2RS9B

Solution structure of the bromodomain of human brpf1 in complex with histone h4k5ac peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
121
structure length
121
Chain Sequence
GSSGSSGFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylated lysine 5 of peptide from Histone H4
publication title Site-specific histone recognition by the bromodomain of Brpf1 and the role in MOZ/MORF histone acetyltransferase complexes
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 36
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2rs9B00
5A85A 4HXRA 5F63A 3UVYA 5FH6A 4O72A 4PCIA 5EWCA 3DWYA 3Q2FA 3SVGA 4YBSA 5HELA 2DKWA 4LYIA 5A5NA 4A9FA 3SVHA 5CQAA 5E74A 2F6JA 5CUGA 3HMEA 4QY4A 4YADA 4TYLA 4CUTA 2E3KA 3MULA 5C4QA 4NR5A 5BT5A 5CFWA 4TT2A 2YYNA 5C87A 3JVMA 5ENJA 2L85A 4QC1A 3UV5A 5EISA 5F36A 3SVFA 5J0DA 4QR4A 5LKXA 5EICA 5A83A 5F3AA 3U5LA 4HBVA 4BHWA 3K2JA 4CFKA 4ALGA 5F25A 2RNWA 4CURA 4PTBA 3MUKA 5CQ3A 5E0RA 3GG3A 5IGKA 5LUUA 5I29A 2NXBA 2YEKA 5DKDA 5A5PA 5BT4A 4A9OA 5FB0A 3NXBA 4MR5A 4BJXA 5L97A 4YK0A 5TB6A 5LJ2A 5KTWA 3O37A 4DONA 5D0CA 3MXFA 5HFQA 4QSSA 5LVQA 5HEMA 5CY9A 5FG6A 5EP7A 5BT3A 4UYFA 4QSUA 5FE2A 2YEMA 4QNSA 4QB3A 5F2PA 2OUOA 2DWWA 5JI8A 2L5EA 4QSWA 4A9LA 5I89A 4CUSA 5FBXA 4UYDA 5DBMA 5CQTA 2E7NA 3P1EA 4TT4A 4UYHA 5DLXA 4PS5A 5CUBA 5E73A 4O7FA 5EI4A 2WP2A 5EWHA 5FFVA 5FE5A 4Z93A 5E7DA 5IGMA 4QEUA 2G4AA 5H1UA 3O33A 2MJVB 3LQIA 5EPBA 3MQMA 5LJ0A 5DLZA 5E9LA 3I3JA 4Y03A 4NUDA 5EK9A 4MR6A 3UW9A 5DW1A 5ENHA 3U5KA 5FE7A 5FE8A 3U5PA 4TU4A 4O76A 3S92A 4YY4A 5CQ7A 4YBTA 5ENEA 4XYAA 4NUEA 5C7NA 5CUAA 4TS8A 4MR3A 5D25A 2RS9B 5DYXA 4BW3A 5DW2A 3MB4A 5CGPA 5L8TA 4LZ2A 5EWVA 3U5OA 5G4SA 4IORA 4UYEA 5TCMA 4BW1A 4QZSA 5FE6A 5LKUA 4HXKA 5II1A 5I88A 5L96A 5HQ5A 2I8NA 5L99A 5FH7A 4O78A 3U5MA 4IOQA 5FG4A 3U5JA 4Z6IA 3ONIA 5E9KA 2YQDA 3AQAA 3IU6A 4TTEA 4WIVA 5CUEA 5KTUA 4UYGA 4YYIA 4LRGA 5ENGA 5DYCA 5LJ1A 4YYNA 5K29A 4RVRA 4AKNA 4A9KA 5II2A 2R0VA 5I83A 4XY8A 5FG5A 4O71A 5C85A 4LYSA 2DVVA 2RI7A 5I7YA 4NYXA 5HENA 2RNXA 5A5RA 4MEOA 4XY9A 3ZYUA 5D3TA 2DATA 4N3WA 2E7OA 4IOOA 5KHMA 4FLPA 3QZTA 4CUQA 3IU5A 3DAIA 5F60A 5E9MA 4QEVA 3HMFA 5E9YA 5EGUA 2RO1A 4HBXA 4KV1A 4OUFA 4CUUA 1WUGA 5FFWA 5D3PA 4YYHA 2LSPB 4Z1SA 3S91A 4CUPA 5L8UA 4HBWA 4KV4A 5CRZA 4NRBA 4QBMA 5HM0A 5IGLA 5I80A 4TU6A 5COIA 4J1PA 5HQ6A 5ETDA 2I7KA 2R0SA 4OGJA 5EPSA 5HRXA 4QSXA 4QR3A 4QYLA 3UV4A 4QR5A 4UIWA 4HXNA 4NR7A 5IIDA 2H60A 3QZVA 4UYFB 4UIVA 5FDZA 3UVXA 5DFCA 5H1VA 4CFLA 5HRWA 5CPEA 5D3HA 4HBYA 4YY6A 4CL9A 4NR6A 4CLBA 1ZS5A 5CQ6A 5FE0A 3U5NA 5A81A 4YATA 4PCEA 5AD2A 4N4HA 4O70A 2DVSA 5LKZA 5F5ZA 5HFRA 1E6IA 4NS5A 4YAXA 5EWWA 4QSRA 5L98A 4HXOA 5ENFA 5FE9A 5DX4A 4UIUA 4NRAA 2OSSA 2RNYA 3P1DA 3LQHA 4UIYA 5ENCA 5KTXA 5D7XA 5DKCA 4Z1QA 5F1LA 5D3LA 4O7AA 3QZSA 4ZQLA 4LZSA 4TZ2A 5CS8A 4MR4A 3LQJA 1F68A 2YDWA 3LXJA 5FE1A 4NR8A 4NYVA 5EPRA 2DVQA 4ZC9A 3HMHA 4HXMA 3O36A 5DFBA 4TT6A 3O34A 4YBMA 5E9VA 5EQ1A 5I86A 2GRCA 2D82A 4NR9A 4QSPA 5F62A 3TLPA 4C67A 4IR3A 3O35A 5F61A 4QC3A 5HRVA 5A7CA 5I1QA 5CP5A 5F1HA 1EQFA 5E3DA 5HCLA 5EA1A 4IR6A 3D7CA 4N4FA 2R10A 3RCWA 5LVRA 4E96A 5EM3A 4OGIA 4TZ8A 4XUAA 4LDFA 4A9NA 3JVJA 4NRCA 5KO4A 5D24A 4N4GA 2R0YA 4O7CA 4MEPA 5D3NA 4A9EA 3UVWA 4QSVA 3UV2A 4O75A 1WUMA 4QSTA 4A9JA 5HQ7A 5C89A 5A5OA 4LR6A 5CZGA 3G0JA 4YYMA 5IG6A 4NR4A 5LKTA 3P1CA 4MEQA 3JVKA 5H1TA 4C66A 5I7XA 4NYWA 2F6NA 4YH4A 3P1FA 5FFYA 4N4IA 5D3SA 5AD3A 4Q0OA 4KCXA 5ETBA 5FB1A 3Q2EA 4LYWA 5JWMA 2KTBB 4NXJA 5EVAA 4NQNA 2YW5A 2N9GA 3G0LA 4O7EA 5DYAA 4A9MA 4ZW1A 