5FG5A

Crystal structure of the bromodomain of human brpf1 in complex with pfi-4 chemical probe
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
114
structure length
114
Chain Sequence
MEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Peregrin
publication title Crystal structure of the bromodomain of human BRPF1 in complex with PFI-4 chemical probe
rcsb
source organism Homo sapiens
total genus 42
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fg5A00
4O7FA 5FBXA 2YQDA 4TZ8A 4NR5A 4YYJA 5COIA 5AMFA 5CRMA 4CUTA 5DBMA 5CUEA 4YYMA 2DATA 4BW3A 5A85A 2G4AA 5DY7A 4YY6A 5LUUA 4NUDA 3ZYUA 3HMEA 4IORA 5FFVA 5L99A 5I86A 4QYDA 2YYNA 5FFYA 4ZW1A 5CRZA 4O75A 3LQHA 5I7XA 3I3JA 4DONA 4QSTA 4QNSA 4CURA 5C8GA 4J0SA 4A9KA 4Z6IA 5AD2A 3D7CA 4O72A 3O35A 4QSUA 4QUUA 3IU6A 5ETDA 4FLPA 5AMEA 5E3DA 4IR6A 5I89A 4NRCA 3UV5A 5DW2A 4XUAA 4A9NA 3UW9A 3NXBA 5IG6A 5LKTA 5EGUA 5E74A 5FG4A 4YY4A 2L5EA 4QEWA 5I88A 3TLPA 2DVRA 5ENGA 4N3WA 5CGPA 5FG5A 5DFCA 5HCLA 3IU5A 2OUOA 4F3IA 4YATA 4RVRA 5LVRA 4A9EA 5D3LA 3U5NA 4YAXA 5E9IA 4QSPA 4QR4A 5EISA 2RS9B 4QSVA 5E9LA 4YADA 3O34A 5ENBA 5C4QA 5ACYA 4LYWA 5E3GA 5EU1A 5FH7A 4O70A 4IR5A 5D3JA 4HXLA 5FE2A 5KTWA 5L8TA 4CUPA 5D3HA 2E7OA 5FE0A 4GPJA 5A82A 3AADA 5L98A 5ENFA 4NRAA 4HXSA 4N4FA 5EWCA 5FH8A 5D7XA 5FDZA 4AKNA 4ZC9A 4NQNA 4NS5A 5E7DA 2RFJA 5EA1A 3U5MA 4O7CA 4HXNA 1JSPB 2YW5A 5D26A 4ALGA 2YEMA 5FE5A 4BW4A 4X2IA 4MENA 4LZSA 4LC2A 4MR5A 4QC3A 5KU3A 4LDFA 4OGJA 2KTBB 5A5RA 2WP1A 5A7CA 5E0RA 4A9JA 5IIDA 3G0JA 4TT6A 3FKMX 5A5SA 5A81A 2N9GA 5FE3A 4NYWA 5CQAA 4QC1A 4TYLA 1X0JA 4MEPA 4UITA 4UYFA 2DKWA 5A5OA 3AQAA 4BW1A 4QZSA 4YBMA 5HENA 4A9LA 5F60A 5DLXA 5I7YA 5C87A 2RNXA 4QB3A 5D25A 5HFRA 4Z1SA 5LVQA 4A9OA 5I80A 3S91A 5EP7A 5CTLA 1E6IA 3SVFA 4A9MA 3MUKA 4J0RA 4YK0A 3S92A 5A5NA 1WUMA 2NXBA 4UIYA 5H1TA 5KO4A 4OGIA 4NYVA 3QZTA 4N4GA 5ETBA 5FB0A 5F25A 2RI7A 4HBWA 4QR3A 3MULA 5DYAA 4QR5A 4UIWA 5J0DA 4QSXA 5EI4A 5FE8A 5H1UA 5HRWA 5KHMA 4XYAA 3U5OA 5C7NA 5EPSA 4O71A 5A5PA 5EV9A 2FSAA 4HXPA 5D3SA 2L84A 5HFQA 3UV2A 2GRCA 4HBYA 4NR4A 3U5PA 4XY9A 5EICA 4Z1QA 4LZRA 5CUBA 5I29A 5LJ1A 4YYNA 4CFLA 5IGMA 5LJ0A 4TU4A 4NR7A 2YELA 3O33A 2RNWA 2DVSA 4Q0OA 4ZQLA 1WUGA 4UYEA 3U5LA 4NR9A 5F36A 5BT3A 4CUSA 3GG3A 5FE6A 5CS8A 4J1PA 3DAIA 4BW2A 4NR6A 5CQ6A 3JVKA 3QZSA 3UVYA 5HQ7A 2MJVB 4NR8A 5DLZA 5DYCA 4QSWA 3DWYA 5E73A 5D3RA 5DYUA 3HMFA 5EWDA 5F1HA 3U5JA 4HBVA 5CQ7A 5CZGA 3ONIA 4C67A 5FE7A 4UIXA 4TS8A 4HXMA 4LYSA 4PS5A 4TU6A 5CUGA 4Z93A 3QZVA 5E9YA 4UYGA 5F62A 2R0VA 4TQNA 3Q2EA 5FG6A 4IR4A 4NYXA 5DFDA 4PKLA 2RNYA 4LRGA 5HRXA 4A9HA 5CUDA 5HLSA 3MB4A 5E9KA 3K2JA 4KV1A 2D9EA 4CLBA 4YYHA 5D3TA 5BT5A 2YEKA 5EQ1A 5L96A 4QSRA 5EWHA 5EM3A 3SVHA 5EK9A 3JVJA 5L97A 5BT4A 5FFWA 4O76A 5DKHA 5ENEA 4MEOA 1EQFA 3RCWA 2D82A 4YBTA 3P5OA 5AD3A 5DW1A 4LZ2A 2LSPB 5C85A 4YC9A 4NQMA 5L8UA 4NRBA 5II2A 2F6NA 4NXJA 4UYHA 4N4IA 4YBSA 4LR6A 1F68A 2OSSA 4PCEA 4OUFA 5FE4A 4BHWA 5K29A 4UYDA 2I8NA 3LJWA 3P1EA 4YYIA 5CQ8A 4TT4A 5CY9A 5IGNA 2H60A 5HJCA 5TCMA 4O77A 4WHUA 4HXOA 4QSSA 3MXFA 4BJXA 5C89A 4O7BA 5HELA 5EVAA 3MQMA 4PY6A 3UVXA 5A83A 2OO1A 3HMHA 4O7EA 4MR3A 5HQ6A 2WP2A 5IGKA 3P1DA 5HEMA 4Q0NA 4KV4A 5I1QA 4CL9A 4MR4A 4IR3A 3UVWA 4Y03A 4CUQA 4O7AA 5CQ5A 5D3PA 1ZS5A 5CP5A 4QBMA 3LQIA 4N4HA 3LQJA 5DX4A 5KTXA 5LKXA 3MB3A 3JVLA 5H85A 5CQ3A 5D3NA 4C66A 3O37A 4QYLA 5CUCA 4MR6A 5I83A 4E96A 4QEUA 4WHWA 4CUUA 4IOOA 5F3AA 5F5ZA 4Z6HA 2F6JA 4CFKA 4TT2A 4J3IA 2DVVA 5FE9A 5HM0A 4ALHA 5FB1A 3SVGA 2DWWA 4WIVA 5FE1A 4TTEA 4HBXA 4IOQA 5EPBA 4HXRA 