA 5F1LA 2I8NA 5EP7A 4QSTA 5CUBA 4O77A 3O36A 5DBMA 4Z6HA 4CUTA 2YEMA 5A5SA 5DFBA 4A9IA 5EPBA 4NR9A 4YH4A 5A83A 4A9NA 3U5NA 3IU6A 4E96A 3Q2FA 1JSPB 3MUKA 5KTXA 5I40A 5I88A 5DYXA 5F3AA 5HENA 3P1EA 4O71A 3FKMX 4MEOA 2D9EA 4O70A 5LKXA 5IGMA 5ETBA 3UVWA 4WHWA 3UVXA 4QR5A 5DKDA 4BW1A 4Z6IA 5E9IA 3LQIA 5A85A 3UV2A 5CQ7A 5FE3A 3S92A 5COIA 5DYAA 3TLPA 5EWWA 5ENBA 5HRVA 4QSRA 5D3RA 4HBXA 5DX4A 4MENA 5ETDA 5A5PA 5BT5A 4YATA 3DAIA 3ONIA 4NYWA 2RNWA 5EWHA 4QC3A 5I83A 5I7XA 5II2A 5FE1A 4HXOA 5LJ2A 4ALHA 3SVHA 5C87A 4IOOA 4J1PA 5BT4A 4QB3A 5CQAA 5F36A 3U5MA 5DLZA 5F1HA 5F25A 4A9KA 5G4SA 4TQNA 5H85A 4IR5A 3U5OA 5HFQA 4QSWA 5EPRA 5EK9A 4QUTA 5F60A 4YAXA 3P1DA 5EWVA 4TZ2A 4O75A 5LKZA 5DYCA 3U5PA 4HXRA 5KTWA 5FE9A 5D3NA 4IR6A 3U5KA 4CUQA 5L97A 4NYXA 5EPSA 5A5OA 5DKHA 3U5JA 4A9OA 4UIXA 5C8GA 4TZ8A 3S91A 4YABA 2DVQA 2RNYA 3ZYUA 4QC1A 5D24A 4ALGA 4QYDA 3JVJA 4N4FA 4QEVA 1ZS5A 2E7NA 5E9MA 5A7CA 4CUSA 5LUUA 5CUEA 4WHUA 4HBWA 4CUUA 4MR4A 5CY9A 4UYFA 5TCMA 4QYLA 4MR6A 2OO1A 5FFVA 4NR7A 4Y03A 5A5RA 5CUAA 4O7EA 5ENJA 5EVAA 5EA1A 5HM0A 4LRGA 3NXBA 4YYMA 2R0YA 4YBMA 4TTEA 5FH8A 4C67A 5E9YA 2G4AA 3RCWA 4UIUA 2DVRA 3HMFA 5EWCA 4N4GA 5FG6A 3AQAA 4QUUA 3JVLA 5EGUA 4YY6A 5C7NA 5CGPA 4O74A 4HXNA 5CRZA 4UYHA 4A9HA 4NYVA 5FE8A 3GG3A 4YBSA 3HMHA 4YK0A 5FH6A 5I89A 5EWDA 5ENIA 3MB3A 2F6JA 4O7FA 5E9KA 4LDFA 4LR6A 4FLPA 4A9JA 4QNSA 4YYNA 4QSSA 5AMFA 4LYIA 4DONA 5DLXA 5D3JA 4PKLA 3DWYA 2RO1A 5FE7A 4YY4A 3AADA 4N4IA 5F61A 5HQ7A 4N4HA 5FFWA 3O34A 4O76A 5HEMA 5IGNA 5EQ1A 5D3SA 5D7XA 4O72A 4XUBA 4LZSA 5CTLA 4ZQLA 4CL9A 2DWWA 4QZSA 5E74A 1WUGA 5ENHA 3G0LA 4BW4A 5E0RA 4MEPA 5AMEA 4OUFA 2WP2A 5L98A 5DW1A 4C66A 5EV9A 3LXJA 5LKTA 5BT3A 2YQDA 4NRBA 3MULA 2DATA 2RNXA 5IGKA 5ENFA 4N3WA 4QSXA 4XUAA 5E3DA 4UIVA 4HXKA 4QY4A 3UV5A 2D82A 4TT6A 5ACYA 3I3JA 4NRAA 5CPEA 4XY9A 5LVQA 1N72A 5KHMA 4PY6A 5CQ6A 5LJ1A 4MEQA 3SVGA 4QSPA 5HCLA 5CQTA 5LJ0A 4KV4A 4J3IA 5I7YA 4HXLA 5HJCA 2R10A 1JM4B 4HXMA 3JVKA 4IR4A 5HRWA 4UIZA 5AD2A 2MJVB 5EM3A 1WUMA 5FB0A 5C89A 3LJWA 4YYJA 5FDZA 3Q2EA 4F3IA 4IR3A 4QEWA 5II1A 2R0SA 3MXFA 2F6NA 5E73A 5C85A 4TT4A 3LQJA 5A5QA 5CUDA 5HFRA 5D0CA 3MB4A 2L5EA 2E7OA 5ENGA 1F68A 5CUGA 5KTUA 4AKNA 5DFCA 5CQ4A 5D26A 3P1FA 4O7CA 4HBYA 4YBTA 5CQ3A 4NRCA 4QR3A 3QZTA 4MR3A 3QZVA 5D25A 2DVVA 3P5OA 5I29A 5H1UA 4YH3A 4NS5A 4PCIA 2YDWA 2OUOA 5I86A 5KU3A 2FSAA 3UVDA 4MR5A 4X2IA 4UITA 3LQHA 3UV4A 2N9GA 5F5ZA 4YYIA 4UIYA 3U5LA 4TU6A 4BW3A 5JI8A 4TS8A 3JVMA 5TB6A 4UYDA 2RS9B 5L8TA 5D3HA 