5IBNA 4UITA 3JVLA 4XUBA 5DFDA 5HLSA 5CRMA 5G4RA 4X2IA 5FE4A 4YABA 5EV9A 4WHUA 2D9EA 2RFJA 5H85A 5AMEA 5E3GA 4MENA 4BW2A 4QSQA 4QUUA 5AMFA 5EWDA 5CQ5A 4QUTA 5FH8A 4GPJA 4HXLA 4F3IA 4IR5A 1X0JA 5I40A 3MB3A 4A9HA 4PY6A 3FKMX 5ENBA 2OO1A 4YC9A 5HJCA 3LJWA 5DKHA 2WP1A 5D26A 5A82A 5IGNA 5E9IA 5D3RA 4Z6HA 4YH3A 4LC2A 5C8GA 4YYGA 5ACYA 4WHWA 4J3IA 4LZRA 4O7BA 5ENIA 4J0RA 1JM4B 2YELA 5A5SA 4NUCA 2DVRA 1JSPB 5D3JA 3P5OA 4UIXA 5A5QA 5CQ4A 5DYUA 5CUCA 5KU3A 5FE3A 4O77A 4J0SA 4UIZA 3AADA 5CUDA 2L84A 4YYJA 4HXSA 4BW4A 4HXPA 3UVDA 4IR4A 4QYDA 4QEWA 4A9IA 5CU8A 5DY7A 4YYKA 1N72A 5CQ8A 5EU1A 4NQMA 4PKLA 2FSAA 4Q0NA 4O74A 4ALHA 5CTLA 4YYDA 4TQNA
chains in the Genus database with same CATH superfamily
5A85A 4HXRA 5F63A 3UVYA 5FH6A 4O72A 4PCIA 5EWCA 3DWYA 3Q2FA 3SVGA 4YBSA 4AI6A 5HELA 2DKWA 4LYIA 5A5NA 4A9FA 3SVHA 5CQAA 5E74A 2F6JA 5CUGA 3HMEA 4QY4A 4YADA 4TYLA 4CUTA 2E3KA 3MULA 5C4QA 4NR5A 5BT5A 5CFWA 4TT2A 2YYNA 5C87A 3JVMA 5ENJA 2L85A 4QC1A 3UV5A 5EISA 5F36A 3SVFA 5J0DA 4QR4A 5LKXA 5EICA 5A83A 5F3AA 3U5LA 4HBVA 4BHWA 3K2JA 4CFKA 4ALGA 5F25A 2RNWA 4CURA 4PTBA 3MUKA 5CQ3A 5E0RA 3GG3A 5IGKA 5LUUA 5I29A 2NXBA 2YEKA 5DKDA 5A5PA 5BT4A 4A9OA 5FB0A 3NXBA 4MR5A 4BJXA 5L97A 4YK0A 5TB6A 5LJ2A 5KTWA 3O37A 4DONA 5D0CA 3MXFA 5HFQA 4QSSA 5LVQA 5HEMA 5CY9A 5FG6A 5EP7A 5BT3A 4UYFA 4QSUA 5FE2A 2YEMA 4QNSA 4QB3A 5F2PA 2OUOA 2DWWA 5JI8A 2L5EA 4QSWA 4A9LA 5I89A 4CUSA 5FBXA 4UYDA 5DBMA 5CQTA 2E7NA 3P1EA 4TT4A 4UYHA 5DLXA 4PS5A 5CUBA 5E73A 4O7FA 5EI4A 2WP2A 5EWHA 5FFVA 5FE5A 4Z93A 5E7DA 5IGMA 4QEUA 2G4AA 5H1UA 3O33A 2MJVB 3LQIA 5EPBA 3MQMA 5LJ0A 5DLZA 5E9LA 3I3JA 4Y03A 4AKIA 4NUDA 5EK9A 4MR6A 3UW9A 5DW1A 5ENHA 3U5KA 5FE7A 5FE8A 3U5PA 4TU4A 4O76A 3S92A 4YY4A 5CQ7A 4YBTA 5ENEA 4XYAA 4NUEA 5C7NA 5CUAA 4TS8A 4MR3A 5D25A 2RS9B 5DYXA 4BW3A 5DW2A 3MB4A 5CGPA 4AKGA 5L8TA 4LZ2A 5EWVA 3U5OA 5G4SA 4IORA 4UYEA 5TCMA 4BW1A 4QZSA 5FE6A 5LKUA 4HXKA 5II1A 5I88A 5L96A 5HQ5A 2I8NA 5L99A 5FH7A 4O78A 3U5MA 4IOQA 5FG4A 3U5JA 4Z6IA 3ONIA 5E9KA 2YQDA 3AQAA 3IU6A 4TTEA 4WIVA 5CUEA 5KTUA 4UYGA 4YYIA 4LRGA 5ENGA 4AKHA 5DYCA 5LJ1A 4YYNA 5K29A 4RVRA 4AKNA 4A9KA 5II2A 2R0VA 5I83A 4XY8A 5FG5A 1ZKRA 4O71A 5C85A 4LYSA 2DVVA 2RI7A 5I7YA 4NYXA 5HENA 2RNXA 5A5RA 4MEOA 4XY9A 3ZYUA 5D3TA 2DATA 4N3WA 2E7OA 4IOOA 5KHMA 4FLPA 3QZTA 4CUQA 3IU5A 3DAIA 5F60A 5E9MA 1PUOA 4QEVA 3HMFA 5E9YA 5EGUA 2RO1A 4HBXA 4KV1A 4OUFA 4CUUA 1WUGA 5FFWA 5D3PA 4YYHA 2LSPB 4Z1SA 3S91A 4CUPA 3VKGA 5L8UA 4HBWA 4KV4A 5CRZA 4NRBA 4QBMA 5HM0A 5IGLA 5I80A 4TU6A 5COIA 4J1PA 5HQ6A 5ETDA 2I7KA 2R0SA 4OGJA 5EPSA 5HRXA 4QSXA 4QR3A 2EJNA 4QYLA 3UV4A 4QR5A 4UIWA 4HXNA 4NR7A 5IIDA 2H60A 3QZVA 4UYFB 4UIVA 5FDZA 3UVXA 3ERRA 5DFCA 5H1VA 4CFLA 5HRWA 5CPEA 5D3HA 4HBYA 4YY6A 4CL9A 4NR6A 4CLBA 1ZS5A 5CQ6A 5FE0A 3U5NA 5A81A 4YATA 4PCEA 5AD2A 4N4HA 4O70A 2DVSA 5LKZA 5F5ZA 5HFRA 1E6IA 4NS5A 4YAXA 5EWWA 4QSRA 5L98A 4HXOA 5ENFA 5FE9A 5DX4A 4UIUA 4NRAA 2OSSA 2RNYA 3P1DA 3LQHA 4UIYA 5ENCA 5KTXA 5D7XA 5DKCA 4Z1QA 5F1LA 5D3LA 4O7AA 3QZSA 4ZQLA 4LZSA 4TZ2A 5CS8A 4MR4A 3LQJA 1F68A 2YDWA 3LXJA 5FE1A 4NR8A 4NYVA 5EPRA 2DVQA 4ZC9A 3HMHA 4HXMA 3O36A 5DFBA 4TT6A 3O34A 4YBMA 5E9VA 5EQ1A 5I86A 2GRCA 2D82A 4NR9A 4QSPA 5F62A 3TLPA 4C67A 4IR3A 3O35A 5F61A 4QC3A 5HRVA 5A7CA 5I1QA 5CP5A 5F1HA 1EQFA 5E3DA 5HCLA 5EA1A 4IR6A 3D7CA 4N4FA 2R10A 3RCWA 5LVRA 4E96A 5EM3A 4OGIA 4TZ8A 4XUAA 4LDFA 4A9NA 3JVJA 4NRCA 5KO4A 5D24A 4N4GA 2R0YA 4O7CA 4MEPA 5D3NA 4A9EA 3UVWA 4QSVA 3UV2A 4O75A 1WUMA 4QSTA 4A9JA 5HQ7A 5C89A 5A5OA 3D1BA 4LR6A 5CZGA 3G0JA 4YYMA 5IG6A 4NR4A 