2RS9B

Solution structure of the bromodomain of human brpf1 in complex with histone h4k5ac peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
121
structure length
121
Chain Sequence
GSSGSSGFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Acetylated lysine 5 of peptide from Histone H4
publication title Site-specific histone recognition by the bromodomain of Brpf1 and the role in MOZ/MORF histone acetyltransferase complexes
rcsb
source organism Homo sapiens
total genus 36
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2rs9B00
4ZQLA 5ETBA 3U5LA 5A5SA 3QZVA 4TT6A 4BW4A 3DAIA 5DBMA 4AKNA 2GRCA 4N4FA 5E7DA 5I86A 4O74A 5F36A 4KV4A 4O7BA 5HEMA 5KTWA 3U5OA 2R0YA 5FG6A 4N3WA 5IGLA 5LKTA 4YY6A 4UIXA 5HFRA 5E9MA 5EWWA 4TU4A 5HQ7A 5HM0A 2E3KA 5L99A 5E9IA 4TS8A 4KV1A 3QZTA 5TB6A 4WIVA 2G4AA 4XY9A 3U5MA 4O75A 4YYDA 3O34A 5D25A 4QC3A 5CUAA 3U5JA 4UYFA 4LZSA 4YYIA 4NQNA 4A9NA 4CLBA 4O78A 3FKMX 2D82A 4A9MA 4NXJA 4OGIA 5DFCA 3D7CA 5D7XA 5C85A 4CFLA 3LXJA 5IBNA 2I7KA 2LSPB 5IGNA 3GG3A 3P1EA 5CRZA 3AADA 5A5QA 4HXRA 4NQMA 4NR9A 5FBXA 3SVFA 4CUTA 4YYNA 5K29A 5EPBA 5DYAA 4PCEA 4O7EA 5KTXA 4PKLA 3SVHA 4PS5A 5E74A 5CS8A 5CZGA 5FH8A 5TCMA 5C89A 4Z6IA 5KTUA 5D3JA 5EWHA 4UITA 3IU6A 2KTBB 5ENIA 5LKZA 1WUGA 4TYLA 5DFBA 2F6JA 5BT5A 2L85A 5H1TA 3G0JA 5A82A 3LJWA 5D26A 3ZYUA 5FH7A 4IORA 4HXMA 5AD3A 5EICA 4MEQA 5CUGA 3P5OA 4TT2A 4CUSA 5D24A 2DATA 2OUOA 5LJ0A 2RNXA 3LQHA 4QSXA 4QSQA 5CTLA 5FG5A 5FB1A 3O35A 3O36A 4RVRA 5I88A 3MULA 5FH6A 2YEKA 5EGUA 4XY8A 3Q2FA 2D9EA 4O71A 5FB0A 5LJ2A 4LZ2A 4HXKA 4UYEA 5FE3A 4BW3A 4GPJA 1JSPB 5ENGA 5HLSA 5CQAA 4QSTA 4MEOA 5CQ5A 4QNSA 4LYSA 4HXNA 5EA1A 4MR3A 3UV4A 3JVJA 5IG6A 5BT4A 5CQ6A 4BW2A 5CU8A 5EU1A 5A5RA 5ENEA 4XYAA 4XUAA 5E9VA 5EVAA 5A5NA 3UW9A 3O37A 5A81A 5DFDA 5FE4A 5A83A 5DYXA 5EV9A 4QB3A 3S92A 4NRBA 5FDZA 5FE8A 5G4SA 3U5PA 4LRGA 5HRVA 3TLPA 5CFWA 5E73A 5CQ3A 5LVRA 5D3TA 2YYNA 2DVQA 3K2JA 4HXLA 5E9KA 4A9JA 5H85A 5BT3A 3P1DA 4QY4A 3JVKA 4UIUA 4YAXA 4QYDA 5ENCA 5DLXA 5E3GA 4NRCA 4QSRA 4A9EA 4IOQA 4Z1QA 4OGJA 4NR8A 5EWVA 5DX4A 4Q0NA 1EQFA 4OUFA 5C7NA 5IGKA 4PCIA 4UIYA 4CURA 5EP7A 4CUPA 4UIZA 2RS9B 2MJVB 5EPRA 5F63A 5CUDA 5F61A 4HBWA 4PTBA 3UVDA 4F3IA 4O72A 5EQ1A 5E3DA 4QYLA 4UYDA 1X0JA 5DYUA 5C87A 2RNWA 5I29A 4J0SA 4NYVA 4C66A 5C4QA 2R10A 5FE1A 2RNYA 4QSPA 3UVWA 4TZ2A 4NYWA 2E7NA 2L5EA 4NR6A 5AMEA 5HCLA 2E7OA 2H60A 5HELA 5DW1A 3P1FA 4QZSA 4BJXA 5FE0A 4UYGA 5DW2A 5F1HA 4QC1A 4QUUA 5FE2A 4Z6HA 5C8GA 3IU5A 4YADA 5E0RA 3MQMA 4IR6A 3UVXA 5HJCA 2RI7A 3ONIA 5FFWA 5F62A 5DY7A 2NXBA 4X2IA 5H1UA 2RFJA 3MB3A 2DVRA 5HRWA 5LVQA 5FE9A 4LC2A 4UYFB 3S91A 4LZRA 4NUDA 4A9OA 4HBVA 2YELA 4QR5A 1ZS5A 4MR6A 1JM4B 3MXFA 3HMEA 4WHUA 5I1QA 4CL9A 4Y03A 4WHWA 4YATA 2DVVA 5DYCA 4TQNA 4YBMA 3SVGA 5EWCA 5II2A 5FE7A 5L8TA 4MR5A 5F3AA 4Z93A 3I3JA 1F68A 5I83A 5CQTA 4LDFA 5LUUA 2YDWA 4YBSA 5A7CA 5DKCA 4HXPA 4N4HA 3JVLA 4IOOA 5I80A 4YH4A 5L8UA 2OO1A 4O76A 2R0VA 4J0RA 3UV5A 4ZC9A 4YABA 3Q2EA 5F60A 4A9FA 5CUBA 5I40A 4LYIA 5CUCA 4ALHA 4QSSA 5L96A 3QZSA 4QSUA 2DKWA 5EPSA 5EWDA 2WP2A 4CUQA 5L98A 5I89A 5AD2A 5CP5A 4NR4A 1E6IA 4E96A 5F2PA 5EM3A 5JWMA 5HENA 3DWYA 3RCWA 5J0DA 4QEVA 2WP1A 5A5OA 4QR4A 4NS5A 4QEWA 5ETDA 5CQ4A 5ENFA 4TZ8A 2OSSA 2N9GA 3UV2A 4O70A 5CQ7A 5E9YA 5G4RA 4O7CA 5CY9A 4N4GA 2DVSA 5H1VA 5LJ1A 2YEMA 3LQIA 5FE6A 5F25A 5IGMA 4IR3A 5FFVA 5HFQA 1N72A 4YC9A 5ENHA 4CUUA 5F1LA 3HMHA 5I7YA 4HXOA 4NYXA 4QEUA 5D3NA 5FG4A 3AQAA 4YH3A 4QSVA 2FSAA 5ENBA 5CQ8A 5D3PA 4XUBA 5E9LA 4MENA 3JVMA 5CUEA 4HBXA 4QSWA 4O7AA 4NRAA 5DKHA 