2R0SA

Crystal structure of the rsc4 tandem bromodomain
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
285
structure length
285
Chain Sequence
VDYNAPLNPKSELFLDDWHIPKFNRFISFTLDVLIDKYKDIFKDFIKLPSRKFHPQYYYKIQQPMSINEIKSRDYEYEDGPSNFLLDVELLTKNCQAYNEYDSLIVKNSMQVVMLIEFEVLKAKNLKRNYLINSEVKAKLLHYLNKLVDATEKKINQALLGASSPKNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFFPELQDLNERGEINLEFDKFEFENYLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin structure-remodeling complex protein RSC4
publication title Autoregulation of the rsc4 tandem bromodomain by gcn5 acetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 101
structure length 285
sequence length 285
ec nomenclature
pdb deposition date 2007-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r0sA01
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 2r0sA02
4QEVA 3UV5A 5CUBA 4ZQLA 4YYGA 5G4RA 4CUSA 4Q0NA 5DLZA 2DVQA 2RO1A 2I7KA 5A5QA 4O77A 5CQ4A 5L97A 4WIVA 4KCXA 4HXOA 4NYVA 2R0SA 5EPSA 4QY4A 3UV2A 3UVWA 4NR4A 5C87A 4C67A 3O33A 5HFRA 3Q2EA 3U5KA 5E9KA 4IR3A 2RNWA 5EGUA 4O7CA 4TZ8A 5I29A 4CFLA 4QSPA 3QZSA 2NXBA 4DONA 1EQFA 5G4SA 4O72A 5ENIA 5COIA 4AKNA 4UITA 3UW9A 5E3GA 5D3JA 5E9MA 5A5RA 3O35A 4Q0OA 4WHWA 5FBXA 4TT4A 4QSXA 1E6IA 4NR5A 5JI8A 2H60A 4UIZA 4O74A 4Z1SA 5LKZA 5EP7A 4KV1A 4YC9A 2LSPB 5H1VA 5LJ2A 5HJCA 4CFKA 5DYXA 5ENJA 4UIXA 4CUQA 4OGJA 5CY9A 5IG6A 5E0RA 5F3AA 3JVLA 4QSTA 5EVAA 3MXFA 2GRCA 5DKCA 5H85A 5LVRA 3G0JA 5DY7A 4TS8A 4A9KA 3TLPA 1JM4B 4YBMA 4NXJA 2L84A 4UYEA 4NR9A 2E7NA 3LQJA 5HCLA 5F36A 5IGNA 3ONIA 5CQ6A 4UIUA 5HRWA 2L85A 5F61A 3S92A 2KTBB 5I7YA 3UV4A 4QEWA 4HXRA 3GG3A 4QUUA 5CQ5A 3AQAA 4CUUA 3QZTA 5HM0A 4XUBA 5FE5A 4BHWA 4HXSA 2FSAA 3MB3A 5E7DA 5FG4A 4IOQA 5IGLA 5DX4A 2R0VA 3O36A 5FE3A 5HQ7A 5A85A 3FKMX 4O71A 5DYUA 4MR3A 4QNSA 2R10A 4HXLA 5AMFA 4HXPA 5LUUA 2DVRA 5A5SA 3SVFA 4NQMA 3DWYA 3O34A 4TQNA 4QYLA 5FDZA 5L8TA 5II2A 4NYXA 4QSSA 4O75A 5CP5A 4CUTA 4WHUA 5FFWA 4QR3A 5ENBA 1X0JA 5L8UA 5E3DA 5F63A 4OUFA 5D7XA 2RI7A 3Q2FA 2G4AA 4QC3A 5F62A 4YADA 5ENHA 3I3JA 2DATA 4LDFA 2L5EA 4NRAA 5F60A 5HELA 4CLBA 4F3IA 4A9HA 4LZRA 4A9FA 1WUGA 3LQIA 5L99A 4UYFA 4YBTA 5ENEA 4QEUA 5HQ5A 4HXMA 3U5NA 4UIYA 3HMFA 3D7CA 5HENA 2YELA 3QZVA 4TU6A 4QR5A 5I89A 4Y03A 5CQAA 5D3NA 4UIVA 4O7AA 3NXBA 4XUAA 5D25A 5CFWA 5HQ6A 5FH6A 5DFCA 4PKLA 3AADA 5FH8A 2RS9B 2OUOA 4BW2A 5L98A 4LRGA 4NRCA 4ALGA 5EV9A 5FE9A 4YBSA 5C85A 5I7XA 4O7FA 5I1QA 4N4GA 5LKTA 4LC2A 5FFYA 4QYDA 5D3TA 5I40A 4XY8A 4NS5A 3HMHA 5DW2A 5EU1A 5DLXA 2YDWA 5IIDA 5EA1A 5EWCA 4HBWA 4J1PA 5FB0A 2OSSA 5KTWA 4J0SA 4C66A 4CURA 4MENA 3DAIA 4O76A 2N9GA 5E9VA 5D3RA 4ZC9A 5CUAA 4YYHA 5EI4A 4BW1A 3MUKA 5EWDA 5CPEA 5EWHA 4MR6A 5KTUA 3U5PA 4Z6IA 3MQMA 4NUCA 5D26A 2DWWA 5KU3A 5DW1A 2E7OA 5D3HA 5DFBA 5E9LA 5D3PA 4QSQA 5CUEA 5BT5A 3K2JA 1F68A 4Z6HA 5FFVA 2F6NA 3U5MA 4IOOA 5FG6A 2WP2A 5FH7A 5DKDA 2OO1A 4TT2A 3UVYA 5FE0A 4QSRA 4KV4A 5CUCA 4E96A 5JWMA 3MB4A 5A5PA 5FE2A 5F1HA 4YYMA 4BJXA 2F6JA 5A5OA 4RVRA 4TYLA 4O7EA 2DVVA 5I86A 4QSWA 5LJ0A 5BT4A 3P1FA 5KHMA 3MULA 4NYWA 4O70A 4YH4A 2I8NA 2DKWA 4ALHA 5TCMA 4N4FA 4IORA 5I88A 4LYSA 3SVHA 5AD3A 4YY6A 4X2IA 4TU4A 5CRMA 5IBNA 5ENFA 3LXJA 4HXNA 3P1DA 5HEMA 4OGIA 5EPRA 5K29A 5KO4A 5AMEA 3O37A 5ACYA 5I83A 5AD2A 3U5LA 5CQTA 5D24A 5HRXA 2YEKA 3P1CA 5ETBA 5HLSA 5LJ1A 5J0DA 4YYKA 4PS5A 2RNYA 4A9JA 4A9IA 5DKHA 5A82A 4NUDA 4XY9A 3ZYUA 4UYDA 5CQ8A 5D3SA 4FLPA 4UYHA 5D3LA 3P5OA 4QSVA 4UYGA 3RCWA 