4YYGA 4YYDA 2GRCA 5CP5A 3IU5A 5L96A 3UVYA 5C4QA 2WP1A 4NQMA 5A5NA 5DW2A 4NUEA 2LSPB 5D3LA 4QBMA 5FE2A 5DFDA 5F62A 5E9VA 5CQ5A 2RFJA 3K2JA 4Q0OA 5FFYA 4NR5A 3QZSA 4NQNA 4PCEA 4LZ2A 3HMEA 2YELA 5AD3A 1E6IA 2DKWA 4TT2A 5CQ8A 5LKUA 5H1TA 4XYAA 3O37A 5JWMA 5L99A 4LC2A 4HXPA 2L85A 5D3PA 4QSVA 4YADA 5F63A 5CRMA 5D3TA 4QR4A 1EQFA 2R0VA 4A9MA 4UYEA 2DVSA 4QSUA 4LYSA 5FG5A 4PTBA 3D7CA 4QSQA 4OGJA 5EICA 5CU8A 3UW9A 4UYGA 5G4RA 4QEUA 5DYUA 5E3GA 3P1CA 4NUDA 4ZC9A 5EI4A 4O7BA 3SVFA 5I1QA 4ZW1A 4XY8A 4J0SA 4O7AA 5L8UA 4BHWA 5FE5A 5A82A 4UYFB 5FE6A 4NUCA 4CFKA 4NR6A 4A9FA 4YC9A 5FH7A 2OSSA 4KCXA 3O33A 2YEKA 4A9EA 2L84A 5E9LA 5CFWA 2YYNA 2H60A 4YYHA 2RI7A 4NR4A 5ENCA 4HBVA 5K29A 4NXJA 5IGLA 4IOQA 5FE0A 4LZRA 4NR8A 2NXBA 4A9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I7K A;  4GPJ A;  4CUR A;  4Q0N A;  4CFL A;  4TYL A;  5DKC A;  4Z1Q A;  5EU1 A;  2KTB B;  4Z93 A;  4Z1S A;  5ENE A;  5IBN A;  5IG6 A;  5I80 A;  5FG4 A;  4YYK A;  5J0D A;  5A81 A;  5HLS A;  4J0R A;  5CZG A;  5HEL A;  4HXS A;  5LVR A;  4CLB A;  4OGI A;  4WIV A;  4RVR A;  5EIS A;  4BW2 A;  4LYW A;  5E7D A;  3MQM A;  5HQ6 A;  5HRX A;  5FB1 A;  5FBX A;  5IID A;  1X0J A;  2E3K A;  5HQ5 A;  4CUP A;  2YW5 A;  5H1V A;  4UIW A;  4IOR A;  4PS5 A;  4KV1 A;  5CS8 A;  3O35 A;  5FE4 A;  5DY7 A;  4TU4 A;  4O78 A;  5CUC A;  5F2P A;  5KO4 A;  3G0J A;  4BJX A;  5F1L A;  2I8N A;  5EP7 A;  4QST A;  5CUB A;  4O77 A;  3O36 A;  5DBM A;  4Z6H A;  4CUT A;  2YEM A;  5A5S A;  5DFB A;  4A9I A;  5EPB A;  4NR9 A;  4YH4 A;  5A83 A;  4A9N A;  3U5N A;  3IU6 A;  4E96 A;  3Q2F A;  1JSP B;  3MUK A;  5KTX A;  5I40 A;  5I88 A;  5DYX A;  5F3A A;  5HEN A;  3P1E A;  4O71 A;  3FKM X;  4MEO A;  2D9E A;  4O70 A;  5LKX A;  5IGM A;  5ETB A;  3UVW A;  4WHW A;  3UVX A;  4QR5 A;  5DKD A;  4BW1 A;  4Z6I A;  5E9I A;  3LQI A;  5A85 A;  3UV2 A;  5CQ7 A;  5FE3 A;  3S92 A;  5COI A;  5DYA A;  3TLP A;  5EWW A;  5ENB A;  5HRV A;  4QSR A;  5D3R A;  4HBX A;  5DX4 A;  4MEN A;  5ETD A;  5A5P A;  5BT5 A;  4YAT A;  3DAI A;  3ONI A;  4NYW A;  2RNW A;  5EWH A;  4QC3 A;  5I83 A;  5I7X A;  5II2 A;  5FE1 A;  4HXO A;  5LJ2 A;  4ALH A;  3SVH A;  5C87 A;  4IOO A;  4J1P A;  5BT4 A;  4QB3 A;  5CQA A;  5F36 A;  3U5M A;  5DLZ A;  5F1H A;  5F25 A;  4A9K A;  5G4S A;  4TQN A;  5H85 A;  4IR5 A;  3U5O A;  5HFQ A;  4QSW A;  5EPR A;  5EK9 A;  4QUT A;  5F60 A;  4YAX A;  3P1D A;  5EWV A;  4TZ2 A;  4O75 A;  5LKZ A;  5DYC A;  3U5P A;  4HXR A;  5KTW A;  5FE9 