4A9IA 4NR7A 3NXBA 5LKXA 3U5KA 4J1PA 4TTEA 4O77A 4FLPA 4QUTA 3LQJA 4CFKA 4MEPA 5ACYA 5F5ZA 5CPEA 5D3HA 4BHWA 5DKDA 3U5NA 4YYHA 4YBTA 4HXSA 4A9KA 4YYKA 4A9HA 4QBMA 4LR6A 5D3RA 1WUMA 5KHMA 5FE5A 4NUCA 4PY6A 5A5PA 5KO4A 5CGPA 4QR3A 5COIA 4Q0OA 4IR4A 4UYHA 4BW1A 4UIWA 5AMFA 2RO1A 5JI8A 2L84A 4LYWA 3G0LA 3HMFA 4TU6A 4YYGA 4NR5A 4N4IA 5IIDA 2YW5A 5HQ5A 5CRMA 5II1A 4O7FA 5L97A 5EI4A 3MUKA 2I8NA 4MR4A 4TT4A 5EK9A 4YY4A 4C67A 5A85A 4A9LA 3P1CA 5LKUA 5D3LA 4KCXA 5I7XA 4YK0A 4UIVA 5HQ6A 4HBYA 2F6NA 4ZW1A 4NUEA 4Z1SA 5EISA 5FFYA 4J3IA 5DLZA 5HRXA 2YQDA 4IR5A 3O33A 5KU3A 5D3SA 4YYJA 4ALGA 3MB4A 2DWWA 5ENJA 3UVYA 5D0CA 4DONA 2R0SA 4YYMA
chains in the Genus database with same CATH superfamily
4ZQLA 5ETBA 3U5LA 5A5SA 3QZVA 4TT6A 4BW4A 3DAIA 5DBMA 4AKNA 2GRCA 4N4FA 5E7DA 5I86A 4O74A 5F36A 4KV4A 4O7BA 5HEMA 5KTWA 3U5OA 2R0YA 5FG6A 4N3WA 5IGLA 5LKTA 4YY6A 4UIXA 5HFRA 5E9MA 3VKGA 5EWWA 4TU4A 5HQ7A 5HM0A 2E3KA 5L99A 5E9IA 4TS8A 4KV1A 3QZTA 5TB6A 4WIVA 2G4AA 4XY9A 3U5MA 4O75A 4YYDA 3O34A 5D25A 4QC3A 5CUAA 3U5JA 4UYFA 4LZSA 4YYIA 4NQNA 4A9NA 4CLBA 4O78A 3FKMX 2D82A 4A9MA 4NXJA 4OGIA 5DFCA 3D7CA 5D7XA 5C85A 4CFLA 3LXJA 5IBNA 2I7KA 2LSPB 5IGNA 3GG3A 3P1EA 5CRZA 3AADA 5A5QA 4HXRA 4NQMA 4NR9A 5FBXA 3SVFA 4CUTA 4YYNA 5K29A 5EPBA 5DYAA 4PCEA 4O7EA 5KTXA 4PKLA 3SVHA 4PS5A 5E74A 5CS8A 5CZGA 5FH8A 5TCMA 5C89A 4Z6IA 5KTUA 5D3JA 5EWHA 4UITA 3IU6A 2KTBB 5ENIA 5LKZA 1WUGA 4TYLA 5DFBA 2F6JA 5BT5A 2L85A 5H1TA 3G0JA 4AKIA 5A82A 3LJWA 5D26A 3ZYUA 5FH7A 4IORA 4HXMA 5AD3A 5EICA 4MEQA 5CUGA 3P5OA 4TT2A 4CUSA 5D24A 2DATA 2OUOA 5LJ0A 2RNXA 3LQHA 4QSXA 4QSQA 5CTLA 5FG5A 5FB1A 3O35A 3O36A 4RVRA 5I88A 3MULA 5FH6A 2YEKA 5EGUA 4XY8A 3Q2FA 2D9EA 4O71A 5FB0A 5LJ2A 4LZ2A 4HXKA 4UYEA 5FE3A 4BW3A 4GPJA 1JSPB 5ENGA 5HLSA 5CQAA 4QSTA 4MEOA 5CQ5A 4QNSA 4LYSA 4HXNA 5EA1A 4MR3A 3UV4A 3JVJA 5IG6A 5BT4A 5CQ6A 4BW2A 5CU8A 5EU1A 5A5RA 5ENEA 4XYAA 4XUAA 5E9VA 5EVAA 5A5NA 3UW9A 3O37A 5A81A 5DFDA 5FE4A 5A83A 5DYXA 5EV9A 4QB3A 3S92A 4NRBA 5FDZA 5FE8A 5G4SA 3U5PA 3VKHA 4LRGA 5HRVA 3TLPA 5CFWA 5E73A 5CQ3A 5LVRA 5D3TA 1PUOA 2YYNA 2DVQA 3K2JA 4HXLA 5E9KA 4A9JA 5H85A 5BT3A 3P1DA 4QY4A 3JVKA 4UIUA 4YAXA 4QYDA 5ENCA 5DLXA 5E3GA 2EJNA 4NRCA 4QSRA 4A9EA 4IOQA 4Z1QA 4OGJA 4NR8A 5EWVA 5DX4A 4Q0NA 1EQFA 3D1BA 4OUFA 5C7NA 5IGKA 4PCIA 4UIYA 4CURA 5EP7A 4CUPA 4UIZA 2RS9B 2MJVB 5EPRA 5F63A 5CUDA 5F61A 4HBWA 4PTBA 3UVDA 4F3IA 4O72A 5EQ1A 4AKHA 5E3DA 4QYLA 4UYDA 1X0JA 5DYUA 5C87A 2RNWA 5I29A 4J0SA 4NYVA 4C66A 5C4QA 2R10A 5FE1A 2RNYA 4QSPA 3UVWA 4TZ2A 4NYWA 2E7NA 2L5EA 4NR6A 5AMEA 5HCLA 2E7OA 2H60A 5HELA 5DW1A 3P1FA 4QZSA 4BJXA 5FE0A 4UYGA 3D1DA 5DW2A 5F1HA 4QC1A 4QUUA 5FE2A 4Z6HA 5C8GA 3IU5A 4YADA 5E0RA 3MQMA 4IR6A 3UVXA 5HJCA 2RI7A 3ONIA 5FFWA 5F62A 5DY7A 2NXBA 4X2IA 5H1UA 2RFJA 3MB3A 2DVRA 5HRWA 5LVQA 5FE9A 1ZKRA 4LC2A 4UYFB 3S91A 4LZRA 4NUDA 4A9OA 4HBVA 2YELA 4QR5A 1ZS5A 4MR6A 1JM4B 3MXFA 3HMEA 4WHUA 5I1QA 4CL9A 4Y03A 4WHWA 4YATA 2DVVA 5DYCA 4TQNA 4YBMA 3SVGA 5EWCA 5II2A 5FE7A 5L8TA 4MR5A 5F3AA 4Z93A 3I3JA 1F68A 5I83A 5CQTA 4LDFA 5LUUA 2YDWA 4YBSA 5A7CA 5DKCA 4HXPA 4N4HA 3JVLA 4IOOA 5I80A 4YH4A 5L8UA 2OO1A 4O76A 2R0VA 4J0RA 3ERRA 3UV5A 4ZC9A 4YABA 3Q2EA 5F60A 4A9FA 5CUBA 5I40A 4LYIA 5CUCA 4ALHA 4QSSA 5L96A 3QZSA 4QSUA 2DKWA 5EPSA 5EWDA 2WP2A 4CUQA 5L98A 5I89A 5AD2A 5CP5A 4NR4A 1E6IA 4E96A 5F2PA 5EM3A 5JWMA 5HENA 3DWYA 3RCWA 5J0DA 4AI6A 4QEVA 2WP1A 5A5OA 4QR4A 4NS5A 4QEWA 5ETDA 5CQ4A 5ENFA 4TZ8A 2OSSA 2N9GA 3UV2A 4O70A 5CQ7A 5E9YA 5G4RA 4O7CA 5CY9A 4N4GA 2DVSA 5H1VA 5LJ1A 2YEMA 3LQIA 