2RNXA 4YAXA 3IU5A 5LKXA 5CQ3A 4HBXA 3SVGA 4MR5A 5CU8A 5F2PA 5EISA 4NR7A 3IU6A 2YW5A 5FE1A 4IR4A 4YABA 5H1TA 4TT6A 3U5OA 5FE6A 3P1EA 5HFQA 5F1LA 4YK0A 5EWVA 4IR5A 5E74A 4QBMA 5CS8A 5A7CA 4GPJA 4MEPA 5DFDA 5CGPA 3UVXA 5I80A 4HBYA 5IGKA 5DYAA 4BW4A 2YQDA 3UVDA 4QSUA 5E9YA 5EM3A 3JVJA 3LJWA 4QUTA 4N4HA 4YYJA 2MJVB 4QC1A 4XYAA 5ENGA 2DVSA 4TTEA 5FE7A 1ZS5A 3G0LA 5A81A 5CQ7A 4MEOA 4A9EA 4A9OA 5C8GA 5A5NA 4UIWA 4YATA 4LYWA 4N4IA 5CTLA 4Z93A 5FB1A 5CZGA 4PTBA 5FE8A 5C7NA 4MR4A 4YY4A 4CUPA 5CRZA 4PY6A 4NR6A 5F5ZA 5EICA 4Z1QA 1JSPB 5L96A 4A9MA 2RFJA 5CUDA 1N72A 4NUEA 4O7BA 4J0RA 4IR6A 4PCIA 5KTXA 5LVQA 2D82A 4QR4A 5FE4A 2D9EA 4NR8A 5EPBA 5E73A 5BT3A 3S91A 4NQNA 5C4QA 5F25A 4A9LA 2E3KA 5EQ1A 5H1UA 5C89A 5EWWA 4HBVA 4TZ2A 5II1A 3U5JA 4A9NA 4LZSA 4NRBA 5DBMA 5DYCA 4ZW1A 4YYIA 4LR6A 3LQHA 4O78A 4CL9A 4YYNA 5D0CA 5FG5A 2WP1A 5TB6A 3HMEA 5ENCA 4BW3A 4YYDA 2R0YA 4PCEA 4HXKA 4QB3A 4LYIA 2YEMA 4J3IA 2YYNA 4YH3A 5EK9A 3JVMA 5ETDA 4QZSA 1WUMA 5CUGA 5E9IA 4MEQA 5A83A 5LKUA 4UYFB 5HRVA 5IGMA 3JVKA 4LZ2A 4N3WA
chains in the Genus database with same CATH superfamily
4QEVA 3UV5A 5CUBA 4ZQLA 4YYGA 5G4RA 4CUSA 4Q0NA 5DLZA 2DVQA 2RO1A 2I7KA 5A5QA 4O77A 5CQ4A 5L97A 4WIVA 4KCXA 4HXOA 4NYVA 2R0SA 5EPSA 4QY4A 3UV2A 3UVWA 4NR4A 5C87A 4C67A 3O33A 5HFRA 3Q2EA 3U5KA 5E9KA 4IR3A 2RNWA 5EGUA 4O7CA 4TZ8A 5I29A 4CFLA 4QSPA 3QZSA 2NXBA 4DONA 1EQFA 5G4SA 4O72A 5ENIA 5COIA 4AKNA 3D1BA 4UITA 3UW9A 5E3GA 4AKIA 5D3JA 5E9MA 5A5RA 3O35A 4Q0OA 4WHWA 5FBXA 4TT4A 4QSXA 1E6IA 4NR5A 5JI8A 2H60A 4UIZA 4O74A 4Z1SA 5LKZA 5EP7A 4KV1A 4YC9A 2LSPB 5H1VA 5LJ2A 5HJCA 4CFKA 5DYXA 5ENJA 4UIXA 4CUQA 4OGJA 5CY9A 5IG6A 5E0RA 5F3AA 3JVLA 4QSTA 5EVAA 3MXFA 2GRCA 5DKCA 5H85A 5LVRA 3G0JA 5DY7A 4TS8A 4A9KA 3TLPA 1JM4B 4YBMA 4NXJA 2L84A 4UYEA 4NR9A 2E7NA 3LQJA 5HCLA 5F36A 5IGNA 3ONIA 4AI6A 5CQ6A 4UIUA 5HRWA 2L85A 5F61A 3S92A 2KTBB 5I7YA 3UV4A 4QEWA 4HXRA 3GG3A 4QUUA 5CQ5A 3AQAA 4CUUA 3QZTA 5HM0A 4XUBA 3VKHA 5FE5A 4BHWA 4HXSA 2FSAA 3MB3A 5E7DA 5FG4A 4IOQA 5IGLA 5DX4A 2R0VA 3O36A 5FE3A 4AKHA 5HQ7A 5A85A 3FKMX 4O71A 5DYUA 4MR3A 4QNSA 2R10A 4HXLA 5AMFA 4HXPA 5LUUA 2DVRA 5A5SA 3SVFA 4NQMA 3DWYA 3O34A 4TQNA 4QYLA 5FDZA 5L8TA 5II2A 4NYXA 4QSSA 4O75A 5CP5A 4CUTA 4WHUA 5FFWA 4QR3A 5ENBA 1X0JA 5L8UA 5E3DA 5F63A 4OUFA 5D7XA 2RI7A 3Q2FA 2G4AA 4QC3A 5F62A 4YADA 5ENHA 3I3JA 2DATA 4LDFA 2L5EA 4NRAA 5F60A 5HELA 4CLBA 4F3IA 4A9HA 3VKGA 4LZRA 4A9FA 1WUGA 3LQIA 5L99A 4UYFA 4YBTA 5ENEA 4QEUA 5HQ5A 4HXMA 3U5NA 4UIYA 3HMFA 3D7CA 5HENA 3ERRA 2YELA 3QZVA 4TU6A 4QR5A 5I89A 4Y03A 5CQAA 5D3NA 4UIVA 4O7AA 3NXBA 4XUAA 5D25A 5CFWA 5HQ6A 5FH6A 5DFCA 4PKLA 3AADA 5FH8A 2RS9B 2OUOA 4BW2A 5L98A 4LRGA 4NRCA 4ALGA 5EV9A 5FE9A 4YBSA 5C85A 5I7XA 4O7FA 5I1QA 4N4GA 5LKTA 4LC2A 2EJNA 5FFYA 4QYDA 5D3TA 5I40A 4XY8A 4NS5A 3HMHA 5DW2A 5EU1A 5DLXA 1PUOA 2YDWA 5IIDA 5EA1A 1ZKRA 5EWCA 4HBWA 4J1PA 5FB0A 2OSSA 5KTWA 4J0SA 4C66A 4CURA 4MENA 4AKGA 3DAIA 4O76A 2N9GA 5E9VA 5D3RA 4ZC9A 5CUAA 4YYHA 5EI4A 4BW1A 3MUKA 5EWDA 5CPEA 5EWHA 4MR6A 5KTUA 3U5PA 4Z6IA 3MQMA 4NUCA 5D26A 2DWWA 5KU3A 5DW1A 2E7OA 5D3HA 5DFBA 5E9LA 5D3PA 4QSQA 5CUEA 5BT5A 3K2JA 1F68A 4Z6HA 5FFVA 3D1DA 2F6NA 3U5MA 4IOOA 5FG6A 2WP2A 5FH7A 5DKDA 2OO1A 4TT2A 3UVYA 5FE0A 4QSRA 4KV4A 5CUCA 4E96A 5JWMA 3MB4A 5A5PA 5FE2A 5F1HA 4YYMA 4BJXA 2F6JA 5A5OA 4RVRA 4TYLA 4O7EA 2DVVA 5I86A 4QSWA 5LJ0A 5BT4A 3P1FA 5KHMA 3MULA 4NYWA 4O70A 4YH4A 2I8NA 2DKWA 4ALHA 5TCMA 4N4FA 4IORA 5I88A 4LYSA 3SVHA 5AD3A 