4YYGA 2L85A 4QY4A 2E3KA 5JI8A 5ENHA 5A5QA 5H1VA 5DKDA 5HQ5A 5CPEA 1JM4B 4UIZA 5F63A 4PCIA 5EPRA 5EWWA 4MEQA 5CQTA 5IGLA 3JVMA 3UV4A 4NUCA 5ENCA 5II1A 5G4RA 3U5KA 2DVQA 2R0SA 5G4SA 5CFWA 1N72A 3P1CA 4UIVA 4QEVA 3LXJA 5D0CA 3P1FA 5ENJA 4O74A 4A9FA 4XUBA 5CU8A 3G0LA 4XY8A 5HRVA 5FH6A 5JWMA 5KTUA 4UIUA 4UYFB 4YH4A 3UVDA 2RO1A 5F61A 4YYDA 4QSQA 4LYIA 5CUAA 4YABA 4YH3A 5DKCA 2I7KA 2E7NA 4HXKA 5ENIA 4NUEA 5D24A 5F2PA 3O36A 5LJ2A 4O78A 5EWVA 5TB6A 2YDWA 5LKUA 5DYXA 5E9VA 4KCXA 4YYKA 4QUTA 5CQ4A 5I40A 4PTBA 4A9IA 5LKZA 5E9MA 5F1LA 2R10A 5IBNA 2R0YA 4TZ2A 3Q2FA 5DFBA
chains in the Genus database with same CATH superfamily
4O7FA 5FBXA 2YQDA 4TZ8A 4NR5A 4YYJA 5COIA 5AMFA 5CRMA 4CUTA 5DBMA 5CUEA 4YYMA 2DATA 4BW3A 5A85A 4AKHA 2G4AA 5DY7A 4YY6A 5LUUA 4NUDA 3ZYUA 3HMEA 4IORA 5FFVA 5L99A 5I86A 4QYDA 2YYNA 5FFYA 4ZW1A 5CRZA 4O75A 3LQHA 5I7XA 3I3JA 4DONA 4QSTA 4QNSA 4CURA 5C8GA 4J0SA 4A9KA 4Z6IA 5AD2A 3D7CA 4O72A 3O35A 4QSUA 4QUUA 3IU6A 5ETDA 4FLPA 5AMEA 5E3DA 4IR6A 5I89A 4NRCA 3UV5A 3VKHA 5DW2A 4XUAA 4A9NA 3UW9A 3NXBA 5IG6A 5LKTA 5EGUA 5E74A 5FG4A 4YY4A 2L5EA 4QEWA 5I88A 3TLPA 2DVRA 5ENGA 4N3WA 5CGPA 5FG5A 5DFCA 5HCLA 3IU5A 2OUOA 4F3IA 4YATA 4RVRA 5LVRA 4A9EA 5D3LA 3U5NA 4YAXA 5E9IA 4QSPA 4QR4A 5EISA 2RS9B 4QSVA 5E9LA 4YADA 3O34A 5ENBA 5C4QA 5ACYA 4LYWA 5E3GA 5EU1A 5FH7A 4O70A 4IR5A 5D3JA 4HXLA 5FE2A 5KTWA 5L8TA 4CUPA 5D3HA 2E7OA 5FE0A 4AKIA 1ZKRA 4GPJA 5A82A 3AADA 5L98A 5ENFA 4NRAA 4HXSA 4N4FA 5EWCA 5FH8A 5D7XA 5FDZA 4AKNA 4ZC9A 4NQNA 4NS5A 5E7DA 2RFJA 5EA1A 3U5MA 4O7CA 4HXNA 1JSPB 2YW5A 5D26A 4ALGA 2YEMA 5FE5A 4BW4A 4X2IA 4MENA 4LZSA 4LC2A 4MR5A 4QC3A 5KU3A 4LDFA 4OGJA 2KTBB 5A5RA 2WP1A 5A7CA 5E0RA 4A9JA 5IIDA 3G0JA 4TT6A 3D1BA 3FKMX 5A5SA 5A81A 2N9GA 5FE3A 4NYWA 5CQAA 4QC1A 4TYLA 1X0JA 4MEPA 4UITA 4UYFA 2DKWA 5A5OA 3AQAA 4BW1A 4QZSA 4YBMA 5HENA 4A9LA 1PUOA 5F60A 5DLXA 5I7YA 5C87A 2RNXA 4QB3A 5D25A 5HFRA 4Z1SA 5LVQA 4A9OA 5I80A 3S91A 5EP7A 5CTLA 1E6IA 3SVFA 4A9MA 3MUKA 4J0RA 4YK0A 3S92A 5A5NA 1WUMA 2NXBA 4UIYA 5H1TA 5KO4A 4OGIA 4NYVA 3QZTA 4N4GA 5ETBA 5FB0A 5F25A 2RI7A 4HBWA 4QR3A 3MULA 5DYAA 4AI6A 4QR5A 4UIWA 5J0DA 4QSXA 5EI4A 5FE8A 5H1UA 5HRWA 5KHMA 4XYAA 3U5OA 5C7NA 5EPSA 4O71A 5A5PA 5EV9A 2FSAA 4HXPA 5D3SA 2L84A 5HFQA 3UV2A 2GRCA 4HBYA 4NR4A 3U5PA 4XY9A 5EICA 4Z1QA 4LZRA 5CUBA 5I29A 5LJ1A 4YYNA 4CFLA 5IGMA 5LJ0A 4TU4A 4NR7A 2YELA 3O33A 2RNWA 2DVSA 4Q0OA 4ZQLA 1WUGA 4UYEA 3U5LA 4NR9A 5F36A 5BT3A 4CUSA 3GG3A 5FE6A 5CS8A 4J1PA 3DAIA 4BW2A 4NR6A 5CQ6A 3JVKA 3QZSA 3UVYA 5HQ7A 2MJVB 4NR8A 5DLZA 5DYCA 4QSWA 3DWYA 5E73A 5D3RA 5DYUA 3HMFA 5EWDA 5F1HA 3U5JA 4HBVA 5CQ7A 5CZGA 3ONIA 4C67A 5FE7A 4UIXA 4TS8A 4HXMA 4LYSA 4PS5A 4TU6A 5CUGA 4Z93A 3ERRA 3QZVA 5E9YA 4UYGA 5F62A 2R0VA 4TQNA 3Q2EA 5FG6A 4IR4A 4NYXA 5DFDA 4PKLA 2RNYA 4LRGA 5HRXA 4A9HA 5CUDA 5HLSA 3MB4A 5E9KA 3K2JA 4KV1A 2D9EA 4CLBA 4YYHA 5D3TA 5BT5A 2YEKA 5EQ1A 5L96A 4QSRA 5EWHA 5EM3A 3SVHA 5EK9A 3JVJA 5L97A 5BT4A 5FFWA 4O76A 5DKHA 5ENEA 4MEOA 1EQFA 3RCWA 2D82A 2EJNA 4YBTA 3P5OA 4AKGA 5AD3A 5DW1A 4LZ2A 2LSPB 5C85A 4YC9A 4NQMA 5L8UA 4NRBA 5II2A 2F6NA 4NXJA 4UYHA 4N4IA 4YBSA 4LR6A 1F68A 2OSSA 4PCEA 4OUFA 5FE4A 4BHWA 5K29A 4UYDA 2I8NA 3LJWA 3P1EA 4YYIA 5CQ8A 4TT4A 5CY9A 5IGNA 2H60A 5HJCA 5TCMA 4O77A 4WHUA 4HXOA 4QSSA 3MXFA 4BJXA 5C89A 4O7BA 5HELA 5EVAA 3MQMA 4PY6A 3UVXA 5A83A 2OO1A 3HMHA 4O7EA 4MR3A 5HQ6A 2WP2A 5IGKA 3P1DA 5HEMA 4Q0NA 4KV4A 5I1QA 4CL9A 4MR4A 4IR3A 3UVWA 4Y03A 4CUQA 4O7AA 5CQ5A 5D3PA 1ZS5A 5CP5A 4QBMA 3LQIA 4N4HA 3LQJA 5DX4A 5KTXA 5LKXA 3MB3A 3JVLA 