5FE6A 5F25A 5IGMA 4AKGA 4IR3A 5FFVA 5HFQA 1N72A 4YC9A 5ENHA 4CUUA 5F1LA 3HMHA 5I7YA 4HXOA 4NYXA 4QEUA 5D3NA 5FG4A 3AQAA 4YH3A 4QSVA 2FSAA 5ENBA 5CQ8A 5D3PA 4XUBA 5E9LA 4MENA 3JVMA 5CUEA 4HBXA 4QSWA 4O7AA 4NRAA 5DKHA 4A9IA 4NR7A 3NXBA 5LKXA 3U5KA 4J1PA 4TTEA 4O77A 4FLPA 4QUTA 3LQJA 4CFKA 4MEPA 5ACYA 5F5ZA 5CPEA 5D3HA 4BHWA 5DKDA 3U5NA 4YYHA 4YBTA 4HXSA 4A9KA 4YYKA 4A9HA 4QBMA 4LR6A 5D3RA 1WUMA 5KHMA 5FE5A 4NUCA 4PY6A 5A5PA 5KO4A 5CGPA 4QR3A 5COIA 4Q0OA 4IR4A 4UYHA 4BW1A 4UIWA 5AMFA 2RO1A 5JI8A 2L84A 4LYWA 3G0LA 3HMFA 4TU6A 4YYGA 4NR5A 4N4IA 5IIDA 2YW5A 5HQ5A 5CRMA 5II1A 4O7FA 5L97A 5EI4A 3MUKA 2I8NA 4MR4A 4TT4A 5EK9A 4YY4A 4C67A 5A85A 4A9LA 3P1CA 5LKUA 5D3LA 4KCXA 5I7XA 4YK0A 4UIVA 5HQ6A 4HBYA 2F6NA 4ZW1A 4NUEA 4Z1SA 5EISA 5FFYA 4J3IA 5DLZA 5HRXA 2YQDA 4IR5A 3O33A 5KU3A 5D3SA 4YYJA 4ALGA 3MB4A 2DWWA 5ENJA 3UVYA 5D0CA 4DONA 2R0SA 4YYMA
chains in the Genus database with same CATH topology
4ZQLA 5ETBA 3U5LA 5A5SA 3QZVA 4TT6A 4BW4A 3DAIA 5DBMA 4AKNA 2GRCA 4N4FA 5E7DA 5I86A 4O74A 5F36A 4KV4A 4O7BA 5HEMA 5KTWA 3U5OA 2R0YA 5FG6A 4N3WA 5IGLA 5LKTA 4YY6A 4UIXA 5HFRA 5E9MA 5EWWA 4TU4A 5HQ7A 5HM0A 2E3KA 5L99A 5E9IA 4TS8A 4KV1A 3QZTA 5TB6A 4WIVA 2G4AA 4XY9A 3U5MA 4O75A 4YYDA 3O34A 5D25A 4QC3A 5CUAA 3U5JA 4UYFA 4LZSA 4YYIA 4NQNA 4A9NA 4CLBA 4O78A 3FKMX 2D82A 4A9MA 4NXJA 4OGIA 5DFCA 3D7CA 5D7XA 5C85A 4CFLA 3LXJA 5IBNA 2I7KA 2LSPB 5IGNA 3GG3A 3P1EA 5CRZA 3AADA 5A5QA 4HXRA 4NQMA 4NR9A 5FBXA 3SVFA 4CUTA 4YYNA 5K29A 5EPBA 5DYAA 4PCEA 4O7EA 5KTXA 4PKLA 3SVHA 4PS5A 5E74A 5CS8A 5CZGA 5FH8A 5TCMA 5C89A 4Z6IA 5KTUA 5D3JA 5EWHA 4UITA 3IU6A 2KTBB 5ENIA 5LKZA 1WUGA 4TYLA 5DFBA 2F6JA 5BT5A 2L85A 5H1TA 3G0JA 5A82A 3LJWA 5D26A 3ZYUA 5FH7A 4IORA 4HXMA 5AD3A 5EICA 4MEQA 5CUGA 3P5OA 4TT2A 4CUSA 5D24A 2DATA 2OUOA 5LJ0A 2RNXA 3LQHA 4QSXA 4QSQA 5CTLA 5FG5A 5FB1A 3O35A 3O36A 4RVRA 5I88A 3MULA 5FH6A 2YEKA 5EGUA 4XY8A 3Q2FA 2D9EA 4O71A 5FB0A 5LJ2A 4LZ2A 4HXKA 4UYEA 5FE3A 4BW3A 4GPJA 1JSPB 5ENGA 5HLSA 5CQAA 4QSTA 4MEOA 5CQ5A 4QNSA 4LYSA 4HXNA 5EA1A 4MR3A 3UV4A 3JVJA 5IG6A 5BT4A 5CQ6A 4BW2A 5CU8A 5EU1A 5A5RA 5ENEA 4XYAA 4XUAA 5E9VA 5EVAA 5A5NA 3UW9A 3O37A 5A81A 5DFDA 5FE4A 5A83A 5DYXA 5EV9A 4QB3A 3S92A 4NRBA 5FDZA 5FE8A 5G4SA 3U5PA 4LRGA 5HRVA 3TLPA 5CFWA 5E73A 5CQ3A 5LVRA 5D3TA 2YYNA 2DVQA 3K2JA 4HXLA 5E9KA 4A9JA 5H85A 5BT3A 3P1DA 4QY4A 3JVKA 4UIUA 4YAXA 4QYDA 5ENCA 5DLXA 5E3GA 4NRCA 4QSRA 4A9EA 4IOQA 4Z1QA 4OGJA 4NR8A 5EWVA 5DX4A 4Q0NA 1EQFA 4OUFA 5C7NA 5IGKA 4PCIA 4UIYA 4CURA 5EP7A 4CUPA 4UIZA 2RS9B 2MJVB 5EPRA 5F63A 5CUDA 5F61A 4HBWA 4PTBA 3UVDA 4F3IA 4O72A 5EQ1A 5E3DA 4QYLA 4UYDA 1X0JA 5DYUA 5C87A 2RNWA 5I29A 4J0SA 4NYVA 4C66A 5C4QA 2R10A 5FE1A 2RNYA 4QSPA 3UVWA 4TZ2A 4NYWA 2E7NA 2L5EA 4NR6A 5AMEA 5HCLA 2E7OA 2H60A 5HELA 5DW1A 3P1FA 4QZSA 4BJXA 5FE0A 4UYGA 5DW2A 5F1HA 4QC1A 4QUUA 5FE2A 4Z6HA 5C8GA 3IU5A 4YADA 5E0RA 3MQMA 4IR6A 3UVXA 5HJCA 2RI7A 3ONIA 5FFWA 5F62A 5DY7A 2NXBA 4X2IA 5H1UA 2RFJA 3MB3A 2DVRA 5HRWA 5LVQA 5FE9A 4LC2A 4UYFB 3S91A 4LZRA 4NUDA 4A9OA 4HBVA 2YELA 4QR5A 1ZS5A 4MR6A 1JM4B 3MXFA 3HMEA 4WHUA 5I1QA 4CL9A 4Y03A 4WHWA 4YATA 2DVVA 5DYCA 4TQNA 4YBMA 3SVGA 5EWCA 5II2A 5FE7A 5L8TA 4MR5A 5F3AA 4Z93A 3I3JA 1F68A 5I83A 5CQTA 4LDFA 5LUUA 2YDWA 4YBSA 5A7CA 5DKCA 4HXPA 4N4HA 3JVLA 4IOOA 5I80A 4YH4A 5L8UA 2OO1A 4O76A 2R0VA 4J0RA 3UV5A 4ZC9A 4YABA 3Q2EA 5F60A 4A9FA 5CUBA 5I40A 4LYIA 5CUCA 4ALHA 4QSSA 5L96A 3QZSA 4QSUA 2DKWA 5EPSA 5EWDA 2WP2A 4CUQA 5L98A 5I89A 5AD2A 5CP5A 4NR4A 1E6IA 4E96A 5F2PA 5EM3A 5JWMA 5HENA 3DWYA 3RCWA 5J0DA 4QEVA 