4YY6A 4X2IA 4TU4A 5CRMA 5IBNA 5ENFA 3LXJA 4HXNA 3P1DA 5HEMA 4OGIA 5EPRA 5K29A 5KO4A 5AMEA 3O37A 5ACYA 5I83A 5AD2A 3U5LA 5CQTA 5D24A 5HRXA 2YEKA 3P1CA 5ETBA 5HLSA 5LJ1A 5J0DA 4YYKA 4PS5A 2RNYA 4A9JA 4A9IA 5DKHA 5A82A 4NUDA 4XY9A 3ZYUA 4UYDA 5CQ8A 5D3SA 4FLPA 4UYHA 5D3LA 3P5OA 4QSVA 4UYGA 3RCWA 2RNXA 4YAXA 3IU5A 5LKXA 5CQ3A 4HBXA 3SVGA 4MR5A 5CU8A 5F2PA 5EISA 4NR7A 3IU6A 2YW5A 5FE1A 4IR4A 4YABA 5H1TA 4TT6A 3U5OA 5FE6A 3P1EA 5HFQA 5F1LA 4YK0A 5EWVA 4IR5A 5E74A 4QBMA 5CS8A 5A7CA 4GPJA 4MEPA 5DFDA 5CGPA 3UVXA 5I80A 4HBYA 5IGKA 5DYAA 4BW4A 2YQDA 3UVDA 4QSUA 5E9YA 5EM3A 3JVJA 3LJWA 4QUTA 4N4HA 4YYJA 2MJVB 4QC1A 4XYAA 5ENGA 2DVSA 4TTEA 5FE7A 1ZS5A 3G0LA 5A81A 5CQ7A 4MEOA 4A9EA 4A9OA 5C8GA 5A5NA 4UIWA 4YATA 4LYWA 4N4IA 5CTLA 4Z93A 5FB1A 5CZGA 4PTBA 5FE8A 5C7NA 4MR4A 4YY4A 4CUPA 5CRZA 4PY6A 4NR6A 5F5ZA 5EICA 4Z1QA 1JSPB 5L96A 4A9MA 2RFJA 5CUDA 1N72A 4NUEA 4O7BA 4J0RA 4IR6A 4PCIA 5KTXA 5LVQA 2D82A 4QR4A 5FE4A 2D9EA 4NR8A 5EPBA 5E73A 5BT3A 3S91A 4NQNA 5C4QA 5F25A 4A9LA 2E3KA 5EQ1A 5H1UA 5C89A 5EWWA 4HBVA 4TZ2A 5II1A 3U5JA 4A9NA 4LZSA 4NRBA 5DBMA 5DYCA 4ZW1A 4YYIA 4LR6A 3LQHA 4O78A 4CL9A 4YYNA 5D0CA 5FG5A 2WP1A 5TB6A 3HMEA 5ENCA 4BW3A 4YYDA 2R0YA 4PCEA 4HXKA 4QB3A 4LYIA 2YEMA 4J3IA 2YYNA 4YH3A 5EK9A 3JVMA 5ETDA 4QZSA 1WUMA 5CUGA 5E9IA 4MEQA 5A83A 5LKUA 4UYFB 5HRVA 5IGMA 3JVKA 4LZ2A 4N3WA
chains in the Genus database with same CATH topology
4QEVA 3UV5A 5CUBA 4ZQLA 4YYGA 5G4RA 4CUSA 4Q0NA 5DLZA 2DVQA 2RO1A 2I7KA 5A5QA 4O77A 5CQ4A 5L97A 4WIVA 4KCXA 4HXOA 4NYVA 2R0SA 5EPSA 4QY4A 3UV2A 3UVWA 4NR4A 5C87A 4C67A 3O33A 5HFRA 3Q2EA 3U5KA 5E9KA 4IR3A 2RNWA 5EGUA 4O7CA 4TZ8A 5I29A 4CFLA 4QSPA 3QZSA 2NXBA 4DONA 1EQFA 5G4SA 4O72A 5ENIA 5COIA 4AKNA 4UITA 3UW9A 5E3GA 5D3JA 5E9MA 5A5RA 3O35A 4Q0OA 4WHWA 5FBXA 4TT4A 4QSXA 1E6IA 4NR5A 5JI8A 2H60A 4UIZA 4O74A 4Z1SA 5LKZA 5EP7A 4KV1A 4YC9A 2LSPB 5H1VA 5LJ2A 5HJCA 4CFKA 5DYXA 5ENJA 4UIXA 4CUQA 4OGJA 5CY9A 5IG6A 5E0RA 5F3AA 3JVLA 4QSTA 5EVAA 3MXFA 2GRCA 5DKCA 5H85A 5LVRA 3G0JA 5DY7A 4TS8A 4A9KA 3TLPA 1JM4B 4YBMA 4NXJA 2L84A 4UYEA 4NR9A 2E7NA 3LQJA 5HCLA 5F36A 5IGNA 3ONIA 5CQ6A 4UIUA 5HRWA 2L85A 5F61A 3S92A 2KTBB 5I7YA 3UV4A 4QEWA 4HXRA 3GG3A 4QUUA 5CQ5A 3AQAA 4CUUA 3QZTA 5HM0A 4XUBA 5FE5A 4BHWA 4HXSA 2FSAA 3MB3A 5E7DA 5FG4A 4IOQA 5IGLA 5DX4A 2R0VA 3O36A 5FE3A 5HQ7A 5A85A 3FKMX 4O71A 5DYUA 4MR3A 4QNSA 2R10A 4HXLA 5AMFA 4HXPA 5LUUA 2DVRA 5A5SA 3SVFA 4NQMA 3DWYA 3O34A 4TQNA 4QYLA 5FDZA 5L8TA 5II2A 4NYXA 4QSSA 4O75A 5CP5A 4CUTA 4WHUA 5FFWA 4QR3A 5ENBA 1X0JA 5L8UA 5E3DA 5F63A 4OUFA 5D7XA 2RI7A 3Q2FA 2G4AA 4QC3A 5F62A 4YADA 5ENHA 3I3JA 2DATA 4LDFA 2L5EA 4NRAA 5F60A 5HELA 4CLBA 4F3IA 4A9HA 4LZRA 4A9FA 1WUGA 3LQIA 5L99A 4UYFA 4YBTA 5ENEA 4QEUA 5HQ5A 4HXMA 3U5NA 4UIYA 3HMFA 3D7CA 5HENA 2YELA 3QZVA 4TU6A 4QR5A 5I89A 4Y03A 5CQAA 5D3NA 4UIVA 4O7AA 3NXBA 4XUAA 5D25A 5CFWA 5HQ6A 5FH6A 5DFCA 4PKLA 3AADA 5FH8A 2RS9B 2OUOA 4BW2A 5L98A 4LRGA 4NRCA 4ALGA 5EV9A 5FE9A 4YBSA 5C85A 5I7XA 4O7FA 5I1QA 4N4GA 5LKTA 4LC2A 5FFYA 4QYDA 5D3TA 5I40A 4XY8A 4NS5A 3HMHA 5DW2A 5EU1A 5DLXA 2YDWA 5IIDA 5EA1A 5EWCA 4HBWA 4J1PA 5FB0A 2OSSA 5KTWA 4J0SA 4C66A 4CURA 4MENA 3DAIA 4O76A 2N9GA 5E9VA 5D3RA 4ZC9A 5CUAA 4YYHA 5EI4A 4BW1A 3MUKA 5EWDA 5CPEA 5EWHA 4MR6A 5KTUA 3U5PA 4Z6IA 3MQMA 4NUCA 5D26A 2DWWA 5KU3A 5DW1A 2E7OA 5D3HA 5DFBA 5E9LA 5D3PA 4QSQA 5CUEA 5BT5A 3K2JA 1F68A 4Z6HA 5FFVA 2F6NA 3U5MA 4IOOA 5FG6A 2WP2A 5FH7A 5DKDA 2OO1A 4TT2A 3UVYA 5FE0A 4QSRA 