5LKTA 3P1CA 4MEQA 3JVKA 5H1TA 4C66A 5I7XA 4NYWA 2F6NA 4YH4A 3P1FA 5FFYA 4N4IA 5D3SA 5AD3A 4Q0OA 4KCXA 5ETBA 5FB1A 3Q2EA 4LYWA 5JWMA 2KTBB 4NXJA 5EVAA 4NQNA 2YW5A 2N9GA 3G0LA 4O7EA 3D1DA 5DYAA 4A9MA 4ZW1A 5IBNA 4UITA 3JVLA 4XUBA 5DFDA 5HLSA 5CRMA 5G4RA 4X2IA 5FE4A 4YABA 5EV9A 4WHUA 2D9EA 2RFJA 5H85A 5AMEA 5E3GA 4MENA 4BW2A 3VKHA 4QSQA 4QUUA 5AMFA 5EWDA 5CQ5A 4QUTA 5FH8A 4GPJA 4HXLA 4F3IA 4IR5A 1X0JA 5I40A 3MB3A 4A9HA 4PY6A 3FKMX 5ENBA 2OO1A 4YC9A 5HJCA 3LJWA 5DKHA 2WP1A 5D26A 5A82A 5IGNA 5E9IA 5D3RA 4Z6HA 4YH3A 4LC2A 5C8GA 4YYGA 5ACYA 4WHWA 4J3IA 4LZRA 4O7BA 5ENIA 4J0RA 1JM4B 2YELA 5A5SA 4NUCA 2DVRA 1JSPB 5D3JA 3P5OA 4UIXA 5A5QA 5CQ4A 5DYUA 5CUCA 5KU3A 5FE3A 4O77A 4J0SA 4UIZA 3AADA 5CUDA 2L84A 4YYJA 4HXSA 4BW4A 4HXPA 3UVDA 4IR4A 4QYDA 4QEWA 4A9IA 5CU8A 5DY7A 4YYKA 1N72A 5CQ8A 5EU1A 4NQMA 4PKLA 2FSAA 4Q0NA 4O74A 4ALHA 5CTLA 4YYDA 4TQNA
chains in the Genus database with same CATH topology
5A85A 4HXRA 5F63A 3UVYA 5FH6A 4O72A 4PCIA 5EWCA 3DWYA 3Q2FA 3SVGA 4YBSA 5HELA 2DKWA 4LYIA 5A5NA 4A9FA 3SVHA 5CQAA 5E74A 2F6JA 5CUGA 3HMEA 4QY4A 4YADA 4TYLA 4CUTA 2E3KA 3MULA 5C4QA 4NR5A 5BT5A 5CFWA 4TT2A 2YYNA 5C87A 3JVMA 5ENJA 2L85A 4QC1A 3UV5A 5EISA 5F36A 3SVFA 5J0DA 4QR4A 5LKXA 5EICA 5A83A 5F3AA 3U5LA 4HBVA 4BHWA 3K2JA 4CFKA 4ALGA 5F25A 2RNWA 4CURA 4PTBA 3MUKA 5CQ3A 5E0RA 3GG3A 5IGKA 5LUUA 5I29A 2NXBA 2YEKA 5DKDA 5A5PA 5BT4A 4A9OA 5FB0A 3NXBA 4MR5A 4BJXA 5L97A 4YK0A 5TB6A 5LJ2A 5KTWA 3O37A 4DONA 5D0CA 3MXFA 5HFQA 4QSSA 5LVQA 5HEMA 5CY9A 5FG6A 5EP7A 5BT3A 4UYFA 4QSUA 5FE2A 2YEMA 4QNSA 4QB3A 5F2PA 2OUOA 2DWWA 5JI8A 2L5EA 4QSWA 4A9LA 5I89A 4CUSA 5FBXA 4UYDA 5DBMA 5CQTA 2E7NA 3P1EA 4TT4A 4UYHA 5DLXA 4PS5A 5CUBA 5E73A 4O7FA 5EI4A 2WP2A 5EWHA 5FFVA 5FE5A 4Z93A 5E7DA 5IGMA 4QEUA 2G4AA 5H1UA 3O33A 2MJVB 3LQIA 5EPBA 3MQMA 5LJ0A 5DLZA 5E9LA 3I3JA 4Y03A 4NUDA 5EK9A 4MR6A 3UW9A 5DW1A 5ENHA 3U5KA 5FE7A 5FE8A 3U5PA 4TU4A 4O76A 3S92A 4YY4A 5CQ7A 4YBTA 5ENEA 4XYAA 4NUEA 5C7NA 5CUAA 4TS8A 4MR3A 5D25A 2RS9B 5DYXA 4BW3A 5DW2A 3MB4A 5CGPA 5L8TA 4LZ2A 5EWVA 3U5OA 5G4SA 4IORA 4UYEA 5TCMA 4BW1A 4QZSA 5FE6A 5LKUA 4HXKA 5II1A 5I88A 5L96A 5HQ5A 2I8NA 5L99A 5FH7A 4O78A 3U5MA 4IOQA 5FG4A 3U5JA 4Z6IA 3ONIA 5E9KA 2YQDA 3AQAA 3IU6A 4TTEA 4WIVA 5CUEA 5KTUA 4UYGA 4YYIA 4LRGA 5ENGA 5DYCA 5LJ1A 4YYNA 5K29A 4RVRA 4AKNA 4A9KA 5II2A 2R0VA 5I83A 4XY8A 5FG5A 4O71A 5C85A 4LYSA 2DVVA 2RI7A 5I7YA 4NYXA 5HENA 2RNXA 5A5RA 4MEOA 4XY9A 3ZYUA 5D3TA 2DATA 4N3WA 2E7OA 4IOOA 5KHMA 4FLPA 3QZTA 4CUQA 3IU5A 3DAIA 5F60A 5E9MA 4QEVA 3HMFA 5E9YA 5EGUA 2RO1A 4HBXA 4KV1A 4OUFA 4CUUA 1WUGA 5FFWA 5D3PA 4YYHA 2LSPB 4Z1SA 3S91A 4CUPA 5L8UA 4HBWA 4KV4A 5CRZA 4NRBA 4QBMA 5HM0A 5IGLA 5I80A 4TU6A 5COIA 4J1PA 5HQ6A 5ETDA 2I7KA 2R0SA 4OGJA 5EPSA 5HRXA 4QSXA 4QR3A 4QYLA 3UV4A 4QR5A 4UIWA 4HXNA 4NR7A 5IIDA 2H60A 3QZVA 4UYFB 4UIVA 5FDZA 3UVXA 5DFCA 5H1VA 4CFLA 5HRWA 5CPEA 5D3HA 4HBYA 4YY6A 4CL9A 4NR6A 4CLBA 1ZS5A 5CQ6A 5FE0A 3U5NA 5A81A 4YATA 4PCEA 5AD2A 4N4HA 4O70A 2DVSA 5LKZA 5F5ZA 5HFRA 1E6IA 4NS5A 4YAXA 5EWWA 4QSRA 5L98A 4HXOA 5ENFA 5FE9A 5DX4A 4UIUA 4NRAA 2OSSA 2RNYA 3P1DA 3LQHA 4UIYA 5ENCA 5KTXA 5D7XA 5DKCA 4Z1QA 5F1LA 5D3LA 4O7AA 3QZSA 4ZQLA 4LZSA 4TZ2A 5CS8A 4MR4A 3LQJA 1F68A 2YDWA 3LXJA 5FE1A 4NR8A 4NYVA 5EPRA 2DVQA 4ZC9A 3HMHA 4HXMA 3O36A 5DFBA 4TT6A 3O34A 4YBMA 5E9VA 5EQ1A 5I86A 2GRCA 2D82A 4NR9A 4QSPA 5F62A 3TLPA 4C67A 4IR3A 3O35A 5F61A 4QC3A 5HRVA 5A7CA 5I1QA 5CP5A 5F1HA 1EQFA 5E3DA 5HCLA 5EA1A 4IR6A 3D7CA 4N4FA 2R10A 3RCWA 5LVRA 4E96A 5EM3A 4OGIA 4TZ8A 4XUAA 4LDFA 4A9NA 3JVJA 