A;  5D3N A;  4IR6 A;  3U5K A;  4CUQ A;  5L97 A;  4NYX A;  5EPS A;  5A5O A;  5DKH A;  3U5J A;  4A9O A;  4UIX A;  5C8G A;  4TZ8 A;  3S91 A;  4YAB A;  2DVQ A;  2RNY A;  3ZYU A;  4QC1 A;  5D24 A;  4ALG A;  4QYD A;  3JVJ A;  4N4F A;  4QEV A;  1ZS5 A;  2E7N A;  5E9M A;  5A7C A;  4CUS A;  5LUU A;  5CUE A;  4WHU A;  4HBW A;  4CUU A;  4MR4 A;  5CY9 A;  4UYF A;  5TCM A;  4QYL A;  4MR6 A;  2OO1 A;  5FFV A;  4NR7 A;  4Y03 A;  5A5R A;  5CUA A;  4O7E A;  5ENJ A;  5EVA A;  5EA1 A;  5HM0 A;  4LRG A;  3NXB A;  4YYM A;  2R0Y A;  4YBM A;  4TTE A;  5FH8 A;  4C67 A;  5E9Y A;  2G4A A;  3RCW A;  4UIU A;  2DVR A;  3HMF A;  5EWC A;  4N4G A;  5FG6 A;  3AQA A;  4QUU A;  3JVL A;  5EGU A;  4YY6 A;  5C7N A;  5CGP A;  4O74 A;  4HXN A;  5CRZ A;  4UYH A;  4A9H A;  4NYV A;  5FE8 A;  3GG3 A;  4YBS A;  3HMH A;  4YK0 A;  5FH6 A;  5I89 A;  5EWD A;  5ENI A;  3MB3 A;  2F6J A;  4O7F A;  5E9K A;  4LDF A;  4LR6 A;  4FLP A;  4A9J A;  4QNS A;  4YYN A;  4QSS A;  5AMF A;  4LYI A;  4DON A;  5DLX A;  5D3J A;  4PKL A;  3DWY A;  2RO1 A;  5FE7 A;  4YY4 A;  3AAD A;  4N4I A;  5F61 A;  5HQ7 A;  4N4H A;  5FFW A;  3O34 A;  4O76 A;  5HEM A;  5IGN A;  5EQ1 A;  5D3S A;  5D7X A;  4O72 A;  4XUB A;  4LZS A;  5CTL A;  4ZQL A;  4CL9 A;  2DWW A;  4QZS A;  5E74 A;  1WUG A;  5ENH A;  3G0L A;  4BW4 A;  5E0R A;  4MEP A;  5AME A;  4OUF A;  2WP2 A;  5L98 A;  5DW1 A;  4C66 A;  5EV9 A;  3LXJ A;  5LKT A;  5BT3 A;  2YQD A;  4NRB A;  3MUL A;  2DAT A;  2RNX A;  5IGK A;  5ENF A;  4N3W A;  4QSX A;  4XUA A;  5E3D A;  4UIV A;  4HXK A;  4QY4 A;  3UV5 A;  2D82 A;  4TT6 A;  5ACY A;  3I3J A;  4NRA A;  5CPE A;  4XY9 A;  5LVQ A;  1N72 A;  5KHM A;  4PY6 A;  5CQ6 A;  5LJ1 A;  4MEQ A;  3SVG A;  4QSP A;  5HCL A;  5CQT A;  5LJ0 A;  4KV4 A;  4J3I A;  5I7Y A;  4HXL A;  5HJC A;  2R10 A;  1JM4 B;  4HXM A;  3JVK A;  4IR4 A;  5HRW A;  4UIZ A;  5AD2 A;  2MJV B;  5EM3 A;  1WUM A;  5FB0 A;  5C89 A;  3LJW A;  4YYJ A;  5FDZ A;  3Q2E A;  4F3I A;  4IR3 A;  4QEW A;  5II1 A;  2R0S A;  3MXF A;  2F6N A;  5E73 A;  5C85 A;  4TT4 A;  3LQJ A;  5A5Q A;  5CUD A;  5HFR A;  5D0C A;  3MB4 A;  2L5E A;  2E7O A;  5ENG A;  1F68 A;  5CUG A;  5KTU A;  4AKN A;  5DFC A;  5CQ4 A;  5D26 A;  3P1F A;  4O7C A;  4HBY A;  4YBT A;  5CQ3 A;  4NRC A;  4QR3 A;  3QZT A;  4MR3 A;  3QZV A;  5D25 A;  2DVV A;  3P5O A;  5I29 A;  5H1U A;  4YH3 A;  4NS5 A;  4PCI A;  2YDW A;  2OUO A;  5I86 A;  5KU3 A;  2FSA A;  3UVD A;  4MR5 A;  4X2I A;  4UIT A;  3LQH A;  3UV4 A;  2N9G