4KV4A 5CUCA 4E96A 5JWMA 3MB4A 5A5PA 5FE2A 5F1HA 4YYMA 4BJXA 2F6JA 5A5OA 4RVRA 4TYLA 4O7EA 2DVVA 5I86A 4QSWA 5LJ0A 5BT4A 3P1FA 5KHMA 3MULA 4NYWA 4O70A 4YH4A 2I8NA 2DKWA 4ALHA 5TCMA 4N4FA 4IORA 5I88A 4LYSA 3SVHA 5AD3A 4YY6A 4X2IA 4TU4A 5CRMA 5IBNA 5ENFA 3LXJA 4HXNA 3P1DA 5HEMA 4OGIA 5EPRA 5K29A 5KO4A 5AMEA 3O37A 5ACYA 5I83A 5AD2A 3U5LA 5CQTA 5D24A 5HRXA 2YEKA 3P1CA 5ETBA 5HLSA 5LJ1A 5J0DA 4YYKA 4PS5A 2RNYA 4A9JA 4A9IA 5DKHA 5A82A 4NUDA 4XY9A 3ZYUA 4UYDA 5CQ8A 5D3SA 4FLPA 4UYHA 5D3LA 3P5OA 4QSVA 4UYGA 3RCWA 2RNXA 4YAXA 3IU5A 5LKXA 5CQ3A 4HBXA 3SVGA 4MR5A 5CU8A 5F2PA 5EISA 4NR7A 3IU6A 2YW5A 5FE1A 4IR4A 4YABA 5H1TA 4TT6A 3U5OA 5FE6A 3P1EA 5HFQA 5F1LA 4YK0A 5EWVA 4IR5A 5E74A 4QBMA 5CS8A 5A7CA 4GPJA 4MEPA 5DFDA 5CGPA 3UVXA 5I80A 4HBYA 5IGKA 5DYAA 4BW4A 2YQDA 3UVDA 4QSUA 5E9YA 5EM3A 3JVJA 3LJWA 4QUTA 4N4HA 4YYJA 2MJVB 4QC1A 4XYAA 5ENGA 2DVSA 4TTEA 5FE7A 1ZS5A 3G0LA 5A81A 5CQ7A 4MEOA 4A9EA 4A9OA 5C8GA 5A5NA 4UIWA 4YATA 4LYWA 4N4IA 5CTLA 4Z93A 5FB1A 5CZGA 4PTBA 5FE8A 5C7NA 4MR4A 4YY4A 4CUPA 5CRZA 4PY6A 4NR6A 5F5ZA 5EICA 4Z1QA 1JSPB 5L96A 4A9MA 2RFJA 5CUDA 1N72A 4NUEA 4O7BA 4J0RA 4IR6A 4PCIA 5KTXA 5LVQA 2D82A 4QR4A 5FE4A 2D9EA 4NR8A 5EPBA 5E73A 5BT3A 3S91A 4NQNA 5C4QA 5F25A 4A9LA 2E3KA 5EQ1A 5H1UA 5C89A 5EWWA 4HBVA 4TZ2A 5II1A 3U5JA 4A9NA 4LZSA 4NRBA 5DBMA 5DYCA 4ZW1A 4YYIA 4LR6A 3LQHA 4O78A 4CL9A 4YYNA 5D0CA 5FG5A 2WP1A 5TB6A 3HMEA 5ENCA 4BW3A 4YYDA 2R0YA 4PCEA 4HXKA 4QB3A 4LYIA 2YEMA 4J3IA 2YYNA 4YH3A 5EK9A 3JVMA 5ETDA 4QZSA 1WUMA 5CUGA 5E9IA 4MEQA 5A83A 5LKUA 4UYFB 5HRVA 5IGMA 3JVKA 4LZ2A 4N3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QEV A;  3UV5 A;  5CUB A;  4ZQL A;  4YYG A;  5G4R A;  4CUS A;  4Q0N A;  5DLZ A;  2DVQ A;  2RO1 A;  2I7K A;  5A5Q A;  4O77 A;  5CQ4 A;  5L97 A;  4WIV A;  4KCX A;  4HXO A;  4NYV A;  2R0S A;  5EPS A;  4QY4 A;  3UV2 A;  3UVW A;  4NR4 A;  5C87 A;  4C67 A;  3O33 A;  5HFR A;  3Q2E A;  3U5K A;  5E9K A;  4IR3 A;  2RNW A;  5EGU A;  4O7C A;  4TZ8 A;  5I29 A;  4CFL A;  4QSP A;  3QZS A;  2NXB A;  4DON A;  1EQF A;  5G4S A;  4O72 A;  5ENI A;  5COI A;  4AKN A;  4UIT A;  3UW9 A;  5E3G A;  5D3J A;  5E9M A;  5A5R A;  3O35 A;  4Q0O A;  4WHW A;  5FBX A;  4TT4 A;  4QSX A;  1E6I A;  4NR5 A;  5JI8 A;  2H60 A;  4UIZ A;  4O74 A;  4Z1S A;  5LKZ A;  5EP7 A;  4KV1 A;  4YC9 A;  2LSP B;  5H1V A;  5LJ2 A;  5HJC A;  4CFK A;  5DYX A;  5ENJ A;  4UIX A;  4CUQ A;  4OGJ A;  5CY9 A;  5IG6 A;  5E0R A;  5F3A A;  3JVL A;  4QST A;  5EVA A;  3MXF A;  2GRC A;  5DKC A;  5H85 A;  5LVR A;  3G0J A;  5DY7 A;  4TS8 A;  4A9K A;  3TLP A;  1JM4 B;  4YBM A;  4NXJ A;  2L84 A;  4UYE A;  4NR9 A;  2E7N A;  3LQJ A;  5HCL A;  5F36 A;  5IGN A;  3ONI A;  5CQ6 A;  4UIU A;  5HRW A;  2L85 A;  5F61 A;  3S92 A;  2KTB B;  5I7Y A;  3UV4 A;  4QEW A;  4HXR A;  3GG3 A;  4QUU A;  5CQ5 A;  3AQA A;  4CUU A;  3QZT A;  5HM0 A;  4XUB A;  5FE5 A;  4BHW A;  4HXS A;  2FSA A;  3MB3 A;  5E7D A;  5FG4 A;  4IOQ A;  5IGL A;  5DX4 A;  2R0V A;  3O36 A;  5FE3 A;  5HQ7 A;  5A85 A;  3FKM X;  4O71 A;  5DYU A;  4MR3 A;  4QNS A;  2R10 A;  4HXL A;  5AMF A;  4HXP A;  5LUU A;  2DVR A;  5A5S A;  3SVF A;  4NQM A;  3DWY A;  3O34 A;  4TQN A;  4QYL A;  5FDZ A;  5L8T A;  5II2 A;  4NYX A;  4QSS A;  4O75 A;  5CP5 A;  4CUT A;  4WHU A;  5FFW A;  4QR3 A;  5ENB A;  1X0J A;  5L8U A;  5E3D A;  5F63 A;  4OUF A;  5D7X A;  2RI7 A;  3Q2F A;  2G4A A;  4QC3 A;  5F62 A;  4YAD A;  5ENH A;  3I3J A;  2DAT A;  4LDF