2WP1A 5A5OA 4QR4A 4NS5A 4QEWA 5ETDA 5CQ4A 5ENFA 4TZ8A 2OSSA 2N9GA 3UV2A 4O70A 5CQ7A 5E9YA 5G4RA 4O7CA 5CY9A 4N4GA 2DVSA 5H1VA 5LJ1A 2YEMA 3LQIA 5FE6A 5F25A 5IGMA 4IR3A 5FFVA 5HFQA 1N72A 4YC9A 5ENHA 4CUUA 5F1LA 3HMHA 5I7YA 4HXOA 4NYXA 4QEUA 5D3NA 5FG4A 3AQAA 4YH3A 4QSVA 2FSAA 5ENBA 5CQ8A 5D3PA 4XUBA 5E9LA 4MENA 3JVMA 5CUEA 4HBXA 4QSWA 4O7AA 4NRAA 5DKHA 4A9IA 4NR7A 3NXBA 5LKXA 3U5KA 4J1PA 4TTEA 4O77A 4FLPA 4QUTA 3LQJA 4CFKA 4MEPA 5ACYA 5F5ZA 5CPEA 5D3HA 4BHWA 5DKDA 3U5NA 4YYHA 4YBTA 4HXSA 4A9KA 4YYKA 4A9HA 4QBMA 4LR6A 5D3RA 1WUMA 5KHMA 5FE5A 4NUCA 4PY6A 5A5PA 5KO4A 5CGPA 4QR3A 5COIA 4Q0OA 4IR4A 4UYHA 4BW1A 4UIWA 5AMFA 2RO1A 5JI8A 2L84A 4LYWA 3G0LA 3HMFA 4TU6A 4YYGA 4NR5A 4N4IA 5IIDA 2YW5A 5HQ5A 5CRMA 5II1A 4O7FA 5L97A 5EI4A 3MUKA 2I8NA 4MR4A 4TT4A 5EK9A 4YY4A 4C67A 5A85A 4A9LA 3P1CA 5LKUA 5D3LA 4KCXA 5I7XA 4YK0A 4UIVA 5HQ6A 4HBYA 2F6NA 4ZW1A 4NUEA 4Z1SA 5EISA 5FFYA 4J3IA 5DLZA 5HRXA 2YQDA 4IR5A 3O33A 5KU3A 5D3SA 4YYJA 4ALGA 3MB4A 2DWWA 5ENJA 3UVYA 5D0CA 4DONA 2R0SA 4YYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZQL A;  5ETB A;  3U5L A;  5A5S A;  3QZV A;  4TT6 A;  4BW4 A;  3DAI A;  5DBM A;  4AKN A;  2GRC A;  4N4F A;  5E7D A;  5I86 A;  4O74 A;  5F36 A;  4KV4 A;  4O7B A;  5HEM A;  5KTW A;  3U5O A;  2R0Y A;  5FG6 A;  4N3W A;  5IGL A;  5LKT A;  4YY6 A;  4UIX A;  5HFR A;  5E9M A;  5EWW A;  4TU4 A;  5HQ7 A;  5HM0 A;  2E3K A;  5L99 A;  5E9I A;  4TS8 A;  4KV1 A;  3QZT A;  5TB6 A;  4WIV A;  2G4A A;  4XY9 A;  3U5M A;  4O75 A;  4YYD A;  3O34 A;  5D25 A;  4QC3 A;  5CUA A;  3U5J A;  4UYF A;  4LZS A;  4YYI A;  4NQN A;  4A9N A;  4CLB A;  4O78 A;  3FKM X;  2D82 A;  4A9M A;  4NXJ A;  4OGI A;  5DFC A;  3D7C A;  5D7X A;  5C85 A;  4CFL A;  3LXJ A;  5IBN A;  2I7K A;  2LSP B;  5IGN A;  3GG3 A;  3P1E A;  5CRZ A;  3AAD A;  5A5Q A;  4HXR A;  4NQM A;  4NR9 A;  5FBX A;  3SVF A;  4CUT A;  4YYN A;  5K29 A;  5EPB A;  5DYA A;  4PCE A;  4O7E A;  5KTX A;  4PKL A;  3SVH A;  4PS5 A;  5E74 A;  5CS8 A;  5CZG A;  5FH8 A;  5TCM A;  5C89 A;  4Z6I A;  5KTU A;  5D3J A;  5EWH A;  4UIT A;  3IU6 A;  2KTB B;  5ENI A;  5LKZ A;  1WUG A;  4TYL A;  5DFB A;  2F6J A;  5BT5 A;  2L85 A;  5H1T A;  3G0J A;  5A82 A;  3LJW A;  5D26 A;  3ZYU A;  5FH7 A;  4IOR A;  4HXM A;  5AD3 A;  5EIC A;  4MEQ A;  5CUG A;  3P5O A;  4TT2 A;  4CUS A;  5D24 A;  2DAT A;  2OUO A;  5LJ0 A;  2RNX A;  3LQH A;  4QSX A;  4QSQ A;  5CTL A;  5FG5 A;  5FB1 A;  3O35 A;  3O36 A;  4RVR A;  5I88 A;  3MUL A;  5FH6 A;  2YEK A;  5EGU A;  4XY8 A;  3Q2F A;  2D9E A;  4O71 A;  5FB0 A;  5LJ2 A;  4LZ2 A;  4HXK A;  4UYE A;  5FE3 A;  4BW3 A;  4GPJ A;  1JSP B;  5ENG A;  5HLS A;  5CQA A;  4QST A;  4MEO A;  5CQ5 A;  4QNS A;  4LYS A;  4HXN A;  5EA1 A;  4MR3 A;  3UV4 A;  3JVJ A;  5IG6 A;  5BT4 A;  5CQ6 A;  4BW2 A;  5CU8 A;  5EU1 A;  5A5R A;  5ENE A;  4XYA A;  4XUA A;  5E9V A;  5EVA A;  5A5N A;  3UW9 A;  3O37 A;  5A81 A;  5DFD A;  5FE4 A;  5A83 A;  5DYX A;  5EV9 A;  4QB3 A;  3S92 A;  4NRB A;  5FDZ A;  5FE8 A;  5G4S A;  3U5P A;  4LRG A;  5HRV A;  3TLP A;  5CFW A;  5E73 A;  5CQ3 A;  5LVR A;  5D3T A;  2YYN A;  2DVQ A;  3K2J A;  4HXL A;  5E9K A;  4A9J A;  5H85 A;  5BT3 A;  3P1D A;  4QY4 A;  3JVK A;  4UIU A;  4YAX A;  4QYD A;  5ENC A;  5DLX A;  5E3G A;  4NRC A;  4QSR A;  4A9E A;  4IOQ A;  4Z1Q A;  4OGJ A;  4NR8 A;  5EWV A;  5DX4 A;  4Q0N A;  1EQF A;  4OUF A;  5C7N A;  5IGK A;  4PCI A;  4UIY A;  4CUR A;  5EP7 A;  4CUP A;  4UIZ A;  2RS9 B;  2MJV B;  5EPR A;  5F63 A;  5CUD A;  5F61 A;  4HBW A;  4PTB A;  3UVD A;  