5H85A 5CQ3A 5D3NA 4C66A 3O37A 4QYLA 5CUCA 4MR6A 5I83A 4E96A 4QEUA 4WHWA 4CUUA 4IOOA 5F3AA 5F5ZA 4Z6HA 2F6JA 4CFKA 4TT2A 4J3IA 2DVVA 5FE9A 5HM0A 4ALHA 5FB1A 3SVGA 2DWWA 4WIVA 5FE1A 4TTEA 4HBXA 4IOQA 5EPBA 4HXRA 4YYGA 2L85A 4QY4A 2E3KA 5JI8A 5ENHA 5A5QA 5H1VA 5DKDA 5HQ5A 5CPEA 1JM4B 4UIZA 5F63A 4PCIA 5EPRA 5EWWA 4MEQA 5CQTA 5IGLA 3JVMA 3UV4A 4NUCA 5ENCA 5II1A 5G4RA 3U5KA 2DVQA 2R0SA 5G4SA 5CFWA 1N72A 3P1CA 4UIVA 4QEVA 3LXJA 5D0CA 3P1FA 5ENJA 4O74A 4A9FA 4XUBA 5CU8A 3G0LA 4XY8A 5HRVA 5FH6A 5JWMA 5KTUA 4UIUA 4UYFB 4YH4A 3UVDA 2RO1A 5F61A 4YYDA 4QSQA 4LYIA 5CUAA 4YABA 4YH3A 5DKCA 2I7KA 3VKGA 2E7NA 4HXKA 5ENIA 4NUEA 5D24A 5F2PA 3O36A 5LJ2A 4O78A 5EWVA 5TB6A 2YDWA 5LKUA 5DYXA 5E9VA 4KCXA 4YYKA 4QUTA 5CQ4A 5I40A 3D1DA 4PTBA 4A9IA 5LKZA 5E9MA 5F1LA 2R10A 5IBNA 2R0YA 4TZ2A 3Q2FA 5DFBA
chains in the Genus database with same CATH topology
4O7FA 5FBXA 2YQDA 4TZ8A 4NR5A 4YYJA 5COIA 5AMFA 5CRMA 4CUTA 5DBMA 5CUEA 4YYMA 2DATA 4BW3A 5A85A 2G4AA 5DY7A 4YY6A 5LUUA 4NUDA 3ZYUA 3HMEA 4IORA 5FFVA 5L99A 5I86A 4QYDA 2YYNA 5FFYA 4ZW1A 5CRZA 4O75A 3LQHA 5I7XA 3I3JA 4DONA 4QSTA 4QNSA 4CURA 5C8GA 4J0SA 4A9KA 4Z6IA 5AD2A 3D7CA 4O72A 3O35A 4QSUA 4QUUA 3IU6A 5ETDA 4FLPA 5AMEA 5E3DA 4IR6A 5I89A 4NRCA 3UV5A 5DW2A 4XUAA 4A9NA 3UW9A 3NXBA 5IG6A 5LKTA 5EGUA 5E74A 5FG4A 4YY4A 2L5EA 4QEWA 5I88A 3TLPA 2DVRA 5ENGA 4N3WA 5CGPA 5FG5A 5DFCA 5HCLA 3IU5A 2OUOA 4F3IA 4YATA 4RVRA 5LVRA 4A9EA 5D3LA 3U5NA 4YAXA 5E9IA 4QSPA 4QR4A 5EISA 2RS9B 4QSVA 5E9LA 4YADA 3O34A 5ENBA 5C4QA 5ACYA 4LYWA 5E3GA 5EU1A 5FH7A 4O70A 4IR5A 5D3JA 4HXLA 5FE2A 5KTWA 5L8TA 4CUPA 5D3HA 2E7OA 5FE0A 4GPJA 5A82A 3AADA 5L98A 5ENFA 4NRAA 4HXSA 4N4FA 5EWCA 5FH8A 5D7XA 5FDZA 4AKNA 4ZC9A 4NQNA 4NS5A 5E7DA 2RFJA 5EA1A 3U5MA 4O7CA 4HXNA 1JSPB 2YW5A 5D26A 4ALGA 2YEMA 5FE5A 4BW4A 4X2IA 4MENA 4LZSA 4LC2A 4MR5A 4QC3A 5KU3A 4LDFA 4OGJA 2KTBB 5A5RA 2WP1A 5A7CA 5E0RA 4A9JA 5IIDA 3G0JA 4TT6A 3FKMX 5A5SA 5A81A 2N9GA 5FE3A 4NYWA 5CQAA 4QC1A 4TYLA 1X0JA 4MEPA 4UITA 4UYFA 2DKWA 5A5OA 3AQAA 4BW1A 4QZSA 4YBMA 5HENA 4A9LA 5F60A 5DLXA 5I7YA 5C87A 2RNXA 4QB3A 5D25A 5HFRA 4Z1SA 5LVQA 4A9OA 5I80A 3S91A 5EP7A 5CTLA 1E6IA 3SVFA 4A9MA 3MUKA 4J0RA 4YK0A 3S92A 5A5NA 1WUMA 2NXBA 4UIYA 5H1TA 5KO4A 4OGIA 4NYVA 3QZTA 4N4GA 5ETBA 5FB0A 5F25A 2RI7A 4HBWA 4QR3A 3MULA 5DYAA 4QR5A 4UIWA 5J0DA 4QSXA 5EI4A 5FE8A 5H1UA 5HRWA 5KHMA 4XYAA 3U5OA 5C7NA 5EPSA 4O71A 5A5PA 5EV9A 2FSAA 4HXPA 5D3SA 2L84A 5HFQA 3UV2A 2GRCA 4HBYA 4NR4A 3U5PA 4XY9A 5EICA 4Z1QA 4LZRA 5CUBA 5I29A 5LJ1A 4YYNA 4CFLA 5IGMA 5LJ0A 4TU4A 4NR7A 2YELA 3O33A 2RNWA 2DVSA 4Q0OA 4ZQLA 1WUGA 4UYEA 3U5LA 4NR9A 5F36A 5BT3A 4CUSA 3GG3A 5FE6A 5CS8A 4J1PA 3DAIA 4BW2A 4NR6A 5CQ6A 3JVKA 3QZSA 3UVYA 5HQ7A 2MJVB 4NR8A 5DLZA 5DYCA 4QSWA 3DWYA 5E73A 5D3RA 5DYUA 3HMFA 5EWDA 5F1HA 3U5JA 4HBVA 5CQ7A 5CZGA 3ONIA 4C67A 5FE7A 4UIXA 4TS8A 4HXMA 4LYSA 4PS5A 4TU6A 5CUGA 4Z93A 3QZVA 5E9YA 4UYGA 5F62A 2R0VA 4TQNA 3Q2EA 5FG6A 4IR4A 4NYXA 5DFDA 4PKLA 2RNYA 4LRGA 5HRXA 4A9HA 5CUDA 5HLSA 3MB4A 5E9KA 3K2JA 4KV1A 2D9EA 4CLBA 4YYHA 5D3TA 5BT5A 2YEKA 5EQ1A 5L96A 4QSRA 5EWHA 5EM3A 3SVHA 5EK9A 3JVJA 5L97A 5BT4A 5FFWA 4O76A 5DKHA 5ENEA 4MEOA 1EQFA 3RCWA 2D82A 4YBTA 3P5OA 5AD3A 5DW1A 4LZ2A 2LSPB 5C85A 4YC9A 4NQMA 5L8UA 4NRBA 5II2A 2F6NA 4NXJA 4UYHA 4N4IA 4YBSA 4LR6A 1F68A 2OSSA 4PCEA 4OUFA 5FE4A 4BHWA 5K29A 4UYDA 2I8NA 3LJWA 3P1EA 4YYIA 5CQ8A 4TT4A 5CY9A 5IGNA 2H60A 5HJCA 5TCMA 4O77A 4WHUA 4HXOA 4QSSA 3MXFA 4BJXA 5C89A 4O7BA 5HELA 5EVAA 3MQMA 4PY6A 3UVXA 5A83A 2OO1A 3HMHA 4O7EA 4MR3A 5HQ6A 