A;  2L5E A;  4NRA A;  5F60 A;  5HEL A;  4CLB A;  4F3I A;  4A9H A;  4LZR A;  4A9F A;  1WUG A;  3LQI A;  5L99 A;  4UYF A;  4YBT A;  5ENE A;  4QEU A;  5HQ5 A;  4HXM A;  3U5N A;  4UIY A;  3HMF A;  3D7C A;  5HEN A;  2YEL A;  3QZV A;  4TU6 A;  4QR5 A;  5I89 A;  4Y03 A;  5CQA A;  5D3N A;  4UIV A;  4O7A A;  3NXB A;  4XUA A;  5D25 A;  5CFW A;  5HQ6 A;  5FH6 A;  5DFC A;  4PKL A;  3AAD A;  5FH8 A;  2RS9 B;  2OUO A;  4BW2 A;  5L98 A;  4LRG A;  4NRC A;  4ALG A;  5EV9 A;  5FE9 A;  4YBS A;  5C85 A;  5I7X A;  4O7F A;  5I1Q A;  4N4G A;  5LKT A;  4LC2 A;  5FFY A;  4QYD A;  5D3T A;  5I40 A;  4XY8 A;  4NS5 A;  3HMH A;  5DW2 A;  5EU1 A;  5DLX A;  2YDW A;  5IID A;  5EA1 A;  5EWC A;  4HBW A;  4J1P A;  5FB0 A;  2OSS A;  5KTW A;  4J0S A;  4C66 A;  4CUR A;  4MEN A;  3DAI A;  4O76 A;  2N9G A;  5E9V A;  5D3R A;  4ZC9 A;  5CUA A;  4YYH A;  5EI4 A;  4BW1 A;  3MUK A;  5EWD A;  5CPE A;  5EWH A;  4MR6 A;  5KTU A;  3U5P A;  4Z6I A;  3MQM A;  4NUC A;  5D26 A;  2DWW A;  5KU3 A;  5DW1 A;  2E7O A;  5D3H A;  5DFB A;  5E9L A;  5D3P A;  4QSQ A;  5CUE A;  5BT5 A;  3K2J A;  1F68 A;  4Z6H A;  5FFV A;  2F6N A;  3U5M A;  4IOO A;  5FG6 A;  2WP2 A;  5FH7 A;  5DKD A;  2OO1 A;  4TT2 A;  3UVY A;  5FE0 A;  4QSR A;  4KV4 A;  5CUC A;  4E96 A;  5JWM A;  3MB4 A;  5A5P A;  5FE2 A;  5F1H A;  4YYM A;  4BJX A;  2F6J A;  5A5O A;  4RVR A;  4TYL A;  4O7E A;  2DVV A;  5I86 A;  4QSW A;  5LJ0 A;  5BT4 A;  3P1F A;  5KHM A;  3MUL A;  4NYW A;  4O70 A;  4YH4 A;  2I8N A;  2DKW A;  4ALH A;  5TCM A;  4N4F A;  4IOR A;  5I88 A;  4LYS A;  3SVH A;  5AD3 A;  4YY6 A;  4X2I A;  4TU4 A;  5CRM A;  5IBN A;  5ENF A;  3LXJ A;  4HXN A;  3P1D A;  5HEM A;  4OGI A;  5EPR A;  5K29 A;  5KO4 A;  5AME A;  3O37 A;  5ACY A;  5I83 A;  5AD2 A;  3U5L A;  5CQT A;  5D24 A;  5HRX A;  2YEK A;  3P1C A;  5ETB A;  5HLS A;  5LJ1 A;  5J0D A;  4YYK A;  4PS5 A;  2RNY A;  4A9J A;  4A9I A;  5DKH A;  5A82 A;  4NUD A;  4XY9 A;  3ZYU A;  4UYD A;  5CQ8 A;  5D3S A;  4FLP A;  4UYH A;  5D3L A;  3P5O A;  4QSV A;  4UYG A;  3RCW A;  2RNX A;  4YAX A;  3IU5 A;  5LKX A;  5CQ3 A;  4HBX A;  3SVG A;  4MR5 A;  5CU8 A;  5F2P A;  5EIS A;  4NR7 A;  3IU6 A;  2YW5 A;  5FE1 A;  4IR4 A;  4YAB A;  5H1T A;  4TT6 A;  3U5O A;  5FE6 A;  3P1E A;  5HFQ A;  5F1L A;  4YK0 A;  5EWV A;  4IR5 A;  5E74 A;  4QBM A;  5CS8 A;  5A7C A;  4GPJ A;  4MEP A;  5DFD A;  5CGP A;  3UVX A;  5I80 A;  4HBY A;  5IGK A;  5DYA A;  4BW4 A;  2YQD A;  3UVD A;  4QSU A;  5E9Y A;  5EM3 A;  3JVJ A;  3LJW A;  4QUT A;  4N4H A;  4YYJ A;  2MJV B;  4QC1 A;  4XYA A;  5ENG A;  2DVS A;  4TTE A;  5FE7 A;  1ZS5 A;  3G0L A;  5A81 A;  5CQ7 A;  4MEO A;  4A9E A;  4A9O A;  5C8G A;  5A5N A;  4UIW A;  4YAT A;  4LYW A;  4N4I A;  5CTL A;  4Z93 A;  5FB1 A;  5CZG A;  4PTB A;  5FE8 A;  5C7N A;  4MR4 A;  4YY4 A;  4CUP A;  5CRZ A;  4PY6 A;  4NR6 A;  5F5Z A;  5EIC A;  4Z1Q A;  1JSP B;  5L96 A;  4A9M A;  2RFJ A;  5CUD A;  1N72 A;  4NUE A;  4O7B A;  4J0R A;  4IR6 A;  4PCI A;  5KTX A;  5LVQ A;  2D82 A;  4QR4 A;  5FE4 A;  2D9E A;  4NR8 A;  5EPB A;  5E73 A;  5BT3 A;  3S91 A;  4NQN A;  5C4Q A;  5F25 A;  4A9L A;  2E3K A;  5EQ1 A;  5H1U A;  5C89 A;  5EWW A;  4HBV A;  4TZ2 A;  5II1 A;  3U5J A;  4A9N A;  4LZS A;  4NRB A;  5DBM A;  5DYC A;  4ZW1 A;  4YYI A;  4LR6 A;  3LQH A;  4O78 A;  4CL9 A;  4YYN A;  5D0C A;  5FG5 A;  2WP1 A;  5TB6 A;  3HME A;  5ENC A;  4BW3 A;  4YYD A;  2R0Y A;  4PCE A;  4HXK A;  4QB3 A;  4LYI A;  2YEM A;  4J3I A;  2YYN A;  4YH3 A;  5EK9 A;  3JVM A;  5ETD A;  4QZS A;  1WUM A;  5CUG A;  5E9I A;  4MEQ A;  5A83 A;  5LKU A;  4UYF B;  5HRV A;  5IGM A;  3JVK A;  4LZ2 A;  4N3W A; 