4F3I A;  4O72 A;  5EQ1 A;  5E3D A;  4QYL A;  4UYD A;  1X0J A;  5DYU A;  5C87 A;  2RNW A;  5I29 A;  4J0S A;  4NYV A;  4C66 A;  5C4Q A;  2R10 A;  5FE1 A;  2RNY A;  4QSP A;  3UVW A;  4TZ2 A;  4NYW A;  2E7N A;  2L5E A;  4NR6 A;  5AME A;  5HCL A;  2E7O A;  2H60 A;  5HEL A;  5DW1 A;  3P1F A;  4QZS A;  4BJX A;  5FE0 A;  4UYG A;  5DW2 A;  5F1H A;  4QC1 A;  4QUU A;  5FE2 A;  4Z6H A;  5C8G A;  3IU5 A;  4YAD A;  5E0R A;  3MQM A;  4IR6 A;  3UVX A;  5HJC A;  2RI7 A;  3ONI A;  5FFW A;  5F62 A;  5DY7 A;  2NXB A;  4X2I A;  5H1U A;  2RFJ A;  3MB3 A;  2DVR A;  5HRW A;  5LVQ A;  5FE9 A;  4LC2 A;  4UYF B;  3S91 A;  4LZR A;  4NUD A;  4A9O A;  4HBV A;  2YEL A;  4QR5 A;  1ZS5 A;  4MR6 A;  1JM4 B;  3MXF A;  3HME A;  4WHU A;  5I1Q A;  4CL9 A;  4Y03 A;  4WHW A;  4YAT A;  2DVV A;  5DYC A;  4TQN A;  4YBM A;  3SVG A;  5EWC A;  5II2 A;  5FE7 A;  5L8T A;  4MR5 A;  5F3A A;  4Z93 A;  3I3J A;  1F68 A;  5I83 A;  5CQT A;  4LDF A;  5LUU A;  2YDW A;  4YBS A;  5A7C A;  5DKC A;  4HXP A;  4N4H A;  3JVL A;  4IOO A;  5I80 A;  4YH4 A;  5L8U A;  2OO1 A;  4O76 A;  2R0V A;  4J0R A;  3UV5 A;  4ZC9 A;  4YAB A;  3Q2E A;  5F60 A;  4A9F A;  5CUB A;  5I40 A;  4LYI A;  5CUC A;  4ALH A;  4QSS A;  5L96 A;  3QZS A;  4QSU A;  2DKW A;  5EPS A;  5EWD A;  2WP2 A;  4CUQ A;  5L98 A;  5I89 A;  5AD2 A;  5CP5 A;  4NR4 A;  1E6I A;  4E96 A;  5F2P A;  5EM3 A;  5JWM A;  5HEN A;  3DWY A;  3RCW A;  5J0D A;  4QEV A;  2WP1 A;  5A5O A;  4QR4 A;  4NS5 A;  4QEW A;  5ETD A;  5CQ4 A;  5ENF A;  4TZ8 A;  2OSS A;  2N9G A;  3UV2 A;  4O70 A;  5CQ7 A;  5E9Y A;  5G4R A;  4O7C A;  5CY9 A;  4N4G A;  2DVS A;  5H1V A;  5LJ1 A;  2YEM A;  3LQI A;  5FE6 A;  5F25 A;  5IGM A;  4IR3 A;  5FFV A;  5HFQ A;  1N72 A;  4YC9 A;  5ENH A;  4CUU A;  5F1L A;  3HMH A;  5I7Y A;  4HXO A;  4NYX A;  4QEU A;  5D3N A;  5FG4 A;  3AQA A;  4YH3 A;  4QSV A;  2FSA A;  5ENB A;  5CQ8 A;  5D3P A;  4XUB A;  5E9L A;  4MEN A;  3JVM A;  5CUE A;  4HBX A;  4QSW A;  4O7A A;  4NRA A;  5DKH A;  4A9I A;  4NR7 A;  3NXB A;  5LKX A;  3U5K A;  4J1P A;  4TTE A;  4O77 A;  4FLP A;  4QUT A;  3LQJ A;  4CFK A;  4MEP A;  5ACY A;  5F5Z A;  5CPE A;  5D3H A;  4BHW A;  5DKD A;  3U5N A;  4YYH A;  4YBT A;  4HXS A;  4A9K A;  4YYK A;  4A9H A;  4QBM A;  4LR6 A;  5D3R A;  1WUM A;  5KHM A;  5FE5 A;  4NUC A;  4PY6 A;  5A5P A;  5KO4 A;  5CGP A;  4QR3 A;  5COI A;  4Q0O A;  4IR4 A;  4UYH A;  4BW1 A;  4UIW A;  5AMF A;  2RO1 A;  5JI8 A;  2L84 A;  4LYW A;  3G0L A;  3HMF A;  4TU6 A;  4YYG A;  4NR5 A;  4N4I A;  5IID A;  2YW5 A;  5HQ5 A;  5CRM A;  5II1 A;  4O7F A;  5L97 A;  5EI4 A;  3MUK A;  2I8N A;  4MR4 A;  4TT4 A;  5EK9 A;  4YY4 A;  4C67 A;  5A85 A;  4A9L A;  3P1C A;  5LKU A;  5D3L A;  4KCX A;  5I7X A;  4YK0 A;  4UIV A;  5HQ6 A;  4HBY A;  2F6N A;  4ZW1 A;  4NUE A;  4Z1S A;  5EIS A;  5FFY A;  4J3I A;  5DLZ A;  5HRX A;  2YQD A;  4IR5 A;  3O33 A;  5KU3 A;  5D3S A;  4YYJ A;  4ALG A;  3MB4 A;  2DWW A;  5ENJ A;  3UVY A;  5D0C A;  4DON A;  2R0S A;  4YYM A; 
#chains in the Genus database with same CATH topology