4NRCA 5KO4A 5D24A 4N4GA 2R0YA 4O7CA 4MEPA 5D3NA 4A9EA 3UVWA 4QSVA 3UV2A 4O75A 1WUMA 4QSTA 4A9JA 5HQ7A 5C89A 5A5OA 4LR6A 5CZGA 3G0JA 4YYMA 5IG6A 4NR4A 5LKTA 3P1CA 4MEQA 3JVKA 5H1TA 4C66A 5I7XA 4NYWA 2F6NA 4YH4A 3P1FA 5FFYA 4N4IA 5D3SA 5AD3A 4Q0OA 4KCXA 5ETBA 5FB1A 3Q2EA 4LYWA 5JWMA 2KTBB 4NXJA 5EVAA 4NQNA 2YW5A 2N9GA 3G0LA 4O7EA 5DYAA 4A9MA 4ZW1A 5IBNA 4UITA 3JVLA 4XUBA 5DFDA 5HLSA 5CRMA 5G4RA 4X2IA 5FE4A 4YABA 5EV9A 4WHUA 2D9EA 2RFJA 5H85A 5AMEA 5E3GA 4MENA 4BW2A 4QSQA 4QUUA 5AMFA 5EWDA 5CQ5A 4QUTA 5FH8A 4GPJA 4HXLA 4F3IA 4IR5A 1X0JA 5I40A 3MB3A 4A9HA 4PY6A 3FKMX 5ENBA 2OO1A 4YC9A 5HJCA 3LJWA 5DKHA 2WP1A 5D26A 5A82A 5IGNA 5E9IA 5D3RA 4Z6HA 4YH3A 4LC2A 5C8GA 4YYGA 5ACYA 4WHWA 4J3IA 4LZRA 4O7BA 5ENIA 4J0RA 1JM4B 2YELA 5A5SA 4NUCA 2DVRA 1JSPB 5D3JA 3P5OA 4UIXA 5A5QA 5CQ4A 5DYUA 5CUCA 5KU3A 5FE3A 4O77A 4J0SA 4UIZA 3AADA 5CUDA 2L84A 4YYJA 4HXSA 4BW4A 4HXPA 3UVDA 4IR4A 4QYDA 4QEWA 4A9IA 5CU8A 5DY7A 4YYKA 1N72A 5CQ8A 5EU1A 4NQMA 4PKLA 2FSAA 4Q0NA 4O74A 4ALHA 5CTLA 4YYDA 4TQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A85 A;  4HXR A;  5F63 A;  3UVY A;  5FH6 A;  4O72 A;  4PCI A;  5EWC A;  3DWY A;  3Q2F A;  3SVG A;  4YBS A;  5HEL A;  2DKW A;  4LYI A;  5A5N A;  4A9F A;  3SVH A;  5CQA A;  5E74 A;  2F6J A;  5CUG A;  3HME A;  4QY4 A;  4YAD A;  4TYL A;  4CUT A;  2E3K A;  3MUL A;  5C4Q A;  4NR5 A;  5BT5 A;  5CFW A;  4TT2 A;  2YYN A;  5C87 A;  3JVM A;  5ENJ A;  2L85 A;  4QC1 A;  3UV5 A;  5EIS A;  5F36 A;  3SVF A;  5J0D A;  4QR4 A;  5LKX A;  5EIC A;  5A83 A;  5F3A A;  3U5L A;  4HBV A;  4BHW A;  3K2J A;  4CFK A;  4ALG A;  5F25 A;  2RNW A;  4CUR A;  4PTB A;  3MUK A;  5CQ3 A;  5E0R A;  3GG3 A;  5IGK A;  5LUU A;  5I29 A;  2NXB A;  2YEK A;  5DKD A;  5A5P A;  5BT4 A;  4A9O A;  5FB0 A;  3NXB A;  4MR5 A;  4BJX A;  5L97 A;  4YK0 A;  5TB6 A;  5LJ2 A;  5KTW A;  3O37 A;  4DON A;  5D0C A;  3MXF A;  5HFQ A;  4QSS A;  5LVQ A;  5HEM A;  5CY9 A;  5FG6 A;  5EP7 A;  5BT3 A;  4UYF A;  4QSU A;  5FE2 A;  2YEM A;  4QNS A;  4QB3 A;  5F2P A;  2OUO A;  2DWW A;  5JI8 A;  2L5E A;  4QSW A;  4A9L A;  5I89 A;  4CUS A;  5FBX A;  4UYD A;  5DBM A;  5CQT A;  2E7N A;  3P1E A;  4TT4 A;  4UYH A;  5DLX A;  4PS5 A;  5CUB A;  5E73 A;  4O7F A;  5EI4 A;  2WP2 A;  5EWH A;  5FFV A;  5FE5 A;  4Z93 A;  5E7D A;  5IGM A;  4QEU A;  2G4A A;  5H1U A;  3O33 A;  2MJV B;  3LQI A;  5EPB A;  3MQM A;  5LJ0 A;  5DLZ A;  5E9L A;  3I3J A;  4Y03 A;  4NUD A;  5EK9 A;  4MR6 A;  3UW9 A;  5DW1 A;  5ENH A;  3U5K A;  5FE7 A;  5FE8 A;  3U5P A;  4TU4 A;  4O76 A;  3S92 A;  4YY4 A;  5CQ7 A;  4YBT A;  5ENE A;  4XYA A;  4NUE A;  5C7N A;  5CUA A;  4TS8 A;  4MR3 A;  5D25 A;  2RS9 B;  5DYX A;  4BW3 A;  5DW2 A;  3MB4 A;  5CGP A;  5L8T A;  4LZ2 A;  5EWV A;  3U5O A;  5G4S A;  4IOR A;  4UYE A;  5TCM A;  4BW1 A;  4QZS A;  5FE6 A;  5LKU A;  4HXK A;  5II1 A;  5I88 A;  5L96 A;  5HQ5 A;  2I8N A;  5L99 A;  5FH7 A;  4O78 A;  3U5M A;  4IOQ A;  5FG4 A;  3U5J A;  4Z6I A;  3ONI A;  5E9K A;  2YQD A;  3AQA A;  3IU6 A;  4TTE A;  4WIV A;  5CUE A;  5KTU A;  4UYG A;  4YYI A;  4LRG A;  5ENG A;  5DYC A;  5LJ1 A;  4YYN A;  5K29 A;  4RVR A;  4AKN A;  4A9K A;  5II2 A;  2R0V A;  5I83 A;  4XY8 A;  5FG5 A;  4O71 A;  5C85 A;  4LYS A;  2DVV A;  2RI7 A;  5I7Y A;  4NYX A;  5HEN A;  2RNX A;  5A5R A;  4MEO A;  4XY9 A;  3ZYU A;  5D3T A;  2DAT A;  4N3W A;  2E7O A;  4IOO A;  5KHM A;  4FLP A;  3QZT A;  4CUQ A;  3IU5 A;  3DAI A;  5F60 A;  5E9M A;  4QEV A;  3HMF A;  5E9Y A;  5EGU A;  2RO1 A;  4HBX A;  4KV1 A;  4OUF A;  4CUU A;  