#chains in the Genus database with same CATH topology
 4QEV A;  3UV5 A;  5CUB A;  4ZQL A;  4YYG A;  5G4R A;  4CUS A;  4Q0N A;  5DLZ A;  2DVQ A;  2RO1 A;  2I7K A;  5A5Q A;  4O77 A;  5CQ4 A;  5L97 A;  4WIV A;  4KCX A;  4HXO A;  4NYV A;  2R0S A;  5EPS A;  4QY4 A;  3UV2 A;  3UVW A;  4NR4 A;  5C87 A;  4C67 A;  3O33 A;  5HFR A;  3Q2E A;  3U5K A;  5E9K A;  4IR3 A;  2RNW A;  5EGU A;  4O7C A;  4TZ8 A;  5I29 A;  4CFL A;  4QSP A;  3QZS A;  2NXB A;  4DON A;  1EQF A;  5G4S A;  4O72 A;  5ENI A;  5COI A;  4AKN A;  3D1B A;  4UIT A;  3UW9 A;  5E3G A;  4AKI A;  5D3J A;  5E9M A;  5A5R A;  3O35 A;  4Q0O A;  4WHW A;  5FBX A;  4TT4 A;  4QSX A;  1E6I A;  4NR5 A;  5JI8 A;  2H60 A;  4UIZ A;  4O74 A;  4Z1S A;  5LKZ A;  5EP7 A;  4KV1 A;  4YC9 A;  2LSP B;  5H1V A;  5LJ2 A;  5HJC A;  4CFK A;  5DYX A;  5ENJ A;  4UIX A;  4CUQ A;  4OGJ A;  5CY9 A;  5IG6 A;  5E0R A;  5F3A A;  3JVL A;  4QST A;  5EVA A;  3MXF A;  2GRC A;  5DKC A;  5H85 A;  5LVR A;  3G0J A;  5DY7 A;  4TS8 A;  4A9K A;  3TLP A;  1JM4 B;  4YBM A;  4NXJ A;  2L84 A;  4UYE A;  4NR9 A;  2E7N A;  3LQJ A;  5HCL A;  5F36 A;  5IGN A;  3ONI A;  4AI6 A;  5CQ6 A;  4UIU A;  5HRW A;  2L85 A;  5F61 A;  3S92 A;  2KTB B;  5I7Y A;  3UV4 A;  4QEW A;  4HXR A;  3GG3 A;  4QUU A;  5CQ5 A;  3AQA A;  4CUU A;  3QZT A;  5HM0 A;  4XUB A;  3VKH A;  5FE5 A;  4BHW A;  4HXS A;  2FSA A;  3MB3 A;  5E7D A;  5FG4 A;  4IOQ A;  5IGL A;  5DX4 A;  2R0V A;  3O36 A;  5FE3 A;  4AKH A;  5HQ7 A;  5A85 A;  3FKM X;  4O71 A;  5DYU A;  4MR3 A;  4QNS A;  2R10 A;  4HXL A;  5AMF A;  4HXP A;  5LUU A;  2DVR A;  5A5S A;  3SVF A;  4NQM A;  3DWY A;  3O34 A;  4TQN A;  4QYL A;  5FDZ A;  5L8T A;  5II2 A;  4NYX A;  4QSS A;  4O75 A;  5CP5 A;  4CUT A;  4WHU A;  5FFW A;  4QR3 A;  5ENB A;  1X0J A;  5L8U A;  5E3D A;  5F63 A;  4OUF A;  5D7X A;  2RI7 A;  3Q2F A;  2G4A A;  4QC3 A;  5F62 A;  4YAD A;  5ENH A;  3I3J A;  2DAT A;  4LDF A;  2L5E A;  4NRA A;  5F60 A;  5HEL A;  4CLB A;  4F3I A;  4A9H A;  3VKG A;  4LZR A;  4A9F A;  1WUG A;  3LQI A;  5L99 A;  4UYF A;  4YBT A;  5ENE A;  4QEU A;  5HQ5 A;  4HXM A;  3U5N A;  4UIY A;  3HMF A;  3D7C A;  5HEN A;  3ERR A;  2YEL A;  3QZV A;  4TU6 A;  4QR5 A;  5I89 A;  4Y03 A;  5CQA A;  5D3N A;  4UIV A;  4O7A A;  3NXB A;  4XUA A;  5D25 A;  5CFW A;  5HQ6 A;  5FH6 A;  5DFC A;  4PKL A;  3AAD A;  5FH8 A;  2RS9 B;  2OUO A;  4BW2 A;  5L98 A;  4LRG A;  4NRC A;  4ALG A;  5EV9 A;  5FE9 A;  4YBS A;  5C85 A;  5I7X A;  4O7F A;  5I1Q A;  4N4G A;  5LKT A;  4LC2 A;  2EJN A;  5FFY A;  4QYD A;  5D3T A;  5I40 A;  4XY8 A;  4NS5 A;  3HMH A;  5DW2 A;  5EU1 A;  5DLX A;  1PUO A;  2YDW A;  5IID A;  5EA1 A;  1ZKR A;  5EWC A;  4HBW A;  4J1P A;  5FB0 A;  2OSS A;  5KTW A;  4J0S A;  4C66 A;  4CUR A;  4MEN A;  4AKG A;  3DAI A;  4O76 A;  2N9G A;  5E9V A;  5D3R A;  4ZC9 A;  5CUA A;  4YYH A;  5EI4 A;  4BW1 A;  3MUK A;  5EWD A;  5CPE A;  5EWH A;  4MR6 A;  5KTU A;  3U5P A;  4Z6I A;  3MQM A;  4NUC A;  5D26 A;  2DWW A;  5KU3 A;  5DW1 A;  2E7O A;  5D3H A;  5DFB A;  5E9L A;  5D3P A;  4QSQ A;  5CUE A;  5BT5 A;  3K2J A;  1F68 A;  4Z6H A;  5FFV A;  3D1D A;  2F6N A;  3U5M A;  4IOO A;  5FG6 A;  2WP2 A;  5FH7 A;  5DKD A;  2OO1 A;  4TT2 A;  3UVY A;  5FE0 A;  4QSR A;  4KV4 A;  5CUC A;  4E96 A;  5JWM A;  3MB4 A;  