 4ZQL A;  5ETB A;  3U5L A;  5A5S A;  3QZV A;  4TT6 A;  4BW4 A;  3DAI A;  5DBM A;  4AKN A;  2GRC A;  4N4F A;  5E7D A;  5I86 A;  4O74 A;  5F36 A;  4KV4 A;  4O7B A;  5HEM A;  5KTW A;  3U5O A;  2R0Y A;  5FG6 A;  4N3W A;  5IGL A;  5LKT A;  4YY6 A;  4UIX A;  5HFR A;  5E9M A;  3VKG A;  5EWW A;  4TU4 A;  5HQ7 A;  5HM0 A;  2E3K A;  5L99 A;  5E9I A;  4TS8 A;  4KV1 A;  3QZT A;  5TB6 A;  4WIV A;  2G4A A;  4XY9 A;  3U5M A;  4O75 A;  4YYD A;  3O34 A;  5D25 A;  4QC3 A;  5CUA A;  3U5J A;  4UYF A;  4LZS A;  4YYI A;  4NQN A;  4A9N A;  4CLB A;  4O78 A;  3FKM X;  2D82 A;  4A9M A;  4NXJ A;  4OGI A;  5DFC A;  3D7C A;  5D7X A;  5C85 A;  4CFL A;  3LXJ A;  5IBN A;  2I7K A;  2LSP B;  5IGN A;  3GG3 A;  3P1E A;  5CRZ A;  3AAD A;  5A5Q A;  4HXR A;  4NQM A;  4NR9 A;  5FBX A;  3SVF A;  4CUT A;  4YYN A;  5K29 A;  5EPB A;  5DYA A;  4PCE A;  4O7E A;  5KTX A;  4PKL A;  3SVH A;  4PS5 A;  5E74 A;  5CS8 A;  5CZG A;  5FH8 A;  5TCM A;  5C89 A;  4Z6I A;  5KTU A;  5D3J A;  5EWH A;  4UIT A;  3IU6 A;  2KTB B;  5ENI A;  5LKZ A;  1WUG A;  4TYL A;  5DFB A;  2F6J A;  5BT5 A;  2L85 A;  5H1T A;  3G0J A;  4AKI A;  5A82 A;  3LJW A;  5D26 A;  3ZYU A;  5FH7 A;  4IOR A;  4HXM A;  5AD3 A;  5EIC A;  4MEQ A;  5CUG A;  3P5O A;  4TT2 A;  4CUS A;  5D24 A;  2DAT A;  2OUO A;  5LJ0 A;  2RNX A;  3LQH A;  4QSX A;  4QSQ A;  5CTL A;  5FG5 A;  5FB1 A;  3O35 A;  3O36 A;  4RVR A;  5I88 A;  3MUL A;  5FH6 A;  2YEK A;  5EGU A;  4XY8 A;  3Q2F A;  2D9E A;  4O71 A;  5FB0 A;  5LJ2 A;  4LZ2 A;  4HXK A;  4UYE A;  5FE3 A;  4BW3 A;  4GPJ A;  1JSP B;  5ENG A;  5HLS A;  5CQA A;  4QST A;  4MEO A;  5CQ5 A;  4QNS A;  4LYS A;  4HXN A;  5EA1 A;  4MR3 A;  3UV4 A;  3JVJ A;  5IG6 A;  5BT4 A;  5CQ6 A;  4BW2 A;  5CU8 A;  5EU1 A;  5A5R A;  5ENE A;  4XYA A;  4XUA A;  5E9V A;  5EVA A;  5A5N A;  3UW9 A;  3O37 A;  5A81 A;  5DFD A;  5FE4 A;  5A83 A;  5DYX A;  5EV9 A;  4QB3 A;  3S92 A;  4NRB A;  5FDZ A;  5FE8 A;  5G4S A;  3U5P A;  3VKH A;  4LRG A;  5HRV A;  3TLP A;  5CFW A;  5E73 A;  5CQ3 A;  5LVR A;  5D3T A;  1PUO A;  2YYN A;  2DVQ A;  3K2J A;  4HXL A;  5E9K A;  4A9J A;  5H85 A;  5BT3 A;  3P1D A;  4QY4 A;  3JVK A;  4UIU A;  4YAX A;  4QYD A;  5ENC A;  5DLX A;  5E3G A;  2EJN A;  4NRC A;  4QSR A;  4A9E A;  4IOQ A;  4Z1Q A;  4OGJ A;  4NR8 A;  5EWV A;  5DX4 A;  4Q0N A;  1EQF A;  3D1B A;  4OUF A;  5C7N A;  5IGK A;  4PCI A;  4UIY A;  4CUR A;  5EP7 A;  4CUP A;  4UIZ A;  2RS9 B;  2MJV B;  5EPR A;  5F63 A;  5CUD A;  5F61 A;  4HBW A;  4PTB A;  3UVD A;  4F3I A;  4O72 A;  5EQ1 A;  4AKH A;  5E3D A;  4QYL A;  4UYD A;  1X0J A;  5DYU A;  5C87 A;  2RNW A;  5I29 A;  4J0S A;  4NYV A;  4C66 A;  5C4Q A;  2R10 A;  5FE1 A;  2RNY A;  4QSP A;  3UVW A;  4TZ2 A;  4NYW A;  2E7N A;  2L5E A;  4NR6 A;  5AME A;  5HCL A;  2E7O A;  2H60 A;  5HEL A;  5DW1 A;  3P1F A;  4QZS A;  4BJX A;  5FE0 A;  4UYG A;  3D1D A;  5DW2 A;  5F1H A;  4QC1 A;  4QUU A;  5FE2 A;  4Z6H A;  5C8G A;  3IU5 A;  4YAD A;  5E0R A;  3MQM A;  4IR6 A;  3UVX A;  5HJC A;  2RI7 A;  3ONI A;  5FFW A;  5F62 A;  5DY7 A;  2NXB A;  4X2I A;  5H1U A;  2RFJ A;  3MB3 A;  2DVR A;  5HRW A;  5LVQ A;  5FE9 A;  1ZKR A;  4LC2 A;  4UYF B;  3S91 A;  4LZR A;  4NUD A;  4A9O A;  4HBV A;  2YEL A;  4QR5 A;  1ZS5 A;  4MR6 A;  1JM4 B;  3MXF A;  3HME A;  4WHU A;  5I1Q A;  4CL9 A;  4Y03 A;  4WHW A;  4YAT A;  2DVV A;  5DYC A;  4TQN A;  4YBM A;  3SVG A;  5EWC A;  5II2 A;  5FE7 A;  5L8T A;  4MR5 A;  5F3A A;  4Z93 A;  3I3J A;  1F68 A;  5I83 A;  5CQT A;  4LDF A;  5LUU A;  2YDW A;  4YBS A;  5A7C A;  5DKC A;  4HXP A;  4N4H A;  3JVL A;  4IOO A;  5I80 A;  4YH4 A;  5L8U A;  2OO1 A;  4O76 A;  2R0V A;  4J0R A;  3ERR A;  3UV5 A;  4ZC9 A;  4YAB A;  3Q2E A;  5F60 A;  4A9F A;  5CUB A;  5I40 A;  4LYI A;  5CUC A;  4ALH A;  4QSS A;  5L96 A;  3QZS A;  4QSU A;  2DKW A;  5EPS A;  5EWD A;  2WP2 A;  4CUQ A;  5L98 A;  5I89 A;  5AD2 A;  5CP5 A;  4NR4 A;  1E6I A;  4E96 A;  5F2P A;  5EM3 A;  5JWM A;  5HEN A;  3DWY A;  3RCW A;  5J0D A;  4AI6 A;  4QEV A;  2WP1 A;  5A5O A;  4QR4 A;  4NS5 A;  