2WP2A 5IGKA 3P1DA 5HEMA 4Q0NA 4KV4A 5I1QA 4CL9A 4MR4A 4IR3A 3UVWA 4Y03A 4CUQA 4O7AA 5CQ5A 5D3PA 1ZS5A 5CP5A 4QBMA 3LQIA 4N4HA 3LQJA 5DX4A 5KTXA 5LKXA 3MB3A 3JVLA 5H85A 5CQ3A 5D3NA 4C66A 3O37A 4QYLA 5CUCA 4MR6A 5I83A 4E96A 4QEUA 4WHWA 4CUUA 4IOOA 5F3AA 5F5ZA 4Z6HA 2F6JA 4CFKA 4TT2A 4J3IA 2DVVA 5FE9A 5HM0A 4ALHA 5FB1A 3SVGA 2DWWA 4WIVA 5FE1A 4TTEA 4HBXA 4IOQA 5EPBA 4HXRA 4YYGA 2L85A 4QY4A 2E3KA 5JI8A 5ENHA 5A5QA 5H1VA 5DKDA 5HQ5A 5CPEA 1JM4B 4UIZA 5F63A 4PCIA 5EPRA 5EWWA 4MEQA 5CQTA 5IGLA 3JVMA 3UV4A 4NUCA 5ENCA 5II1A 5G4RA 3U5KA 2DVQA 2R0SA 5G4SA 5CFWA 1N72A 3P1CA 4UIVA 4QEVA 3LXJA 5D0CA 3P1FA 5ENJA 4O74A 4A9FA 4XUBA 5CU8A 3G0LA 4XY8A 5HRVA 5FH6A 5JWMA 5KTUA 4UIUA 4UYFB 4YH4A 3UVDA 2RO1A 5F61A 4YYDA 4QSQA 4LYIA 5CUAA 4YABA 4YH3A 5DKCA 2I7KA 2E7NA 4HXKA 5ENIA 4NUEA 5D24A 5F2PA 3O36A 5LJ2A 4O78A 5EWVA 5TB6A 2YDWA 5LKUA 5DYXA 5E9VA 4KCXA 4YYKA 4QUTA 5CQ4A 5I40A 4PTBA 4A9IA 5LKZA 5E9MA 5F1LA 2R10A 5IBNA 2R0YA 4TZ2A 3Q2FA 5DFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7F A;  5FBX A;  2YQD A;  4TZ8 A;  4NR5 A;  4YYJ A;  5COI A;  5AMF A;  5CRM A;  4CUT A;  5DBM A;  5CUE A;  4YYM A;  2DAT A;  4BW3 A;  5A85 A;  2G4A A;  5DY7 A;  4YY6 A;  5LUU A;  4NUD A;  3ZYU A;  3HME A;  4IOR A;  5FFV A;  5L99 A;  5I86 A;  4QYD A;  2YYN A;  5FFY A;  4ZW1 A;  5CRZ A;  4O75 A;  3LQH A;  5I7X A;  3I3J A;  4DON A;  4QST A;  4QNS A;  4CUR A;  5C8G A;  4J0S A;  4A9K A;  4Z6I A;  5AD2 A;  3D7C A;  4O72 A;  3O35 A;  4QSU A;  4QUU A;  3IU6 A;  5ETD A;  4FLP A;  5AME A;  5E3D A;  4IR6 A;  5I89 A;  4NRC A;  3UV5 A;  5DW2 A;  4XUA A;  4A9N A;  3UW9 A;  3NXB A;  5IG6 A;  5LKT A;  5EGU A;  5E74 A;  5FG4 A;  4YY4 A;  2L5E A;  4QEW A;  5I88 A;  3TLP A;  2DVR A;  5ENG A;  4N3W A;  5CGP A;  5FG5 A;  5DFC A;  5HCL A;  3IU5 A;  2OUO A;  4F3I A;  4YAT A;  4RVR A;  5LVR A;  4A9E A;  5D3L A;  3U5N A;  4YAX A;  5E9I A;  4QSP A;  4QR4 A;  5EIS A;  2RS9 B;  4QSV A;  5E9L A;  4YAD A;  3O34 A;  5ENB A;  5C4Q A;  5ACY A;  4LYW A;  5E3G A;  5EU1 A;  5FH7 A;  4O70 A;  4IR5 A;  5D3J A;  4HXL A;  5FE2 A;  5KTW A;  5L8T A;  4CUP A;  5D3H A;  2E7O A;  5FE0 A;  4GPJ A;  5A82 A;  3AAD A;  5L98 A;  5ENF A;  4NRA A;  4HXS A;  4N4F A;  5EWC A;  5FH8 A;  5D7X A;  5FDZ A;  4AKN A;  4ZC9 A;  4NQN A;  4NS5 A;  5E7D A;  2RFJ A;  5EA1 A;  3U5M A;  4O7C A;  4HXN A;  1JSP B;  2YW5 A;  5D26 A;  4ALG A;  2YEM A;  5FE5 A;  4BW4 A;  4X2I A;  4MEN A;  4LZS A;  4LC2 A;  4MR5 A;  4QC3 A;  5KU3 A;  4LDF A;  4OGJ A;  2KTB B;  5A5R A;  2WP1 A;  5A7C A;  5E0R A;  4A9J A;  5IID A;  3G0J A;  4TT6 A;  3FKM X;  5A5S A;  5A81 A;  2N9G A;  5FE3 A;  4NYW A;  5CQA A;  4QC1 A;  4TYL A;  1X0J A;  4MEP A;  4UIT A;  4UYF A;  2DKW A;  5A5O A;  3AQA A;  4BW1 A;  4QZS A;  4YBM A;  5HEN A;  4A9L A;  5F60 A;  5DLX A;  5I7Y A;  5C87 A;  2RNX A;  4QB3 A;  5D25 A;  5HFR A;  4Z1S A;  5LVQ A;  4A9O A;  5I80 A;  3S91 A;  5EP7 A;  5CTL A;  1E6I A;  3SVF A;  4A9M A;  3MUK A;  4J0R A;  4YK0 A;  3S92 A;  5A5N A;  1WUM A;  2NXB A;  4UIY A;  5H1T A;  5KO4 A;  4OGI A;  4NYV A;  3QZT A;  4N4G A;  5ETB A;  5FB0 A;  5F25 A;  2RI7 A;  4HBW A;  4QR3 A;  3MUL A;  5DYA A;  4QR5 A;  4UIW A;  5J0D A;  4QSX A;  5EI4 A;  5FE8 A;  5H1U A;  5HRW A;  5KHM A;  4XYA A;  3U5O A;  5C7N A;  5EPS A;  4O71 A;  5A5P A;  5EV9 A;  2FSA A;  4HXP A;  5D3S A;  2L84 A;  5HFQ A;  3UV2 A;  2GRC A;  4HBY A;  4NR4 A;  3U5P A;  4XY9 A;  5EIC A;  4Z1Q A;  4LZR A;  5CUB A;  5I29 A;  5LJ1 A;  4YYN A;  4CFL A;  5IGM A;  5LJ0 A;  4TU4 