A;  5F5Z A;  4YYI A;  4UIY A;  3U5L A;  4TU6 A;  4BW3 A;  5JI8 A;  4TS8 A;  3JVM A;  5TB6 A;  4UYD A;  2RS9 B;  5L8T A;  5D3H A;  4YYG A;  4YYD A;  2GRC A;  5CP5 A;  3IU5 A;  5L96 A;  3UVY A;  5C4Q A;  2WP1 A;  4NQM A;  5A5N A;  5DW2 A;  4NUE A;  2LSP B;  5D3L A;  4QBM A;  5FE2 A;  5DFD A;  5F62 A;  5E9V A;  5CQ5 A;  2RFJ A;  3K2J A;  4Q0O A;  5FFY A;  4NR5 A;  3QZS A;  4NQN A;  4PCE A;  4LZ2 A;  3HME A;  2YEL A;  5AD3 A;  1E6I A;  2DKW A;  4TT2 A;  5CQ8 A;  5LKU A;  5H1T A;  4XYA A;  3O37 A;  5JWM A;  5L99 A;  4LC2 A;  4HXP A;  2L85 A;  5D3P A;  4QSV A;  4YAD A;  5F63 A;  5CRM A;  5D3T A;  4QR4 A;  1EQF A;  2R0V A;  4A9M A;  4UYE A;  2DVS A;  4QSU A;  4LYS A;  5FG5 A;  4PTB A;  3D7C A;  4QSQ A;  4OGJ A;  5EIC A;  5CU8 A;  3UW9 A;  4UYG A;  5G4R A;  4QEU A;  5DYU A;  5E3G A;  3P1C A;  4NUD A;  4ZC9 A;  5EI4 A;  4O7B A;  3SVF A;  5I1Q A;  4ZW1 A;  4XY8 A;  4J0S A;  4O7A A;  5L8U A;  4BHW A;  5FE5 A;  5A82 A;  4UYF B;  5FE6 A;  4NUC A;  4CFK A;  4NR6 A;  4A9F A;  4YC9 A;  5FH7 A;  2OSS A;  4KCX A;  3O33 A;  2YEK A;  4A9E A;  2L84 A;  5E9L A;  5CFW A;  2YYN A;  2H60 A;  4YYH A;  2RI7 A;  4NR4 A;  5ENC A;  4HBV A;  5K29 A;  4NXJ A;  5IGL A;  4IOQ A;  5FE0 A;  4LZR A;  4NR8 A;  2NXB A;  4A9L A; 
#chains in the Genus database with same CATH topology
 2I7K A;  4GPJ A;  4CUR A;  4Q0N A;  4CFL A;  4TYL A;  5DKC A;  4Z1Q A;  5EU1 A;  2KTB B;  4Z93 A;  4Z1S A;  5ENE A;  5IBN A;  5IG6 A;  5I80 A;  5FG4 A;  4YYK A;  5J0D A;  5A81 A;  5HLS A;  4J0R A;  5CZG A;  5HEL A;  4HXS A;  5LVR A;  4CLB A;  1PUO A;  4OGI A;  4WIV A;  4RVR A;  5EIS A;  4BW2 A;  4LYW A;  5E7D A;  3D1B A;  3MQM A;  5HQ6 A;  5HRX A;  5FB1 A;  5FBX A;  5IID A;  1X0J A;  2E3K A;  5HQ5 A;  4CUP A;  2YW5 A;  5H1V A;  4UIW A;  4IOR A;  4PS5 A;  4KV1 A;  5CS8 A;  3O35 A;  5FE4 A;  5DY7 A;  4TU4 A;  4O78 A;  5CUC A;  5F2P A;  5KO4 A;  3G0J A;  4BJX A;  5F1L A;  2I8N A;  5EP7 A;  4QST A;  5CUB A;  4O77 A;  4AKH A;  3O36 A;  5DBM A;  4Z6H A;  4CUT A;  2YEM A;  5A5S A;  5DFB A;  4A9I A;  5EPB A;  4NR9 A;  4YH4 A;  5A83 A;  4A9N A;  3U5N A;  3IU6 A;  4E96 A;  3Q2F A;  1JSP B;  3MUK A;  5KTX A;  5I40 A;  5I88 A;  5DYX A;  5F3A A;  4AKG A;  5HEN A;  3P1E A;  4O71 A;  3FKM X;  4MEO A;  2D9E A;  4O70 A;  5LKX A;  5IGM A;  5ETB A;  3UVW A;  4WHW A;  3UVX A;  4QR5 A;  5DKD A;  4BW1 A;  4Z6I A;  5E9I A;  3LQI A;  5A85 A;  3UV2 A;  5CQ7 A;  5FE3 A;  3S92 A;  5COI A;  5DYA A;  3TLP A;  