1WUG A;  5FFW A;  5D3P A;  4YYH A;  2LSP B;  4Z1S A;  3S91 A;  4CUP A;  5L8U A;  4HBW A;  4KV4 A;  5CRZ A;  4NRB A;  4QBM A;  5HM0 A;  5IGL A;  5I80 A;  4TU6 A;  5COI A;  4J1P A;  5HQ6 A;  5ETD A;  2I7K A;  2R0S A;  4OGJ A;  5EPS A;  5HRX A;  4QSX A;  4QR3 A;  4QYL A;  3UV4 A;  4QR5 A;  4UIW A;  4HXN A;  4NR7 A;  5IID A;  2H60 A;  3QZV A;  4UYF B;  4UIV A;  5FDZ A;  3UVX A;  5DFC A;  5H1V A;  4CFL A;  5HRW A;  5CPE A;  5D3H A;  4HBY A;  4YY6 A;  4CL9 A;  4NR6 A;  4CLB A;  1ZS5 A;  5CQ6 A;  5FE0 A;  3U5N A;  5A81 A;  4YAT A;  4PCE A;  5AD2 A;  4N4H A;  4O70 A;  2DVS A;  5LKZ A;  5F5Z A;  5HFR A;  1E6I A;  4NS5 A;  4YAX A;  5EWW A;  4QSR A;  5L98 A;  4HXO A;  5ENF A;  5FE9 A;  5DX4 A;  4UIU A;  4NRA A;  2OSS A;  2RNY A;  3P1D A;  3LQH A;  4UIY A;  5ENC A;  5KTX A;  5D7X A;  5DKC A;  4Z1Q A;  5F1L A;  5D3L A;  4O7A A;  3QZS A;  4ZQL A;  4LZS A;  4TZ2 A;  5CS8 A;  4MR4 A;  3LQJ A;  1F68 A;  2YDW A;  3LXJ A;  5FE1 A;  4NR8 A;  4NYV A;  5EPR A;  2DVQ A;  4ZC9 A;  3HMH A;  4HXM A;  3O36 A;  5DFB A;  4TT6 A;  3O34 A;  4YBM A;  5E9V A;  5EQ1 A;  5I86 A;  2GRC A;  2D82 A;  4NR9 A;  4QSP A;  5F62 A;  3TLP A;  4C67 A;  4IR3 A;  3O35 A;  5F61 A;  4QC3 A;  5HRV A;  5A7C A;  5I1Q A;  5CP5 A;  5F1H A;  1EQF A;  5E3D A;  5HCL A;  5EA1 A;  4IR6 A;  3D7C A;  4N4F A;  2R10 A;  3RCW A;  5LVR A;  4E96 A;  5EM3 A;  4OGI A;  4TZ8 A;  4XUA A;  4LDF A;  4A9N A;  3JVJ A;  4NRC A;  5KO4 A;  5D24 A;  4N4G A;  2R0Y A;  4O7C A;  4MEP A;  5D3N A;  4A9E A;  3UVW A;  4QSV A;  3UV2 A;  4O75 A;  1WUM A;  4QST A;  4A9J A;  5HQ7 A;  5C89 A;  5A5O A;  4LR6 A;  5CZG A;  3G0J A;  4YYM A;  5IG6 A;  4NR4 A;  5LKT A;  3P1C A;  4MEQ A;  3JVK A;  5H1T A;  4C66 A;  5I7X A;  4NYW A;  2F6N A;  4YH4 A;  3P1F A;  5FFY A;  4N4I A;  5D3S A;  5AD3 A;  4Q0O A;  4KCX A;  5ETB A;  5FB1 A;  3Q2E A;  4LYW A;  5JWM A;  2KTB B;  4NXJ A;  5EVA A;  4NQN A;  2YW5 A;  2N9G A;  3G0L A;  4O7E A;  5DYA A;  4A9M A;  4ZW1 A;  5IBN A;  4UIT A;  3JVL A;  4XUB A;  5DFD A;  5HLS A;  5CRM A;  5G4R A;  4X2I A;  5FE4 A;  4YAB A;  5EV9 A;  4WHU A;  2D9E A;  2RFJ A;  5H85 A;  5AME A;  5E3G A;  4MEN A;  4BW2 A;  4QSQ A;  4QUU A;  5AMF A;  5EWD A;  5CQ5 A;  4QUT A;  5FH8 A;  4GPJ A;  4HXL A;  4F3I A;  4IR5 A;  1X0J A;  5I40 A;  3MB3 A;  4A9H A;  4PY6 A;  3FKM X;  5ENB A;  2OO1 A;  4YC9 A;  5HJC A;  3LJW A;  5DKH A;  2WP1 A;  5D26 A;  5A82 A;  5IGN A;  5E9I A;  5D3R A;  4Z6H A;  4YH3 A;  4LC2 A;  5C8G A;  4YYG A;  5ACY A;  4WHW A;  4J3I A;  4LZR A;  4O7B A;  5ENI A;  4J0R A;  1JM4 B;  2YEL A;  5A5S A;  4NUC A;  2DVR A;  1JSP B;  5D3J A;  3P5O A;  4UIX A;  5A5Q A;  5CQ4 A;  5DYU A;  5CUC A;  5KU3 A;  5FE3 A;  4O77 A;  4J0S A;  4UIZ A;  3AAD A;  5CUD A;  2L84 A;  4YYJ A;  4HXS A;  4BW4 A;  4HXP A;  3UVD A;  4IR4 A;  4QYD A;  4QEW A;  4A9I A;  5CU8 A;  5DY7 A;  4YYK A;  1N72 A;  5CQ8 A;  5EU1 A;  4NQM A;  4PKL A;  2FSA A;  4Q0N A;  4O74 A;  4ALH A;  5CTL A;  4YYD A;  4TQN A; 
#chains in the Genus database with same CATH topology