A;  4NR7 A;  2YEL A;  3O33 A;  2RNW A;  2DVS A;  4Q0O A;  4ZQL A;  1WUG A;  4UYE A;  3U5L A;  4NR9 A;  5F36 A;  5BT3 A;  4CUS A;  3GG3 A;  5FE6 A;  5CS8 A;  4J1P A;  3DAI A;  4BW2 A;  4NR6 A;  5CQ6 A;  3JVK A;  3QZS A;  3UVY A;  5HQ7 A;  2MJV B;  4NR8 A;  5DLZ A;  5DYC A;  4QSW A;  3DWY A;  5E73 A;  5D3R A;  5DYU A;  3HMF A;  5EWD A;  5F1H A;  3U5J A;  4HBV A;  5CQ7 A;  5CZG A;  3ONI A;  4C67 A;  5FE7 A;  4UIX A;  4TS8 A;  4HXM A;  4LYS A;  4PS5 A;  4TU6 A;  5CUG A;  4Z93 A;  3QZV A;  5E9Y A;  4UYG A;  5F62 A;  2R0V A;  4TQN A;  3Q2E A;  5FG6 A;  4IR4 A;  4NYX A;  5DFD A;  4PKL A;  2RNY A;  4LRG A;  5HRX A;  4A9H A;  5CUD A;  5HLS A;  3MB4 A;  5E9K A;  3K2J A;  4KV1 A;  2D9E A;  4CLB A;  4YYH A;  5D3T A;  5BT5 A;  2YEK A;  5EQ1 A;  5L96 A;  4QSR A;  5EWH A;  5EM3 A;  3SVH A;  5EK9 A;  3JVJ A;  5L97 A;  5BT4 A;  5FFW A;  4O76 A;  5DKH A;  5ENE A;  4MEO A;  1EQF A;  3RCW A;  2D82 A;  4YBT A;  3P5O A;  5AD3 A;  5DW1 A;  4LZ2 A;  2LSP B;  5C85 A;  4YC9 A;  4NQM A;  5L8U A;  4NRB A;  5II2 A;  2F6N A;  4NXJ A;  4UYH A;  4N4I A;  4YBS A;  4LR6 A;  1F68 A;  2OSS A;  4PCE A;  4OUF A;  5FE4 A;  4BHW A;  5K29 A;  4UYD A;  2I8N A;  3LJW A;  3P1E A;  4YYI A;  5CQ8 A;  4TT4 A;  5CY9 A;  5IGN A;  2H60 A;  5HJC A;  5TCM A;  4O77 A;  4WHU A;  4HXO A;  4QSS A;  3MXF A;  4BJX A;  5C89 A;  4O7B A;  5HEL A;  5EVA A;  3MQM A;  4PY6 A;  3UVX A;  5A83 A;  2OO1 A;  3HMH A;  4O7E A;  4MR3 A;  5HQ6 A;  2WP2 A;  5IGK A;  3P1D A;  5HEM A;  4Q0N A;  4KV4 A;  5I1Q A;  4CL9 A;  4MR4 A;  4IR3 A;  3UVW A;  4Y03 A;  4CUQ A;  4O7A A;  5CQ5 A;  5D3P A;  1ZS5 A;  5CP5 A;  4QBM A;  3LQI A;  4N4H A;  3LQJ A;  5DX4 A;  5KTX A;  5LKX A;  3MB3 A;  3JVL A;  5H85 A;  5CQ3 A;  5D3N A;  4C66 A;  3O37 A;  4QYL A;  5CUC A;  4MR6 A;  5I83 A;  4E96 A;  4QEU A;  4WHW A;  4CUU A;  4IOO A;  5F3A A;  5F5Z A;  4Z6H A;  2F6J A;  4CFK A;  4TT2 A;  4J3I A;  2DVV A;  5FE9 A;  5HM0 A;  4ALH A;  5FB1 A;  3SVG A;  2DWW A;  4WIV A;  5FE1 A;  4TTE A;  4HBX A;  4IOQ A;  5EPB A;  4HXR A;  4YYG A;  2L85 A;  4QY4 A;  2E3K A;  5JI8 A;  5ENH A;  5A5Q A;  5H1V A;  5DKD A;  5HQ5 A;  5CPE A;  1JM4 B;  4UIZ A;  5F63 A;  4PCI A;  5EPR A;  5EWW A;  4MEQ A;  5CQT A;  5IGL A;  3JVM A;  3UV4 A;  4NUC A;  5ENC A;  5II1 A;  5G4R A;  3U5K A;  2DVQ A;  2R0S A;  5G4S A;  5CFW A;  1N72 A;  3P1C A;  4UIV A;  4QEV A;  3LXJ A;  5D0C A;  3P1F A;  5ENJ A;  4O74 A;  4A9F A;  4XUB A;  5CU8 A;  3G0L A;  4XY8 A;  5HRV A;  5FH6 A;  5JWM A;  5KTU A;  4UIU A;  4UYF B;  4YH4 A;  3UVD A;  2RO1 A;  5F61 A;  4YYD A;  4QSQ A;  4LYI A;  5CUA A;  4YAB A;  4YH3 A;  5DKC A;  2I7K A;  2E7N A;  4HXK A;  5ENI A;  4NUE A;  5D24 A;  5F2P A;  3O36 A;  5LJ2 A;  4O78 A;  5EWV A;  5TB6 A;  2YDW A;  5LKU A;  5DYX A;  5E9V A;  4KCX A;  4YYK A;  4QUT A;  5CQ4 A;  5I40 A;  4PTB A;  4A9I A;  5LKZ A;  5E9M A;  5F1L A;  2R10 A;  5IBN A;  2R0Y A;  4TZ2 A;  3Q2F A;  5DFB A; 
#chains in the Genus database with same CATH topology