5EWW A;  5ENB A;  5HRV A;  4QSR A;  5D3R A;  4HBX A;  5DX4 A;  4MEN A;  5ETD A;  5A5P A;  5BT5 A;  4YAT A;  3DAI A;  3ONI A;  4NYW A;  2RNW A;  5EWH A;  4QC3 A;  5I83 A;  5I7X A;  5II2 A;  5FE1 A;  4AI6 A;  4HXO A;  5LJ2 A;  4ALH A;  3SVH A;  5C87 A;  4IOO A;  4J1P A;  5BT4 A;  4QB3 A;  5CQA A;  5F36 A;  3U5M A;  5DLZ A;  5F1H A;  5F25 A;  4A9K A;  5G4S A;  4TQN A;  5H85 A;  4IR5 A;  3U5O A;  5HFQ A;  4QSW A;  5EPR A;  5EK9 A;  4QUT A;  5F60 A;  4YAX A;  3P1D A;  5EWV A;  4TZ2 A;  4O75 A;  5LKZ A;  5DYC A;  3U5P A;  4HXR A;  5KTW A;  5FE9 A;  5D3N A;  4IR6 A;  3U5K A;  4CUQ A;  5L97 A;  4NYX A;  5EPS A;  3ERR A;  5A5O A;  5DKH A;  3U5J A;  4A9O A;  4UIX A;  5C8G A;  4TZ8 A;  3S91 A;  4YAB A;  2DVQ A;  2RNY A;  3ZYU A;  4QC1 A;  5D24 A;  4ALG A;  4QYD A;  3JVJ A;  4N4F A;  4QEV A;  1ZS5 A;  2E7N A;  5E9M A;  5A7C A;  4CUS A;  5LUU A;  5CUE A;  4WHU A;  4HBW A;  4CUU A;  4MR4 A;  5CY9 A;  4UYF A;  5TCM A;  4QYL A;  4MR6 A;  2OO1 A;  5FFV A;  4NR7 A;  4Y03 A;  5A5R A;  5CUA A;  4O7E A;  3D1D A;  5ENJ A;  5EVA A;  5EA1 A;  3VKH A;  5HM0 A;  4LRG A;  3NXB A;  4YYM A;  2R0Y A;  4YBM A;  4TTE A;  5FH8 A;  4C67 A;  5E9Y A;  2G4A A;  3RCW A;  4UIU A;  2DVR A;  3HMF A;  5EWC A;  4N4G A;  5FG6 A;  3AQA A;  4QUU A;  3JVL A;  5EGU A;  4YY6 A;  5C7N A;  5CGP A;  4O74 A;  4HXN A;  5CRZ A;  4UYH A;  4A9H A;  4NYV A;  5FE8 A;  3GG3 A;  4YBS A;  3HMH A;  4YK0 A;  5FH6 A;  5I89 A;  5EWD A;  5ENI A;  3MB3 A;  2F6J A;  4O7F A;  1ZKR A;  5E9K A;  4AKI A;  4LDF A;  4LR6 A;  4FLP A;  4A9J A;  4QNS A;  4YYN A;  4QSS A;  5AMF A;  4LYI A;  4DON A;  5DLX A;  5D3J A;  4PKL A;  3DWY A;  2RO1 A;  5FE7 A;  4YY4 A;  3AAD A;  4N4I A;  5F61 A;  5HQ7 A;  4N4H A;  5FFW A;  3O34 A;  4O76 A;  5HEM A;  5IGN A;  5EQ1 A;  5D3S A;  5D7X A;  4O72 A;  4XUB A;  4LZS A;  5CTL A;  4ZQL A;  4CL9 A;  2DWW A;  4QZS A;  5E74 A;  1WUG A;  5ENH A;  3G0L A;  4BW4 A;  5E0R A;  4MEP A;  5AME A;  4OUF A;  2WP2 A;  5L98 A;  5DW1 A;  4C66 A;  5EV9 A;  3LXJ A;  5LKT A;  5BT3 A;  2YQD A;  4NRB A;  3MUL A;  2DAT A;  2RNX A;  5IGK A;  5ENF A;  4N3W A;  4QSX A;  4XUA A;  5E3D A;  4UIV A;  4HXK A;  4QY4 A;  3UV5 A;  2D82 A;  4TT6 A;  5ACY A;  3I3J A;  4NRA A;  5CPE A;  4XY9 A;  5LVQ A;  1N72 A;  5KHM A;  4PY6 A;  5CQ6 A;  5LJ1 A;  4MEQ A;  3SVG A;  4QSP A;  5HCL A;  5CQT A;  5LJ0 A;  4KV4 A;  4J3I A;  5I7Y A;  4HXL A;  5HJC A;  2R10 A;  1JM4 B;  4HXM A;  3JVK A;  4IR4 A;  5HRW A;  4UIZ A;  