 5A85 A;  4HXR A;  5F63 A;  3UVY A;  5FH6 A;  4O72 A;  4PCI A;  5EWC A;  3DWY A;  3Q2F A;  3SVG A;  4YBS A;  4AI6 A;  5HEL A;  2DKW A;  4LYI A;  5A5N A;  4A9F A;  3SVH A;  5CQA A;  5E74 A;  2F6J A;  5CUG A;  3HME A;  4QY4 A;  4YAD A;  4TYL A;  4CUT A;  2E3K A;  3MUL A;  5C4Q A;  4NR5 A;  5BT5 A;  5CFW A;  4TT2 A;  2YYN A;  5C87 A;  3JVM A;  5ENJ A;  2L85 A;  4QC1 A;  3UV5 A;  5EIS A;  5F36 A;  3SVF A;  5J0D A;  4QR4 A;  5LKX A;  5EIC A;  5A83 A;  5F3A A;  3U5L A;  4HBV A;  4BHW A;  3K2J A;  4CFK A;  4ALG A;  5F25 A;  2RNW A;  4CUR A;  4PTB A;  3MUK A;  5CQ3 A;  5E0R A;  3GG3 A;  5IGK A;  5LUU A;  5I29 A;  2NXB A;  2YEK A;  5DKD A;  5A5P A;  5BT4 A;  4A9O A;  5FB0 A;  3NXB A;  4MR5 A;  4BJX A;  5L97 A;  4YK0 A;  5TB6 A;  5LJ2 A;  5KTW A;  3O37 A;  4DON A;  5D0C A;  3MXF A;  5HFQ A;  4QSS A;  5LVQ A;  5HEM A;  5CY9 A;  5FG6 A;  5EP7 A;  5BT3 A;  4UYF A;  4QSU A;  5FE2 A;  2YEM A;  4QNS A;  4QB3 A;  5F2P A;  2OUO A;  2DWW A;  5JI8 A;  2L5E A;  4QSW A;  4A9L A;  5I89 A;  4CUS A;  5FBX A;  4UYD A;  5DBM A;  5CQT A;  2E7N A;  3P1E A;  4TT4 A;  4UYH A;  5DLX A;  4PS5 A;  5CUB A;  5E73 A;  4O7F A;  5EI4 A;  2WP2 A;  5EWH A;  5FFV A;  5FE5 A;  4Z93 A;  5E7D A;  5IGM A;  4QEU A;  2G4A A;  5H1U A;  3O33 A;  2MJV B;  3LQI A;  5EPB A;  3MQM A;  5LJ0 A;  5DLZ A;  5E9L A;  3I3J A;  4Y03 A;  4AKI A;  4NUD A;  5EK9 A;  4MR6 A;  3UW9 A;  5DW1 A;  5ENH A;  3U5K A;  5FE7 A;  5FE8 A;  3U5P A;  4TU4 A;  4O76 A;  3S92 A;  4YY4 A;  5CQ7 A;  4YBT A;  5ENE A;  4XYA A;  4NUE A;  5C7N A;  5CUA A;  4TS8 A;  4MR3 A;  5D25 A;  2RS9 B;  5DYX A;  4BW3 A;  5DW2 A;  3MB4 A;  5CGP A;  4AKG A;  5L8T A;  4LZ2 A;  5EWV A;  3U5O A;  5G4S A;  4IOR A;  4UYE A;  5TCM A;  4BW1 A;  4QZS A;  5FE6 A;  5LKU A;  4HXK A;  5II1 A;  5I88 A;  5L96 A;  5HQ5 A;  2I8N A;  5L99 A;  5FH7 A;  4O78 A;  3U5M A;  4IOQ A;  5FG4 A;  3U5J A;  4Z6I A;  3ONI A;  5E9K A;  2YQD A;  3AQA A;  3IU6 A;  4TTE A;  4WIV A;  5CUE A;  5KTU A;  4UYG A;  4YYI A;  4LRG A;  5ENG A;  4AKH A;  5DYC A;  5LJ1 A;  4YYN A;  5K29 A;  4RVR A;  4AKN A;  4A9K A;  5II2 A;  2R0V A;  5I83 A;  4XY8 A;  5FG5 A;  1ZKR A;  4O71 A;  5C85 A;  4LYS A;  2DVV A;  2RI7 A;  5I7Y A;  4NYX A;  5HEN A;  2RNX A;  5A5R A;  4MEO A;  4XY9 A;  3ZYU A;  5D3T A;  2DAT A;  4N3W A;  2E7O A;  4IOO A;  5KHM A;  4FLP A;  3QZT A;  4CUQ A;  3IU5 A;  3DAI A;  5F60 A;  5E9M A;  1PUO A;  4QEV A;  3HMF A;  5E9Y A;  5EGU A;  2RO1 A;  4HBX A;  4KV1 A;  4OUF A;  4CUU A;  1WUG A;  5FFW A;  5D3P A;  4YYH A;  2LSP B;  4Z1S A;  3S91 A;  4CUP A;  3VKG A;  5L8U A;  4HBW A;  4KV4 A;  5CRZ A;  4NRB A;  4QBM A;  5HM0 A;  5IGL A;  5I80 A;  4TU6 A;  5COI A;  4J1P A;  5HQ6 A;  5ETD A;  2I7K A;  2R0S A;  4OGJ A;  5EPS A;  5HRX A;  4QSX A;  4QR3 A;  2EJN A;  4QYL A;  3UV4 A;  4QR5 A;  4UIW A;  4HXN A;  4NR7 A;  5IID A;  2H60 A;  3QZV A;  4UYF B;  4UIV A;  5FDZ A;  3UVX A;  3ERR A;  5DFC A;  5H1V A;  4CFL A;  5HRW A;  5CPE A;  5D3H A;  4HBY A;  4YY6 A;  4CL9 A;  4NR6 A;  4CLB A;  1ZS5 A;  5CQ6 A;  5FE0 A;  3U5N A;  5A81 A;  4YAT A;  4PCE A;  5AD2 A;  4N4H A;  4O70 A;  2DVS A;  5LKZ A;  5F5Z A;  5HFR A;  1E6I A;  4NS5 A;  4YAX A;  5EWW A;  4QSR A;  5L98 A;  4HXO A;  5ENF A;  5FE9 A;  5DX4 A;  4UIU A;  4NRA A;  2OSS A;  2RNY A;  3P1D A;  3LQH A;  4UIY A;  5ENC A;  5KTX A;  5D7X A;  5DKC A;  4Z1Q A;  5F1L A;  5D3L A;  4O7A A;  3QZS A;  4ZQL A;  4LZS A;  4TZ2 A;  5CS8 A;  4MR4 A;  3LQJ A;  1F68 A;  2YDW A;  3LXJ A;  5FE1 A;  4NR8 A;  4NYV A;  5EPR A;  2DVQ A;  4ZC9 A;  3HMH A;  4HXM A;  3O36 A;  5DFB A;  4TT6 A;  3O34 A;  4YBM A;  5E9V A;  5EQ1 A;  5I86 A;  2GRC A;  2D82 A;  4NR9 A;  4QSP A;  5F62 A;  3TLP A;  4C67 A;  4IR3 A;  3O35 A;  5F61 A;  4QC3 A;  5HRV A;  5A7C A;  5I1Q A;  5CP5 A;  5F1H A;  1EQF A;  5E3D A;  5HCL A;  5EA1 A;  4IR6 A;  3D7C A;  4N4F A;  2R10 A;  3RCW A;  5LVR A;  4E96 A;  5EM3 A;  4OGI A;  4TZ8 A;  4XUA A;  4LDF A;  4A9N A;  3JVJ A;  4NRC A;  5KO4 A;  5D24 A;  4N4G A;  2R0Y A;  4O7C A;  