 4O7F A;  5FBX A;  2YQD A;  4TZ8 A;  4NR5 A;  4YYJ A;  5COI A;  5AMF A;  5CRM A;  4CUT A;  5DBM A;  5CUE A;  4YYM A;  2DAT A;  4BW3 A;  5A85 A;  4AKH A;  2G4A A;  5DY7 A;  4YY6 A;  5LUU A;  4NUD A;  3ZYU A;  3HME A;  4IOR A;  5FFV A;  5L99 A;  5I86 A;  4QYD A;  2YYN A;  5FFY A;  4ZW1 A;  5CRZ A;  4O75 A;  3LQH A;  5I7X A;  3I3J A;  4DON A;  4QST A;  4QNS A;  4CUR A;  5C8G A;  4J0S A;  4A9K A;  4Z6I A;  5AD2 A;  3D7C A;  4O72 A;  3O35 A;  4QSU A;  4QUU A;  3IU6 A;  5ETD A;  4FLP A;  5AME A;  5E3D A;  4IR6 A;  5I89 A;  4NRC A;  3UV5 A;  3VKH A;  5DW2 A;  4XUA A;  4A9N A;  3UW9 A;  3NXB A;  5IG6 A;  5LKT A;  5EGU A;  5E74 A;  5FG4 A;  4YY4 A;  2L5E A;  4QEW A;  5I88 A;  3TLP A;  2DVR A;  5ENG A;  4N3W A;  5CGP A;  5FG5 A;  5DFC A;  5HCL A;  3IU5 A;  2OUO A;  4F3I A;  4YAT A;  4RVR A;  5LVR A;  4A9E A;  5D3L A;  3U5N A;  4YAX A;  5E9I A;  4QSP A;  4QR4 A;  5EIS A;  2RS9 B;  4QSV A;  5E9L A;  4YAD A;  3O34 A;  5ENB A;  5C4Q A;  5ACY A;  4LYW A;  5E3G A;  5EU1 A;  5FH7 A;  4O70 A;  4IR5 A;  5D3J A;  4HXL A;  5FE2 A;  5KTW A;  5L8T A;  4CUP A;  5D3H A;  2E7O A;  5FE0 A;  4AKI A;  1ZKR A;  4GPJ A;  5A82 A;  3AAD A;  5L98 A;  5ENF A;  4NRA A;  4HXS A;  4N4F A;  5EWC A;  5FH8 A;  5D7X A;  5FDZ A;  4AKN A;  4ZC9 A;  4NQN A;  4NS5 A;  5E7D A;  2RFJ A;  5EA1 A;  3U5M A;  4O7C A;  4HXN A;  1JSP B;  2YW5 A;  5D26 A;  4ALG A;  2YEM A;  5FE5 A;  4BW4 A;  4X2I A;  4MEN A;  4LZS A;  4LC2 A;  4MR5 A;  4QC3 A;  5KU3 A;  4LDF A;  4OGJ A;  2KTB B;  5A5R A;  2WP1 A;  5A7C A;  5E0R A;  4A9J A;  5IID A;  3G0J A;  4TT6 A;  3D1B A;  3FKM X;  5A5S A;  5A81 A;  2N9G A;  5FE3 A;  4NYW A;  5CQA A;  4QC1 A;  4TYL A;  1X0J A;  4MEP A;  4UIT A;  4UYF A;  2DKW A;  5A5O A;  3AQA A;  4BW1 A;  4QZS A;  4YBM A;  5HEN A;  4A9L A;  1PUO A;  5F60 A;  5DLX A;  5I7Y A;  5C87 A;  2RNX A;  4QB3 A;  5D25 A;  5HFR A;  4Z1S A;  5LVQ A;  4A9O A;  5I80 A;  3S91 A;  5EP7 A;  5CTL A;  1E6I A;  3SVF A;  4A9M A;  3MUK A;  4J0R A;  4YK0 A;  3S92 A;  5A5N A;  1WUM A;  2NXB A;  4UIY A;  5H1T A;  5KO4 A;  4OGI A;  4NYV A;  3QZT A;  4N4G A;  5ETB A;  5FB0 A;  5F25 A;  2RI7 A;  4HBW A;  4QR3 A;  3MUL A;  5DYA A;  4AI6 A;  4QR5 A;  4UIW A;  5J0D A;  4QSX A;  5EI4 A;  5FE8 A;  5H1U A;  5HRW A;  5KHM A;  4XYA A;  3U5O A;  5C7N A;  5EPS A;  4O71 A;  5A5P A;  5EV9 A;  2FSA A;  4HXP A;  5D3S A;  2L84 A;  5HFQ A;  3UV2 A;  2GRC A;  4HBY A;  4NR4 A;  3U5P A;  4XY9 A;  5EIC A;  4Z1Q A;  4LZR A;  5CUB A;  5I29 A;  5LJ1 A;  4YYN A;  4CFL A;  5IGM A;  5LJ0 A;  4TU4 A;  4NR7 A;  2YEL A;  3O33 A;  2RNW A;  2DVS A;  4Q0O A;  4ZQL A;  1WUG A;  4UYE A;  3U5L A;  4NR9 A;  5F36 A;  5BT3 A;  4CUS A;  3GG3 A;  5FE6 A;  5CS8 A;  4J1P A;  3DAI A;  4BW2 A;  4NR6 A;  5CQ6 A;  3JVK A;  3QZS A;  3UVY A;  5HQ7 A;  2MJV B;  4NR8 A;  5DLZ A;  5DYC A;  4QSW A;  3DWY A;  5E73 A;  5D3R A;  5DYU A;  3HMF A;  5EWD A;  5F1H A;  3U5J A;  4HBV A;  5CQ7 A;  5CZG A;  3ONI A;  4C67 A;  5FE7 A;  4UIX A;  4TS8 A;  4HXM A;  4LYS A;  4PS5 A;  4TU6 A;  5CUG A;  4Z93 A;  3ERR A;  3QZV A;  5E9Y A;  4UYG A;  5F62 A;  2R0V A;  4TQN A;  3Q2E A;  5FG6 A;  4IR4 A;  4NYX A;  5DFD A;  4PKL A;  2RNY A;  4LRG A;  5HRX A;  4A9H A;  5CUD A;  5HLS A;  3MB4 A;  5E9K A;  3K2J A;  4KV1 A;  2D9E A;  4CLB A;  4YYH A;  5D3T A;  5BT5 A;  2YEK A;  5EQ1 A;  5L96 A;  4QSR A;  5EWH A;  5EM3 A;  3SVH A;  5EK9 A;  3JVJ A;  5L97 A;  5BT4 A;  5FFW A;  4O76 A;  5DKH A;  5ENE A;  4MEO A;  1EQF A;  3RCW A;  2D82 A;  2EJN A;  4YBT A;  3P5O A;  4AKG A;  5AD3 A;  5DW1 A;  4LZ2 A;  2LSP B;  5C85 A;  4YC9 A;  4NQM A;  5L8U A;  4NRB A;  5II2 A;  2F6N A;  4NXJ A;  4UYH A;  4N4I A;  4YBS A;  4LR6 A;  1F68 A;  2OSS A;  4PCE A;  4OUF A;  5FE4 A;  4BHW A;  5K29 A;  4UYD A;  2I8N A;  3LJW A;  3P1E A;  4YYI A;  5CQ8 A;  4TT4 A;  5CY9 A;  5IGN A;  2H60 A;  5HJC A;  5TCM A;  4O77 A;  4WHU A;  4HXO A;  4QSS A;  3MXF A;  4BJX A;  5C89 A;  4O7B A;  5HEL A;  5EVA A;  3MQM A;  4PY6 A;  3UVX A;  5A83 A;  2OO1 A;  3HMH A;  4O7E A;  4MR3 A;  