4QEW A;  5ETD A;  5CQ4 A;  5ENF A;  4TZ8 A;  2OSS A;  2N9G A;  3UV2 A;  4O70 A;  5CQ7 A;  5E9Y A;  5G4R A;  4O7C A;  5CY9 A;  4N4G A;  2DVS A;  5H1V A;  5LJ1 A;  2YEM A;  3LQI A;  5FE6 A;  5F25 A;  5IGM A;  4AKG A;  4IR3 A;  5FFV A;  5HFQ A;  1N72 A;  4YC9 A;  5ENH A;  4CUU A;  5F1L A;  3HMH A;  5I7Y A;  4HXO A;  4NYX A;  4QEU A;  5D3N A;  5FG4 A;  3AQA A;  4YH3 A;  4QSV A;  2FSA A;  5ENB A;  5CQ8 A;  5D3P A;  4XUB A;  5E9L A;  4MEN A;  3JVM A;  5CUE A;  4HBX A;  4QSW A;  4O7A A;  4NRA A;  5DKH A;  4A9I A;  4NR7 A;  3NXB A;  5LKX A;  3U5K A;  4J1P A;  4TTE A;  4O77 A;  4FLP A;  4QUT A;  3LQJ A;  4CFK A;  4MEP A;  5ACY A;  5F5Z A;  5CPE A;  5D3H A;  4BHW A;  5DKD A;  3U5N A;  4YYH A;  4YBT A;  4HXS A;  4A9K A;  4YYK A;  4A9H A;  4QBM A;  4LR6 A;  5D3R A;  1WUM A;  5KHM A;  5FE5 A;  4NUC A;  4PY6 A;  5A5P A;  5KO4 A;  5CGP A;  4QR3 A;  5COI A;  4Q0O A;  4IR4 A;  4UYH A;  4BW1 A;  4UIW A;  5AMF A;  2RO1 A;  5JI8 A;  2L84 A;  4LYW A;  3G0L A;  3HMF A;  4TU6 A;  4YYG A;  4NR5 A;  4N4I A;  5IID A;  2YW5 A;  5HQ5 A;  5CRM A;  5II1 A;  4O7F A;  5L97 A;  5EI4 A;  3MUK A;  2I8N A;  4MR4 A;  4TT4 A;  5EK9 A;  4YY4 A;  4C67 A;  5A85 A;  4A9L A;  3P1C A;  5LKU A;  5D3L A;  4KCX A;  5I7X A;  4YK0 A;  4UIV A;  5HQ6 A;  4HBY A;  2F6N A;  4ZW1 A;  4NUE A;  4Z1S A;  5EIS A;  5FFY A;  4J3I A;  5DLZ A;  5HRX A;  2YQD A;  4IR5 A;  3O33 A;  5KU3 A;  5D3S A;  4YYJ A;  4ALG A;  3MB4 A;  2DWW A;  5ENJ A;  3UVY A;  5D0C A;  4DON A;  2R0S A;  4YYM A; 
#chains in the Genus database with same CATH homology
 4ZQL A;  5ETB A;  3U5L A;  5A5S A;  3QZV A;  4TT6 A;  4BW4 A;  3DAI A;  5DBM A;  4AKN A;  2GRC A;  4N4F A;  5E7D A;  5I86 A;  4O74 A;  5F36 A;  4KV4 A;  4O7B A;  5HEM A;  5KTW A;  3U5O A;  2R0Y A;  5FG6 A;  4N3W A;  5IGL A;  5LKT A;  4YY6 A;  4UIX A;  5HFR A;  5E9M A;  5EWW A;  4TU4 A;  5HQ7 A;  5HM0 A;  2E3K A;  5L99 A;  5E9I A;  4TS8 A;  4KV1 A;  3QZT A;  5TB6 A;  4WIV A;  2G4A A;  4XY9 A;  3U5M A;  4O75 A;  4YYD A;  3O34 A;  5D25 A;  4QC3 A;  5CUA A;  3U5J A;  4UYF A;  4LZS A;  4YYI A;  4NQN A;  4A9N A;  4CLB A;  4O78 A;  3FKM X;  2D82 A;  4A9M A;  4NXJ A;  4OGI A;  5DFC A;  3D7C A;  5D7X A;  5C85 A;  4CFL A;  3LXJ A;  5IBN A;  2I7K A;  2LSP B;  5IGN A;  3GG3 A;  3P1E A;  5CRZ A;  3AAD A;  5A5Q A;  4HXR A;  4NQM A;  4NR9 A;  5FBX A;  3SVF A;  4CUT A;  4YYN A;  5K29 A;  5EPB A;  5DYA A;  4PCE A;  4O7E A;  5KTX A;  4PKL A;  3SVH A;  4PS5 A;  5E74 A;  5CS8 A;  5CZG A;  5FH8 A;  5TCM A;  5C89 A;  4Z6I A;  5KTU A;  5D3J A;  5EWH A;  4UIT A;  3IU6 A;  2KTB B;  5ENI A;  5LKZ A;  1WUG A;  4TYL A;  5DFB A;  2F6J A;  5BT5 A;  2L85 A;  5H1T A;  3G0J A;  5A82 A;  3LJW A;  5D26 A;  3ZYU A;  5FH7 A;  4IOR A;  4HXM A;  5AD3 A;  5EIC A;  4MEQ A;  5CUG A;  3P5O A;  4TT2 A;  4CUS A;  5D24 A;  2DAT A;  2OUO A;  5LJ0 A;  2RNX A;  3LQH A;  4QSX A;  4QSQ A;  5CTL A;  5FG5 A;  5FB1 A;  3O35 A;  3O36 A;  4RVR A;  5I88 A;  3MUL A;  5FH6 A;  2YEK A;  5EGU A;  4XY8 A;  3Q2F A;  2D9E A;  4O71 A;  5FB0 A;  5LJ2 A;  4LZ2 A;  4HXK A;  4UYE A;  5FE3 A;  4BW3 A;  4GPJ A;  1JSP B;  5ENG A;  5HLS A;  5CQA A;  4QST A;  4MEO A;  5CQ5 A;  4QNS A;  4LYS A;  4HXN A;  5EA1 A;  4MR3 A;  3UV4 A;  3JVJ A;  5IG6 A;  5BT4 A;  5CQ6 A;  4BW2 A;  5CU8 A;  5EU1 A;  5A5R A;  5ENE A;  4XYA A;  4XUA A;  5E9V A;  5EVA A;  5A5N A;  3UW9 A;  3O37 A;  5A81 A;  5DFD A;  5FE4 A;  5A83 A;  5DYX A;  5EV9 A;  4QB3 A;  3S92 A;  4NRB A;  5FDZ A;  5FE8 A;  5G4S A;  3U5P A;  4LRG A;  5HRV