4MEP A;  5D3N A;  4A9E A;  3UVW A;  4QSV A;  3UV2 A;  4O75 A;  1WUM A;  4QST A;  4A9J A;  5HQ7 A;  5C89 A;  5A5O A;  3D1B A;  4LR6 A;  5CZG A;  3G0J A;  4YYM A;  5IG6 A;  4NR4 A;  5LKT A;  3P1C A;  4MEQ A;  3JVK A;  5H1T A;  4C66 A;  5I7X A;  4NYW A;  2F6N A;  4YH4 A;  3P1F A;  5FFY A;  4N4I A;  5D3S A;  5AD3 A;  4Q0O A;  4KCX A;  5ETB A;  5FB1 A;  3Q2E A;  4LYW A;  5JWM A;  2KTB B;  4NXJ A;  5EVA A;  4NQN A;  2YW5 A;  2N9G A;  3G0L A;  4O7E A;  3D1D A;  5DYA A;  4A9M A;  4ZW1 A;  5IBN A;  4UIT A;  3JVL A;  4XUB A;  5DFD A;  5HLS A;  5CRM A;  5G4R A;  4X2I A;  5FE4 A;  4YAB A;  5EV9 A;  4WHU A;  2D9E A;  2RFJ A;  5H85 A;  5AME A;  5E3G A;  4MEN A;  4BW2 A;  3VKH A;  4QSQ A;  4QUU A;  5AMF A;  5EWD A;  5CQ5 A;  4QUT A;  5FH8 A;  4GPJ A;  4HXL A;  4F3I A;  4IR5 A;  1X0J A;  5I40 A;  3MB3 A;  4A9H A;  4PY6 A;  3FKM X;  5ENB A;  2OO1 A;  4YC9 A;  5HJC A;  3LJW A;  5DKH A;  2WP1 A;  5D26 A;  5A82 A;  5IGN A;  5E9I A;  5D3R A;  4Z6H A;  4YH3 A;  4LC2 A;  5C8G A;  4YYG A;  5ACY A;  4WHW A;  4J3I A;  4LZR A;  4O7B A;  5ENI A;  4J0R A;  1JM4 B;  2YEL A;  5A5S A;  4NUC A;  2DVR A;  1JSP B;  5D3J A;  3P5O A;  4UIX A;  5A5Q A;  5CQ4 A;  5DYU A;  5CUC A;  5KU3 A;  5FE3 A;  4O77 A;  4J0S A;  4UIZ A;  3AAD A;  5CUD A;  2L84 A;  4YYJ A;  4HXS A;  4BW4 A;  4HXP A;  3UVD A;  4IR4 A;  4QYD A;  4QEW A;  4A9I A;  5CU8 A;  5DY7 A;  4YYK A;  1N72 A;  5CQ8 A;  5EU1 A;  4NQM A;  4PKL A;  2FSA A;  4Q0N A;  4O74 A;  4ALH A;  5CTL A;  4YYD A;  4TQN A; 
#chains in the Genus database with same CATH homology
 5A85 A;  4HXR A;  5F63 A;  3UVY A;  5FH6 A;  4O72 A;  4PCI A;  5EWC A;  3DWY A;  3Q2F A;  3SVG A;  4YBS A;  5HEL A;  2DKW A;  4LYI A;  5A5N A;  4A9F A;  3SVH A;  5CQA A;  5E74 A;  2F6J A;  5CUG A;  3HME A;  4QY4 A;  4YAD A;  4TYL A;  4CUT A;  2E3K A;  3MUL A;  5C4Q A;  4NR5 A;  5BT5 A;  5CFW A;  4TT2 A;  2YYN A;  5C87 A;  3JVM A;  5ENJ A;  2L85 A;  4QC1 A;  3UV5 A;  5EIS A;  5F36 A;  3SVF A;  5J0D A;  4QR4 A;  5LKX A;  5EIC A;  5A83 A;  5F3A A;  3U5L A;  4HBV A;  4BHW A;  3K2J A;  4CFK A;  4ALG A;  5F25 A;  2RNW A;  4CUR A;  4PTB A;  3MUK A;  5CQ3 A;  5E0R A;  3GG3 A;  5IGK A;  5LUU A;  5I29 A;  2NXB A;  2YEK A;  5DKD A;  5A5P A;  5BT4 A;  4A9O A;  5FB0 A;  3NXB A;  4MR5 A;  4BJX A;  5L97 A;  4YK0 A;  5TB6 A;  5LJ2 A;  5KTW A;  3O37 A;  4DON A;  5D0C A;  3MXF A;  5HFQ A;  4QSS A;  5LVQ A;  5HEM A;  5CY9 A;  5FG6 A;  5EP7 A;  5BT3 A;  4UYF A;  4QSU A;  5FE2 A;  2YEM A;  4QNS A;  4QB3 A;  5F2P A;  2OUO A;  2DWW A;  5JI8 A;  2L5E A;  4QSW A;  4A9L A;  5I89 A;  4CUS A;  5FBX A;  4UYD A;  5DBM A;  5CQT A;  2E7N A;  3P1E A;  4TT4 A;  4UYH A;  5DLX A;  4PS5 A;  5CUB A;  5E73 A;  4O7F A;  5EI4 A;  2WP2 A;  5EWH A;  5FFV A;  5FE5 A;  4Z93 A;  5E7D A;  5IGM A;  4QEU A;  2G4A A;  5H1U A;  3O33 A;  2MJV B;  3LQI A;  5EPB A;  3MQM A;  5LJ0 A;  5DLZ A;  5E9L A;  3I3J A;  4Y03 A;  4NUD A;  5EK9 A;  4MR6 A;  3UW9 A;  5DW1 A;  5ENH A;  3U5K A;  5FE7 A;  5FE8 A;  3U5P A;  4TU4 A;  4O76 A;  3S92 A;  4YY4 A;  5CQ7 A;  4YBT A;  5ENE A;  4XYA A;  4NUE A;  5C7N A;  5CUA A;  4TS8 A;  4MR3 A;  5D25 A;  2RS9 B;  5DYX A;  4BW3 A;  5DW2 A;  3MB4 A;  5CGP A;  5L8T A;  4LZ2 A;  5EWV A;  3U5O A;  5G4S A;  4IOR A;  4UYE A;  5TCM A;  4BW1 A;  4QZS A;  5FE6 A;  5LKU A;  4HXK A;  5II1 A;  5I88 A;  5L96 A;  5HQ5 A;  2I8N A;  5L99 A;  5FH7 A;  4O78 A;  3U5M A;  4IOQ A;  5FG4 A;  3U5J A;  4Z6I A;  3ONI A;  5E9K A;  2YQD A;  3AQA A;  3IU6 A;  4TTE A;  4WIV A;  5CUE