5HQ6 A;  2WP2 A;  5IGK A;  3P1D A;  5HEM A;  4Q0N A;  4KV4 A;  5I1Q A;  4CL9 A;  4MR4 A;  4IR3 A;  3UVW A;  4Y03 A;  4CUQ A;  4O7A A;  5CQ5 A;  5D3P A;  1ZS5 A;  5CP5 A;  4QBM A;  3LQI A;  4N4H A;  3LQJ A;  5DX4 A;  5KTX A;  5LKX A;  3MB3 A;  3JVL A;  5H85 A;  5CQ3 A;  5D3N A;  4C66 A;  3O37 A;  4QYL A;  5CUC A;  4MR6 A;  5I83 A;  4E96 A;  4QEU A;  4WHW A;  4CUU A;  4IOO A;  5F3A A;  5F5Z A;  4Z6H A;  2F6J A;  4CFK A;  4TT2 A;  4J3I A;  2DVV A;  5FE9 A;  5HM0 A;  4ALH A;  5FB1 A;  3SVG A;  2DWW A;  4WIV A;  5FE1 A;  4TTE A;  4HBX A;  4IOQ A;  5EPB A;  4HXR A;  4YYG A;  2L85 A;  4QY4 A;  2E3K A;  5JI8 A;  5ENH A;  5A5Q A;  5H1V A;  5DKD A;  5HQ5 A;  5CPE A;  1JM4 B;  4UIZ A;  5F63 A;  4PCI A;  5EPR A;  5EWW A;  4MEQ A;  5CQT A;  5IGL A;  3JVM A;  3UV4 A;  4NUC A;  5ENC A;  5II1 A;  5G4R A;  3U5K A;  2DVQ A;  2R0S A;  5G4S A;  5CFW A;  1N72 A;  3P1C A;  4UIV A;  4QEV A;  3LXJ A;  5D0C A;  3P1F A;  5ENJ A;  4O74 A;  4A9F A;  4XUB A;  5CU8 A;  3G0L A;  4XY8 A;  5HRV A;  5FH6 A;  5JWM A;  5KTU A;  4UIU A;  4UYF B;  4YH4 A;  3UVD A;  2RO1 A;  5F61 A;  4YYD A;  4QSQ A;  4LYI A;  5CUA A;  4YAB A;  4YH3 A;  5DKC A;  2I7K A;  3VKG A;  2E7N A;  4HXK A;  5ENI A;  4NUE A;  5D24 A;  5F2P A;  3O36 A;  5LJ2 A;  4O78 A;  5EWV A;  5TB6 A;  2YDW A;  5LKU A;  5DYX A;  5E9V A;  4KCX A;  4YYK A;  4QUT A;  5CQ4 A;  5I40 A;  3D1D A;  4PTB A;  4A9I A;  5LKZ A;  5E9M A;  5F1L A;  2R10 A;  5IBN A;  2R0Y A;  4TZ2 A;  3Q2F A;  5DFB A; 
#chains in the Genus database with same CATH homology
 4O7F A;  5FBX A;  2YQD A;  4TZ8 A;  4NR5 A;  4YYJ A;  5COI A;  5AMF A;  5CRM A;  4CUT A;  5DBM A;  5CUE A;  4YYM A;  2DAT A;  4BW3 A;  5A85 A;  2G4A A;  5DY7 A;  4YY6 A;  5LUU A;  4NUD A;  3ZYU A;  3HME A;  4IOR A;  5FFV A;  5L99 A;  5I86 A;  4QYD A;  2YYN A;  5FFY A;  4ZW1 A;  5CRZ A;  4O75 A;  3LQH A;  5I7X A;  3I3J A;  4DON A;  4QST A;  4QNS A;  4CUR A;  5C8G A;  4J0S A;  4A9K A;  4Z6I A;  5AD2 A;  3D7C A;  4O72 A;  3O35 A;  4QSU A;  4QUU A;  3IU6 A;  5ETD A;  4FLP A;  5AME A;  5E3D A;  4IR6 A;  5I89 A;  4NRC A;  3UV5 A;  5DW2 A;  4XUA A;  4A9N A;  3UW9 A;  3NXB A;  5IG6 A;  5LKT A;  5EGU A;  5E74 A;  5FG4 A;  4YY4 A;  2L5E A;  4QEW A;  5I88 A;  3TLP A;  2DVR A;  5ENG A;  4N3W A;  5CGP A;  5FG5 A;  5DFC A;  5HCL A;  3IU5 A;  2OUO A;  4F3I A;  4YAT A;  4RVR A;  5LVR A;  4A9E A;  5D3L A;  3U5N A;  4YAX A;  5E9I A;  4QSP A;  4QR4 A;  5EIS A;  2RS9 B;  4QSV A;  5E9L A;  4YAD A;  3O34 A;  5ENB A;  5C4Q A;  5ACY A;  4LYW A;  5E3G A;  5EU1 A;  5FH7 A;  4O70 A;  4IR5 A;  5D3J A;  4HXL A;  5FE2 A;  5KTW A;  5L8T A;  4CUP A;  5D3H A;  2E7O A;  5FE0 A;  4GPJ A;  5A82 A;  3AAD A;  5L98 A;  5ENF A;  4NRA A;  4HXS A;  4N4F A;  5EWC A;  5FH8 A;  5D7X A;  5FDZ A;  4AKN A;  4ZC9 A;  4NQN A;  4NS5 A;  5E7D A;  2RFJ A;  5EA1 A;  3U5M A;  4O7C A;  4HXN A;  1JSP B;  2YW5 A;  5D26 A;  4ALG A;  2YEM A;  5FE5 A;  4BW4 A;  4X2I A;  4MEN A;  4LZS A;  4LC2 A;  4MR5 A;  4QC3 A;  5KU3 A;  4LDF A;  4OGJ A;  2KTB B;  5A5R A;  2WP1 A;  5A7C A;  5E0R A;  4A9J A;  5IID A;  3G0J A;  4TT6 A;  3FKM X;  5A5S A;  5A81 A;  2N9G A;  5FE3 A;  4NYW A;  5CQA A;  4QC1 A;  4TYL A;  1X0J A;  4MEP A;  4UIT A;  4UYF A;  2DKW A;  5A5O A;  3AQA A;  4BW1 A;  4QZS A;  4YBM A;  5HEN A;  4A9L A;  5F60 A;  5DLX A;  5I7Y A;  5C87 A;  2RNX A;  4QB3 A;  5D25 A;  5HFR A;  4Z1S A;  5LVQ A;  4A9O A;  5I80 A;  3S91 A;  5EP7 A;  5CTL A;  1E6I A;  3SVF A;  4A9M A;  3MUK A;  4J0R A;  4YK0 A;  3S92 