5AD2 A;  2MJV B;  5EM3 A;  1WUM A;  3VKG A;  5FB0 A;  5C89 A;  3LJW A;  4YYJ A;  5FDZ A;  3Q2E A;  4F3I A;  4IR3 A;  4QEW A;  5II1 A;  2R0S A;  3MXF A;  2F6N A;  5E73 A;  5C85 A;  4TT4 A;  3LQJ A;  5A5Q A;  5CUD A;  5HFR A;  5D0C A;  3MB4 A;  2L5E A;  2E7O A;  5ENG A;  1F68 A;  5CUG A;  5KTU A;  4AKN A;  5DFC A;  5CQ4 A;  5D26 A;  3P1F A;  4O7C A;  4HBY A;  4YBT A;  5CQ3 A;  4NRC A;  4QR3 A;  3QZT A;  4MR3 A;  3QZV A;  5D25 A;  2DVV A;  3P5O A;  5I29 A;  5H1U A;  4YH3 A;  4NS5 A;  4PCI A;  2YDW A;  2OUO A;  5I86 A;  5KU3 A;  2FSA A;  3UVD A;  4MR5 A;  4X2I A;  4UIT A;  3LQH A;  3UV4 A;  2N9G A;  5F5Z A;  4YYI A;  4UIY A;  3U5L A;  4TU6 A;  4BW3 A;  5JI8 A;  4TS8 A;  3JVM A;  5TB6 A;  4UYD A;  2RS9 B;  5L8T A;  5D3H A;  4YYG A;  4YYD A;  2EJN A;  2GRC A;  3IU5 A;  5CP5 A;  5L96 A;  3UVY A;  5C4Q A;  2WP1 A;  4NQM A;  5A5N A;  5DW2 A;  4NUE A;  2LSP B;  5D3L A;  4QBM A;  5FE2 A;  5DFD A;  5F62 A;  5E9V A;  5CQ5 A;  2RFJ A;  3K2J A;  4Q0O A;  5FFY A;  4NR5 A;  3QZS A;  4NQN A;  4PCE A;  4LZ2 A;  3HME A;  2YEL A;  5AD3 A;  1E6I A;  2DKW A;  4TT2 A;  5CQ8 A;  5LKU A;  5H1T A;  4XYA A;  3O37 A;  5JWM A;  5L99 A;  4LC2 A;  4HXP A;  2L85 A;  5D3P A;  4QSV A;  4YAD A;  5F63 A;  5CRM A;  5D3T A;  4QR4 A;  1EQF A;  2R0V A;  4A9M A;  4UYE A;  2DVS A;  4QSU A;  4LYS A;  5FG5 A;  4PTB A;  3D7C A;  4QSQ A;  4OGJ A;  5EIC A;  5CU8 A;  3UW9 A;  4UYG A;  5G4R A;  4QEU A;  5DYU A;  5E3G A;  3P1C A;  4NUD A;  4ZC9 A;  5EI4 A;  4O7B A;  3SVF A;  5I1Q A;  4ZW1 A;  4XY8 A;  4J0S A;  4O7A A;  5L8U A;  4BHW A;  5FE5 A;  5A82 A;  4UYF B;  5FE6 A;  4NUC A;  4CFK A;  4NR6 A;  4A9F A;  4YC9 A;  5FH7 A;  2OSS A;  4KCX A;  3O33 A;  2YEK A;  4A9E A;  2L84 A;  5E9L A;  5CFW A;  2YYN A;  2H60 A;  4YYH A;  2RI7 A;  4NR4 A;  5ENC A;  4HBV A;  5K29 A;  4NXJ A;  5IGL A;  4IOQ A;  5FE0 A;  4LZR A;  4NR8 A;  2NXB A;  4A9L A; 
#chains in the Genus database with same CATH homology
 2I7K A;  4GPJ A;  4CUR A;  4Q0N A;  4CFL A;  4TYL A;  5DKC A;  4Z1Q A;  5EU1 A;  2KTB B;  4Z93 A;  4Z1S A;  5ENE A;  5IBN A;  5IG6 A;  5I80 A;  5FG4 A;  4YYK A;  5J0D A;  5A81 A;  5HLS A;  4J0R A;  5CZG A;  5HEL A;  4HXS A;  5LVR A;  4CLB A;  4OGI A;  4WIV A;  4RVR A;  5EIS A;  4BW2 A;  4LYW A;  5E7D A;  3MQM A;  5HQ6 A;  5HRX A;  5FB1 A;  5FBX A;  5IID A;  1X0J A;  2E3K A;  5HQ5 A;  4CUP A;  2YW5 A;  5H1V A;  4UIW A;  4IOR A;  4PS5 A;  4KV1 A;  5CS8 A;  3O35 A;  5FE4 A;  5DY7 A;  4TU4 