A;  5KTU A;  4UYG A;  4YYI A;  4LRG A;  5ENG A;  5DYC A;  5LJ1 A;  4YYN A;  5K29 A;  4RVR A;  4AKN A;  4A9K A;  5II2 A;  2R0V A;  5I83 A;  4XY8 A;  5FG5 A;  4O71 A;  5C85 A;  4LYS A;  2DVV A;  2RI7 A;  5I7Y A;  4NYX A;  5HEN A;  2RNX A;  5A5R A;  4MEO A;  4XY9 A;  3ZYU A;  5D3T A;  2DAT A;  4N3W A;  2E7O A;  4IOO A;  5KHM A;  4FLP A;  3QZT A;  4CUQ A;  3IU5 A;  3DAI A;  5F60 A;  5E9M A;  4QEV A;  3HMF A;  5E9Y A;  5EGU A;  2RO1 A;  4HBX A;  4KV1 A;  4OUF A;  4CUU A;  1WUG A;  5FFW A;  5D3P A;  4YYH A;  2LSP B;  4Z1S A;  3S91 A;  4CUP A;  5L8U A;  4HBW A;  4KV4 A;  5CRZ A;  4NRB A;  4QBM A;  5HM0 A;  5IGL A;  5I80 A;  4TU6 A;  5COI A;  4J1P A;  5HQ6 A;  5ETD A;  2I7K A;  2R0S A;  4OGJ A;  5EPS A;  5HRX A;  4QSX A;  4QR3 A;  4QYL A;  3UV4 A;  4QR5 A;  4UIW A;  4HXN A;  4NR7 A;  5IID A;  2H60 A;  3QZV A;  4UYF B;  4UIV A;  5FDZ A;  3UVX A;  5DFC A;  5H1V A;  4CFL A;  5HRW A;  5CPE A;  5D3H A;  4HBY A;  4YY6 A;  4CL9 A;  4NR6 A;  4CLB A;  1ZS5 A;  5CQ6 A;  5FE0 A;  3U5N A;  5A81 A;  4YAT A;  4PCE A;  5AD2 A;  4N4H A;  4O70 A;  2DVS A;  5LKZ A;  5F5Z A;  5HFR A;  1E6I A;  4NS5 A;  4YAX A;  5EWW A;  4QSR A;  5L98 A;  4HXO A;  5ENF A;  5FE9 A;  5DX4 A;  4UIU A;  4NRA A;  2OSS A;  2RNY A;  3P1D A;  3LQH A;  4UIY A;  5ENC A;  5KTX A;  5D7X A;  5DKC A;  4Z1Q A;  5F1L A;  5D3L A;  4O7A A;  3QZS A;  4ZQL A;  4LZS A;  4TZ2 A;  5CS8 A;  4MR4 A;  3LQJ A;  1F68 A;  2YDW A;  3LXJ A;  5FE1 A;  4NR8 A;  4NYV A;  5EPR A;  2DVQ A;  4ZC9 A;  3HMH A;  4HXM A;  3O36 A;  5DFB A;  4TT6 A;  3O34 A;  4YBM A;  5E9V A;  5EQ1 A;  5I86 A;  2GRC A;  2D82 A;  4NR9 A;  4QSP A;  5F62 A;  3TLP A;  4C67 A;  4IR3 A;  3O35 A;  5F61 A;  4QC3 A;  5HRV A;  5A7C A;  5I1Q A;  5CP5 A;  5F1H A;  1EQF A;  5E3D A;  5HCL A;  5EA1 A;  4IR6 A;  3D7C A;  4N4F A;  2R10 A;  3RCW A;  5LVR A;  4E96 A;  5EM3 A;  4OGI A;  4TZ8 A;  4XUA A;  4LDF A;  4A9N A;  3JVJ A;  4NRC A;  5KO4 A;  5D24 A;  4N4G A;  2R0Y A;  4O7C A;  4MEP A;  5D3N A;  4A9E A;  3UVW A;  4QSV A;  3UV2 A;  4O75 A;  1WUM A;  4QST A;  4A9J A;  5HQ7 A;  5C89 A;  5A5O A;  4LR6 A;  5CZG A;  3G0J A;  4YYM A;  5IG6 A;  4NR4 A;  5LKT A;  3P1C A;  4MEQ A;  3JVK A;  5H1T A;  4C66 A;  5I7X A;  4NYW A;  2F6N A;  4YH4 A;  3P1F A;  5FFY A;  4N4I A;  5D3S A;  5AD3 A;  4Q0O A;  4KCX A;  5ETB A;  5FB1 A;  3Q2E A;  4LYW A;  5JWM A;  2KTB B;  4NXJ A;  5EVA A;  4NQN A;  2YW5 A;  2N9G A;  3G0L A;  4O7E A;  5DYA A;  4A9M A;  4ZW1 A;  5IBN A;  4UIT A;  3JVL A;  4XUB A;  5DFD A;  5HLS A;  5CRM A;  5G4R A;  4X2I A;  5FE4 A;  4YAB A;  5EV9 A;  4WHU A;  2D9E A;  2RFJ A;  5H85 A;  5AME A;  5E3G A;  4MEN A;  4BW2 A;  4QSQ A;  4QUU A;  5AMF A;  5EWD A;  5CQ5 A;  4QUT A;  5FH8 A;  4GPJ A;  4HXL A;  4F3I A;  4IR5 A;  1X0J A;  5I40 A;  3MB3 A;  4A9H A;  4PY6 A;  3FKM X;  5ENB A;  2OO1 A;  4YC9 A;  5HJC A;  3LJW A;  5DKH A;  2WP1 A;  5D26 A;  5A82 A;  5IGN A;  5E9I A;  5D3R A;  4Z6H A;  4YH3 A;  4LC2 A;  5C8G A;  4YYG A;  5ACY A;  4WHW A;  4J3I A;  4LZR A;  4O7B A;  5ENI A;  4J0R A;  1JM4 B;  2YEL A;  5A5S A;  4NUC A;  2DVR A;  1JSP B;  5D3J A;  3P5O A;  4UIX A;  5A5Q A;  5CQ4 A;  5DYU A;  5CUC A;  5KU3 A;  5FE3 A;  4O77 A;  4J0S A;  4UIZ A;  3AAD A;  5CUD A;  2L84 A;  4YYJ A;  4HXS A;  4BW4 A;  4HXP A;  3UVD A;  4IR4 A;  4QYD A;  4QEW A;  4A9I A;  5CU8 A;  5DY7 A;  4YYK A;  1N72 A;  5CQ8 A;  5EU1 A;  4NQM A;  4PKL A;  2FSA A;  4Q0N A;  4O74 A;  4ALH A;  5CTL A;  4YYD A;  4TQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...