A;  5A5N A;  1WUM A;  2NXB A;  4UIY A;  5H1T A;  5KO4 A;  4OGI A;  4NYV A;  3QZT A;  4N4G A;  5ETB A;  5FB0 A;  5F25 A;  2RI7 A;  4HBW A;  4QR3 A;  3MUL A;  5DYA A;  4QR5 A;  4UIW A;  5J0D A;  4QSX A;  5EI4 A;  5FE8 A;  5H1U A;  5HRW A;  5KHM A;  4XYA A;  3U5O A;  5C7N A;  5EPS A;  4O71 A;  5A5P A;  5EV9 A;  2FSA A;  4HXP A;  5D3S A;  2L84 A;  5HFQ A;  3UV2 A;  2GRC A;  4HBY A;  4NR4 A;  3U5P A;  4XY9 A;  5EIC A;  4Z1Q A;  4LZR A;  5CUB A;  5I29 A;  5LJ1 A;  4YYN A;  4CFL A;  5IGM A;  5LJ0 A;  4TU4 A;  4NR7 A;  2YEL A;  3O33 A;  2RNW A;  2DVS A;  4Q0O A;  4ZQL A;  1WUG A;  4UYE A;  3U5L A;  4NR9 A;  5F36 A;  5BT3 A;  4CUS A;  3GG3 A;  5FE6 A;  5CS8 A;  4J1P A;  3DAI A;  4BW2 A;  4NR6 A;  5CQ6 A;  3JVK A;  3QZS A;  3UVY A;  5HQ7 A;  2MJV B;  4NR8 A;  5DLZ A;  5DYC A;  4QSW A;  3DWY A;  5E73 A;  5D3R A;  5DYU A;  3HMF A;  5EWD A;  5F1H A;  3U5J A;  4HBV A;  5CQ7 A;  5CZG A;  3ONI A;  4C67 A;  5FE7 A;  4UIX A;  4TS8 A;  4HXM A;  4LYS A;  4PS5 A;  4TU6 A;  5CUG A;  4Z93 A;  3QZV A;  5E9Y A;  4UYG A;  5F62 A;  2R0V A;  4TQN A;  3Q2E A;  5FG6 A;  4IR4 A;  4NYX A;  5DFD A;  4PKL A;  2RNY A;  4LRG A;  5HRX A;  4A9H A;  5CUD A;  5HLS A;  3MB4 A;  5E9K A;  3K2J A;  4KV1 A;  2D9E A;  4CLB A;  4YYH A;  5D3T A;  5BT5 A;  2YEK A;  5EQ1 A;  5L96 A;  4QSR A;  5EWH A;  5EM3 A;  3SVH A;  5EK9 A;  3JVJ A;  5L97 A;  5BT4 A;  5FFW A;  4O76 A;  5DKH A;  5ENE A;  4MEO A;  1EQF A;  3RCW A;  2D82 A;  4YBT A;  3P5O A;  5AD3 A;  5DW1 A;  4LZ2 A;  2LSP B;  5C85 A;  4YC9 A;  4NQM A;  5L8U A;  4NRB A;  5II2 A;  2F6N A;  4NXJ A;  4UYH A;  4N4I A;  4YBS A;  4LR6 A;  1F68 A;  2OSS A;  4PCE A;  4OUF A;  5FE4 A;  4BHW A;  5K29 A;  4UYD A;  2I8N A;  3LJW A;  3P1E A;  4YYI A;  5CQ8 A;  4TT4 A;  5CY9 A;  5IGN A;  2H60 A;  5HJC A;  5TCM A;  4O77 A;  4WHU A;  4HXO A;  4QSS A;  3MXF A;  4BJX A;  5C89 A;  4O7B A;  5HEL A;  5EVA A;  3MQM A;  4PY6 A;  3UVX A;  5A83 A;  2OO1 A;  3HMH A;  4O7E A;  4MR3 A;  5HQ6 A;  2WP2 A;  5IGK A;  3P1D A;  5HEM A;  4Q0N A;  4KV4 A;  5I1Q A;  4CL9 A;  4MR4 A;  4IR3 A;  3UVW A;  4Y03 A;  4CUQ A;  4O7A A;  5CQ5 A;  5D3P A;  1ZS5 A;  5CP5 A;  4QBM A;  3LQI A;  4N4H A;  3LQJ A;  5DX4 A;  5KTX A;  5LKX A;  3MB3 A;  3JVL A;  5H85 A;  5CQ3 A;  5D3N A;  4C66 A;  3O37 A;  4QYL A;  5CUC A;  4MR6 A;  5I83 A;  4E96 A;  4QEU A;  4WHW A;  4CUU A;  4IOO A;  5F3A A;  5F5Z A;  4Z6H A;  2F6J A;  4CFK A;  4TT2 A;  4J3I A;  2DVV A;  5FE9 A;  5HM0 A;  4ALH A;  5FB1 A;  3SVG A;  2DWW A;  4WIV A;  5FE1 A;  4TTE A;  4HBX A;  4IOQ A;  5EPB A;  4HXR A;  4YYG A;  2L85 A;  4QY4 A;  2E3K A;  5JI8 A;  5ENH A;  5A5Q A;  5H1V A;  5DKD A;  5HQ5 A;  5CPE A;  1JM4 B;  4UIZ A;  5F63 A;  4PCI A;  5EPR A;  5EWW A;  4MEQ A;  5CQT A;  5IGL A;  3JVM A;  3UV4 A;  4NUC A;  5ENC A;  5II1 A;  5G4R A;  3U5K A;  2DVQ A;  2R0S A;  5G4S A;  5CFW A;  1N72 A;  3P1C A;  4UIV A;  4QEV A;  3LXJ A;  5D0C A;  3P1F A;  5ENJ A;  4O74 A;  4A9F A;  4XUB A;  5CU8 A;  3G0L A;  4XY8 A;  5HRV A;  5FH6 A;  5JWM A;  5KTU A;  4UIU A;  4UYF B;  4YH4 A;  3UVD A;  2RO1 A;  5F61 A;  4YYD A;  4QSQ A;  4LYI A;  5CUA A;  4YAB A;  4YH3 A;  5DKC A;  2I7K A;  2E7N A;  4HXK A;  5ENI A;  4NUE A;  5D24 A;  5F2P A;  3O36 A;  5LJ2 A;  4O78 A;  5EWV A;  5TB6 A;  2YDW A;  5LKU A;  5DYX A;  5E9V A;  4KCX A;  4YYK A;  4QUT A;  5CQ4 A;  5I40 A;  4PTB A;  4A9I A;  5LKZ A;  5E9M A;  5F1L A;  2R10 A;  5IBN A;  2R0Y A;  4TZ2 A;  3Q2F A;  5DFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...