A;  4O78 A;  5CUC A;  5F2P A;  5KO4 A;  3G0J A;  4BJX A;  5F1L A;  2I8N A;  5EP7 A;  4QST A;  5CUB A;  4O77 A;  3O36 A;  5DBM A;  4Z6H A;  4CUT A;  2YEM A;  5A5S A;  5DFB A;  4A9I A;  5EPB A;  4NR9 A;  4YH4 A;  5A83 A;  4A9N A;  3U5N A;  3IU6 A;  4E96 A;  3Q2F A;  1JSP B;  3MUK A;  5KTX A;  5I40 A;  5I88 A;  5DYX A;  5F3A A;  5HEN A;  3P1E A;  4O71 A;  3FKM X;  4MEO A;  2D9E A;  4O70 A;  5LKX A;  5IGM A;  5ETB A;  3UVW A;  4WHW A;  3UVX A;  4QR5 A;  5DKD A;  4BW1 A;  4Z6I A;  5E9I A;  3LQI A;  5A85 A;  3UV2 A;  5CQ7 A;  5FE3 A;  3S92 A;  5COI A;  5DYA A;  3TLP A;  5EWW A;  5ENB A;  5HRV A;  4QSR A;  5D3R A;  4HBX A;  5DX4 A;  4MEN A;  5ETD A;  5A5P A;  5BT5 A;  4YAT A;  3DAI A;  3ONI A;  4NYW A;  2RNW A;  5EWH A;  4QC3 A;  5I83 A;  5I7X A;  5II2 A;  5FE1 A;  4HXO A;  5LJ2 A;  4ALH A;  3SVH A;  5C87 A;  4IOO A;  4J1P A;  5BT4 A;  4QB3 A;  5CQA A;  5F36 A;  3U5M A;  5DLZ A;  5F1H A;  5F25 A;  4A9K A;  5G4S A;  4TQN A;  5H85 A;  4IR5 A;  3U5O A;  5HFQ A;  4QSW A;  5EPR A;  5EK9 A;  4QUT A;  5F60 A;  4YAX A;  3P1D A;  5EWV A;  4TZ2 A;  4O75 A;  5LKZ A;  5DYC A;  3U5P A;  4HXR A;  5KTW A;  5FE9 A;  5D3N A;  4IR6 A;  3U5K A;  4CUQ A;  5L97 A;  4NYX A;  5EPS A;  5A5O A;  5DKH A;  3U5J A;  4A9O A;  4UIX A;  5C8G A;  4TZ8 A;  3S91 A;  4YAB A;  2DVQ A;  2RNY A;  3ZYU A;  4QC1 A;  5D24 A;  4ALG A;  4QYD A;  3JVJ A;  4N4F A;  4QEV A;  1ZS5 A;  2E7N A;  5E9M A;  5A7C A;  4CUS A;  5LUU A;  5CUE A;  4WHU A;  4HBW A;  4CUU A;  4MR4 A;  5CY9 A;  4UYF A;  5TCM A;  4QYL A;  4MR6 A;  2OO1 A;  5FFV A;  4NR7 A;  4Y03 A;  5A5R A;  5CUA A;  4O7E A;  5ENJ A;  5EVA A;  5EA1 A;  5HM0 A;  4LRG A;  3NXB A;  4YYM A;  2R0Y A;  4YBM A;  4TTE A;  5FH8 A;  4C67 A;  5E9Y A;  2G4A A;  3RCW A;  4UIU A;  2DVR A;  3HMF A;  5EWC A;  4N4G A;  5FG6 A;  3AQA A;  4QUU A;  3JVL A;  5EGU A;  4YY6 A;  5C7N A;  5CGP A;  4O74 A;  4HXN A;  5CRZ A;  4UYH A;  4A9H A;  4NYV A;  5FE8 A;  3GG3 A;  4YBS A;  3HMH A;  4YK0 A;  5FH6 A;  5I89 A;  5EWD A;  5ENI A;  3MB3 A;  2F6J A;  4O7F A;  5E9K A;  4LDF A;  4LR6 A;  4FLP A;  4A9J A;  4QNS A;  4YYN A;  4QSS A;  5AMF A;  4LYI A;  4DON A;  5DLX A;  5D3J A;  4PKL A;  3DWY A;  2RO1 A;  5FE7 A;  4YY4 A;  3AAD A;  4N4I A;  5F61 A;  5HQ7 A;  4N4H A;  5FFW A;  3O34 A;  4O76 A;  5HEM A;  5IGN A;  5EQ1 A;  5D3S A;  5D7X A;  4O72 A;  4XUB A;  4LZS A;  5CTL A;  4ZQL A;  4CL9 A;  2DWW A;  4QZS A;  5E74 A;  1WUG A;  5ENH A;  3G0L A;  4BW4 A;  5E0R