A;  3TLP A;  5CFW A;  5E73 A;  5CQ3 A;  5LVR A;  5D3T A;  2YYN A;  2DVQ A;  3K2J A;  4HXL A;  5E9K A;  4A9J A;  5H85 A;  5BT3 A;  3P1D A;  4QY4 A;  3JVK A;  4UIU A;  4YAX A;  4QYD A;  5ENC A;  5DLX A;  5E3G A;  4NRC A;  4QSR A;  4A9E A;  4IOQ A;  4Z1Q A;  4OGJ A;  4NR8 A;  5EWV A;  5DX4 A;  4Q0N A;  1EQF A;  4OUF A;  5C7N A;  5IGK A;  4PCI A;  4UIY A;  4CUR A;  5EP7 A;  4CUP A;  4UIZ A;  2RS9 B;  2MJV B;  5EPR A;  5F63 A;  5CUD A;  5F61 A;  4HBW A;  4PTB A;  3UVD A;  4F3I A;  4O72 A;  5EQ1 A;  5E3D A;  4QYL A;  4UYD A;  1X0J A;  5DYU A;  5C87 A;  2RNW A;  5I29 A;  4J0S A;  4NYV A;  4C66 A;  5C4Q A;  2R10 A;  5FE1 A;  2RNY A;  4QSP A;  3UVW A;  4TZ2 A;  4NYW A;  2E7N A;  2L5E A;  4NR6 A;  5AME A;  5HCL A;  2E7O A;  2H60 A;  5HEL A;  5DW1 A;  3P1F A;  4QZS A;  4BJX A;  5FE0 A;  4UYG A;  5DW2 A;  5F1H A;  4QC1 A;  4QUU A;  5FE2 A;  4Z6H A;  5C8G A;  3IU5 A;  4YAD A;  5E0R A;  3MQM A;  4IR6 A;  3UVX A;  5HJC A;  2RI7 A;  3ONI A;  5FFW A;  5F62 A;  5DY7 A;  2NXB A;  4X2I A;  5H1U A;  2RFJ A;  3MB3 A;  2DVR A;  5HRW A;  5LVQ A;  5FE9 A;  4LC2 A;  4UYF B;  3S91 A;  4LZR A;  4NUD A;  4A9O A;  4HBV A;  2YEL A;  4QR5 A;  1ZS5 A;  4MR6 A;  1JM4 B;  3MXF A;  3HME A;  4WHU A;  5I1Q A;  4CL9 A;  4Y03 A;  4WHW A;  4YAT A;  2DVV A;  5DYC A;  4TQN A;  4YBM A;  3SVG A;  5EWC A;  5II2 A;  5FE7 A;  5L8T A;  4MR5 A;  5F3A A;  4Z93 A;  3I3J A;  1F68 A;  5I83 A;  5CQT A;  4LDF A;  5LUU A;  2YDW A;  4YBS A;  5A7C A;  5DKC A;  4HXP A;  4N4H A;  3JVL A;  4IOO A;  5I80 A;  4YH4 A;  5L8U A;  2OO1 A;  4O76 A;  2R0V A;  4J0R A;  3UV5 A;  4ZC9 A;  4YAB A;  3Q2E A;  5F60 A;  4A9F A;  5CUB A;  5I40 A;  4LYI A;  5CUC A;  4ALH A;  4QSS A;  5L96 A;  3QZS A;  4QSU A;  2DKW A;  5EPS A;  5EWD A;  2WP2 A;  4CUQ A;  5L98 A;  5I89 A;  5AD2 A;  5CP5 A;  4NR4 A;  1E6I A;  4E96 A;  5F2P A;  5EM3 A;  5JWM A;  5HEN A;  3DWY A;  3RCW A;  5J0D A;  4QEV A;  2WP1 A;  5A5O A;  4QR4 A;  4NS5 A;  4QEW A;  5ETD A;  5CQ4 A;  5ENF A;  4TZ8 A;  2OSS A;  2N9G A;  3UV2 A;  4O70 A;  5CQ7 A;  5E9Y A;  5G4R A;  4O7C A;  5CY9 A;  4N4G A;  2DVS A;  5H1V A;  5LJ1 A;  2YEM A;  3LQI A;  5FE6 A;  5F25 A;  5IGM A;  4IR3 A;  5FFV A;  5HFQ A;  1N72 A;  4YC9 A;  5ENH A;  4CUU A;  5F1L A;  3HMH A;  5I7Y A;  4HXO A;  4NYX A;  4QEU A;  5D3N A;  5FG4 A;  3AQA A;  4YH3 A;  4QSV A;  2FSA A;  5ENB A;  5CQ8 A;  5D3P A;  4XUB A;  5E9L A;  4MEN A;  3JVM A;  5CUE A;  4HBX A;  4QSW A;  4O7A A;  4NRA A;  5DKH A;  4A9I A;  4NR7 A;  3NXB A;  5LKX A;  3U5K A;  4J1P A;  4TTE A;  4O77 A;  4FLP A;  4QUT A;  3LQJ A;  4CFK A;  4MEP A;  5ACY A;  5F5Z A;  5CPE A;  5D3H A;  4BHW A;  5DKD A;  3U5N A;  4YYH A;  4YBT A;  4HXS A;  4A9K A;  4YYK A;  4A9H A;  4QBM A;  4LR6 A;  5D3R A;  1WUM A;  5KHM A;  5FE5 A;  4NUC A;  4PY6 A;  5A5P A;  5KO4 A;  5CGP A;  4QR3 A;  5COI A;  4Q0O A;  4IR4 A;  4UYH A;  4BW1 A;  4UIW A;  5AMF A;  2RO1 A;  5JI8 A;  2L84 A;  4LYW A;  3G0L A;  3HMF A;  4TU6 A;  4YYG A;  4NR5 A;  4N4I A;  5IID A;  2YW5 A;  5HQ5 A;  5CRM A;  5II1 A;  4O7F A;  5L97 A;  5EI4 A;  3MUK A;  2I8N A;  4MR4 A;  4TT4 A;  5EK9 A;  4YY4 A;  4C67 A;  5A85 A;  4A9L A;  3P1C A;  5LKU A;  5D3L A;  4KCX A;  5I7X A;  4YK0 A;  4UIV A;  5HQ6 A;  4HBY A;  2F6N A;  4ZW1 A;  4NUE A;  4Z1S A;  5EIS A;  5FFY A;  4J3I A;  5DLZ A;  5HRX A;  2YQD A;  4IR5 A;  3O33 A;  5KU3 A;  5D3S A;  4YYJ A;  4ALG A;  3MB4 A;  2DWW A;  5ENJ A;  3UVY A;  5D0C A;  4DON A;  2R0S A;  4YYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...