5A5P A;  5FE2 A;  5F1H A;  4YYM A;  4BJX A;  2F6J A;  5A5O A;  4RVR A;  4TYL A;  4O7E A;  2DVV A;  5I86 A;  4QSW A;  5LJ0 A;  5BT4 A;  3P1F A;  5KHM A;  3MUL A;  4NYW A;  4O70 A;  4YH4 A;  2I8N A;  2DKW A;  4ALH A;  5TCM A;  4N4F A;  4IOR A;  5I88 A;  4LYS A;  3SVH A;  5AD3 A;  4YY6 A;  4X2I A;  4TU4 A;  5CRM A;  5IBN A;  5ENF A;  3LXJ A;  4HXN A;  3P1D A;  5HEM A;  4OGI A;  5EPR A;  5K29 A;  5KO4 A;  5AME A;  3O37 A;  5ACY A;  5I83 A;  5AD2 A;  3U5L A;  5CQT A;  5D24 A;  5HRX A;  2YEK A;  3P1C A;  5ETB A;  5HLS A;  5LJ1 A;  5J0D A;  4YYK A;  4PS5 A;  2RNY A;  4A9J A;  4A9I A;  5DKH A;  5A82 A;  4NUD A;  4XY9 A;  3ZYU A;  4UYD A;  5CQ8 A;  5D3S A;  4FLP A;  4UYH A;  5D3L A;  3P5O A;  4QSV A;  4UYG A;  3RCW A;  2RNX A;  4YAX A;  3IU5 A;  5LKX A;  5CQ3 A;  4HBX A;  3SVG A;  4MR5 A;  5CU8 A;  5F2P A;  5EIS A;  4NR7 A;  3IU6 A;  2YW5 A;  5FE1 A;  4IR4 A;  4YAB A;  5H1T A;  4TT6 A;  3U5O A;  5FE6 A;  3P1E A;  5HFQ A;  5F1L A;  4YK0 A;  5EWV A;  4IR5 A;  5E74 A;  4QBM A;  5CS8 A;  5A7C A;  4GPJ A;  4MEP A;  5DFD A;  5CGP A;  3UVX A;  5I80 A;  4HBY A;  5IGK A;  5DYA A;  4BW4 A;  2YQD A;  3UVD A;  4QSU A;  5E9Y A;  5EM3 A;  3JVJ A;  3LJW A;  4QUT A;  4N4H A;  4YYJ A;  2MJV B;  4QC1 A;  4XYA A;  5ENG A;  2DVS A;  4TTE A;  5FE7 A;  1ZS5 A;  3G0L A;  5A81 A;  5CQ7 A;  4MEO A;  4A9E A;  4A9O A;  5C8G A;  5A5N A;  4UIW A;  4YAT A;  4LYW A;  4N4I A;  5CTL A;  4Z93 A;  5FB1 A;  5CZG A;  4PTB A;  5FE8 A;  5C7N A;  4MR4 A;  4YY4 A;  4CUP A;  5CRZ A;  4PY6 A;  4NR6 A;  5F5Z A;  5EIC A;  4Z1Q A;  1JSP B;  5L96 A;  4A9M A;  2RFJ A;  5CUD A;  1N72 A;  4NUE A;  4O7B A;  4J0R A;  4IR6 A;  4PCI A;  5KTX A;  5LVQ A;  2D82 A;  4QR4 A;  5FE4 A;  2D9E A;  4NR8 A;  5EPB A;  5E73 A;  5BT3 A;  3S91 A;  4NQN A;  5C4Q A;  5F25 A;  4A9L A;  2E3K A;  5EQ1 A;  5H1U A;  5C89 A;  5EWW A;  4HBV A;  4TZ2 A;  5II1 A;  3U5J A;  4A9N A;  4LZS A;  4NRB A;  5DBM A;  5DYC A;  4ZW1 A;  4YYI A;  4LR6 A;  3LQH A;  4O78 A;  4CL9 A;  4YYN A;  5D0C A;  5FG5 A;  2WP1 A;  5TB6 A;  3HME A;  5ENC A;  4BW3 A;  4YYD A;  2R0Y A;  4PCE A;  4HXK A;  4QB3 A;  4LYI A;  2YEM A;  4J3I A;  2YYN A;  4YH3 A;  5EK9 A;  3JVM A;  5ETD A;  4QZS A;  1WUM A;  5CUG A;  5E9I A;  4MEQ A;  5A83 A;  5LKU A;  4UYF B;  5HRV A;  5IGM A;  3JVK A;  4LZ2 A;  4N3W A; 
#chains in the Genus database with same CATH homology
 4QEV A;  3UV5 A;  5CUB A;  4ZQL A;  4YYG A;  5G4R A;  4CUS A;  4Q0N A;  5DLZ A;  2DVQ A;  2RO1 A;  2I7K A;  5A5Q A;  4O77 A;  5CQ4 A;  5L97 A;  4WIV A;  4KCX A;  4HXO A;  4NYV A;  2R0S A;  5EPS A;  4QY4 A;  3UV2 A;  3UVW A;  4NR4 A;  5C87 A;  4C67 A;  3O33 A;  5HFR A;  3Q2E A;  3U5K A;  5E9K A;  4IR3 A;  2RNW A;  5EGU A;  4O7C A;  4TZ8 A;  5I29 A;  4CFL A;  4QSP A;  3QZS A;  2NXB A;  4DON A;  1EQF A;  5G4S A;  4O72 A;  5ENI A;  5COI A;  4AKN A;  4UIT A;  3UW9 A;  5E3G A;  5D3J A;  5E9M A;  5A5R A;  3O35 A;  4Q0O A;  4WHW A;  5FBX A;  4TT4 A;  4QSX A;  1E6I A;  4NR5 A;  5JI8 A;  2H60 A;  4UIZ A;  4O74 A;  4Z1S A;  5LKZ A;  5EP7 A;  4KV1 A;  4YC9 A;  2LSP B;  5H1V A;  5LJ2 A;  5HJC A;  4CFK A;  5DYX A;  5ENJ A;  4UIX A;  4CUQ A;  4OGJ A;  5CY9 A;  5IG6 A;  5E0R A;  5F3A A;  3JVL A;  4QST A;  5EVA A;  3MXF A;  2GRC A;  5DKC A;  5H85 A;  5LVR A;  3G0J A;  5DY7 A;  4TS8 A;  4A9K A;  3TLP A;  1JM4 B;  4YBM A;  4NXJ A;  2L84 A;  4UYE A;  4NR9 A;  2E7N A;  3LQJ A;  5HCL A;  5F36 A;  5IGN A;  3ONI A;  