A;  4MEP A;  5AME A;  4OUF A;  2WP2 A;  5L98 A;  5DW1 A;  4C66 A;  5EV9 A;  3LXJ A;  5LKT A;  5BT3 A;  2YQD A;  4NRB A;  3MUL A;  2DAT A;  2RNX A;  5IGK A;  5ENF A;  4N3W A;  4QSX A;  4XUA A;  5E3D A;  4UIV A;  4HXK A;  4QY4 A;  3UV5 A;  2D82 A;  4TT6 A;  5ACY A;  3I3J A;  4NRA A;  5CPE A;  4XY9 A;  5LVQ A;  1N72 A;  5KHM A;  4PY6 A;  5CQ6 A;  5LJ1 A;  4MEQ A;  3SVG A;  4QSP A;  5HCL A;  5CQT A;  5LJ0 A;  4KV4 A;  4J3I A;  5I7Y A;  4HXL A;  5HJC A;  2R10 A;  1JM4 B;  4HXM A;  3JVK A;  4IR4 A;  5HRW A;  4UIZ A;  5AD2 A;  2MJV B;  5EM3 A;  1WUM A;  5FB0 A;  5C89 A;  3LJW A;  4YYJ A;  5FDZ A;  3Q2E A;  4F3I A;  4IR3 A;  4QEW A;  5II1 A;  2R0S A;  3MXF A;  2F6N A;  5E73 A;  5C85 A;  4TT4 A;  3LQJ A;  5A5Q A;  5CUD A;  5HFR A;  5D0C A;  3MB4 A;  2L5E A;  2E7O A;  5ENG A;  1F68 A;  5CUG A;  5KTU A;  4AKN A;  5DFC A;  5CQ4 A;  5D26 A;  3P1F A;  4O7C A;  4HBY A;  4YBT A;  5CQ3 A;  4NRC A;  4QR3 A;  3QZT A;  4MR3 A;  3QZV A;  5D25 A;  2DVV A;  3P5O A;  5I29 A;  5H1U A;  4YH3 A;  4NS5 A;  4PCI A;  2YDW A;  2OUO A;  5I86 A;  5KU3 A;  2FSA A;  3UVD A;  4MR5 A;  4X2I A;  4UIT A;  3LQH A;  3UV4 A;  2N9G A;  5F5Z A;  4YYI A;  4UIY A;  3U5L A;  4TU6 A;  4BW3 A;  5JI8 A;  4TS8 A;  3JVM A;  5TB6 A;  4UYD A;  2RS9 B;  5L8T A;  5D3H A;  4YYG A;  4YYD A;  2GRC A;  5CP5 A;  3IU5 A;  5L96 A;  3UVY A;  5C4Q A;  2WP1 A;  4NQM A;  5A5N A;  5DW2 A;  4NUE A;  2LSP B;  5D3L A;  4QBM A;  5FE2 A;  5DFD A;  5F62 A;  5E9V A;  5CQ5 A;  2RFJ A;  3K2J A;  4Q0O A;  5FFY A;  4NR5 A;  3QZS A;  4NQN A;  4PCE A;  4LZ2 A;  3HME A;  2YEL A;  5AD3 A;  1E6I A;  2DKW A;  4TT2 A;  5CQ8 A;  5LKU A;  5H1T A;  4XYA A;  3O37 A;  5JWM A;  5L99 A;  4LC2 A;  4HXP A;  2L85 A;  5D3P A;  4QSV A;  4YAD A;  5F63 A;  5CRM A;  5D3T A;  4QR4 A;  1EQF A;  2R0V A;  4A9M A;  4UYE A;  2DVS A;  4QSU A;  4LYS A;  5FG5 A;  4PTB A;  3D7C A;  4QSQ A;  4OGJ A;  5EIC A;  5CU8 A;  3UW9 A;  4UYG A;  5G4R A;  4QEU A;  5DYU A;  5E3G A;  3P1C A;  4NUD A;  4ZC9 A;  5EI4 A;  4O7B A;  3SVF A;  5I1Q A;  4ZW1 A;  4XY8 A;  4J0S A;  4O7A A;  5L8U A;  4BHW A;  5FE5 A;  5A82 A;  4UYF B;  5FE6 A;  4NUC A;  4CFK A;  4NR6 A;  4A9F A;  4YC9 A;  5FH7 A;  2OSS A;  4KCX A;  3O33 A;  2YEK A;  4A9E A;  2L84 A;  5E9L A;  5CFW A;  2YYN A;  2H60 A;  4YYH A;  2RI7 A;  4NR4 A;  5ENC A;  4HBV A;  5K29 A;  4NXJ A;  5IGL A;  4IOQ A;  5FE0 A;  4LZR A;  4NR8 A;  2NXB A;  4A9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...