5CQ6 A;  4UIU A;  5HRW A;  2L85 A;  5F61 A;  3S92 A;  2KTB B;  5I7Y A;  3UV4 A;  4QEW A;  4HXR A;  3GG3 A;  4QUU A;  5CQ5 A;  3AQA A;  4CUU A;  3QZT A;  5HM0 A;  4XUB A;  5FE5 A;  4BHW A;  4HXS A;  2FSA A;  3MB3 A;  5E7D A;  5FG4 A;  4IOQ A;  5IGL A;  5DX4 A;  2R0V A;  3O36 A;  5FE3 A;  5HQ7 A;  5A85 A;  3FKM X;  4O71 A;  5DYU A;  4MR3 A;  4QNS A;  2R10 A;  4HXL A;  5AMF A;  4HXP A;  5LUU A;  2DVR A;  5A5S A;  3SVF A;  4NQM A;  3DWY A;  3O34 A;  4TQN A;  4QYL A;  5FDZ A;  5L8T A;  5II2 A;  4NYX A;  4QSS A;  4O75 A;  5CP5 A;  4CUT A;  4WHU A;  5FFW A;  4QR3 A;  5ENB A;  1X0J A;  5L8U A;  5E3D A;  5F63 A;  4OUF A;  5D7X A;  2RI7 A;  3Q2F A;  2G4A A;  4QC3 A;  5F62 A;  4YAD A;  5ENH A;  3I3J A;  2DAT A;  4LDF A;  2L5E A;  4NRA A;  5F60 A;  5HEL A;  4CLB A;  4F3I A;  4A9H A;  4LZR A;  4A9F A;  1WUG A;  3LQI A;  5L99 A;  4UYF A;  4YBT A;  5ENE A;  4QEU A;  5HQ5 A;  4HXM A;  3U5N A;  4UIY A;  3HMF A;  3D7C A;  5HEN A;  2YEL A;  3QZV A;  4TU6 A;  4QR5 A;  5I89 A;  4Y03 A;  5CQA A;  5D3N A;  4UIV A;  4O7A A;  3NXB A;  4XUA A;  5D25 A;  5CFW A;  5HQ6 A;  5FH6 A;  5DFC A;  4PKL A;  3AAD A;  5FH8 A;  2RS9 B;  2OUO A;  4BW2 A;  5L98 A;  4LRG A;  4NRC A;  4ALG A;  5EV9 A;  5FE9 A;  4YBS A;  5C85 A;  5I7X A;  4O7F A;  5I1Q A;  4N4G A;  5LKT A;  4LC2 A;  5FFY A;  4QYD A;  5D3T A;  5I40 A;  4XY8 A;  4NS5 A;  3HMH A;  5DW2 A;  5EU1 A;  5DLX A;  2YDW A;  5IID A;  5EA1 A;  5EWC A;  4HBW A;  4J1P A;  5FB0 A;  2OSS A;  5KTW A;  4J0S A;  4C66 A;  4CUR A;  4MEN A;  3DAI A;  4O76 A;  2N9G A;  5E9V A;  5D3R A;  4ZC9 A;  5CUA A;  4YYH A;  5EI4 A;  4BW1 A;  3MUK A;  5EWD A;  5CPE A;  5EWH A;  4MR6 A;  5KTU A;  3U5P A;  4Z6I A;  3MQM A;  4NUC A;  5D26 A;  2DWW A;  5KU3 A;  5DW1 A;  2E7O A;  5D3H A;  5DFB A;  5E9L A;  5D3P A;  4QSQ A;  5CUE A;  5BT5 A;  3K2J A;  1F68 A;  4Z6H A;  5FFV A;  2F6N A;  3U5M A;  4IOO A;  5FG6 A;  2WP2 A;  5FH7 A;  5DKD A;  2OO1 A;  4TT2 A;  3UVY A;  5FE0 A;  4QSR A;  4KV4 A;  5CUC A;  4E96 A;  5JWM A;  3MB4 A;  5A5P A;  5FE2 A;  5F1H A;  4YYM A;  4BJX A;  2F6J A;  5A5O A;  4RVR A;  4TYL A;  4O7E A;  2DVV A;  5I86 A;  4QSW A;  5LJ0 A;  5BT4 A;  3P1F A;  5KHM A;  3MUL A;  4NYW A;  4O70 A;  4YH4 A;  2I8N A;  2DKW A;  4ALH A;  5TCM A;  4N4F A;  4IOR A;  5I88 A;  4LYS A;  3SVH A;  5AD3 A;  4YY6 A;  4X2I A;  4TU4 A;  5CRM A;  5IBN A;  5ENF A;  3LXJ A;  4HXN A;  3P1D A;  5HEM A;  4OGI A;  5EPR A;  5K29 A;  5KO4 A;  5AME A;  3O37 A;  5ACY A;  5I83 A;  5AD2 A;  3U5L A;  5CQT A;  5D24 A;  5HRX A;  2YEK A;  3P1C A;  5ETB A;  5HLS A;  5LJ1 A;  5J0D A;  4YYK A;  4PS5 A;  2RNY A;  4A9J A;  4A9I A;  5DKH A;  5A82 A;  4NUD A;  4XY9 A;  3ZYU A;  4UYD A;  5CQ8 A;  5D3S A;  4FLP A;  4UYH A;  5D3L A;  3P5O A;  4QSV A;  4UYG A;  3RCW A;  2RNX A;  4YAX A;  3IU5 A;  5LKX A;  5CQ3 A;  4HBX A;  3SVG A;  4MR5 A;  5CU8 A;  5F2P A;  5EIS A;  4NR7 A;  3IU6 A;  2YW5 A;  5FE1 A;  4IR4 A;  4YAB A;  5H1T A;  4TT6 A;  3U5O A;  5FE6 A;  3P1E A;  5HFQ A;  5F1L A;  4YK0 A;  5EWV A;  4IR5 A;  5E74 A;  4QBM A;  5CS8 A;  5A7C A;  4GPJ A;  4MEP A;  5DFD A;  5CGP A;  3UVX A;  5I80 A;  4HBY A;  5IGK A;  5DYA A;  4BW4 A;  2YQD A;  3UVD A;  4QSU A;  5E9Y A;  5EM3 A;  3JVJ A;  3LJW A;  4QUT A;  4N4H A;  4YYJ A;  2MJV B;  4QC1 A;  4XYA A;  5ENG A;  2DVS A;  4TTE A;  5FE7 A;  1ZS5 A;  3G0L A;  5A81 A;  5CQ7 A;  4MEO A;  4A9E A;  4A9O A;  5C8G A;  5A5N A;  4UIW A;  4YAT A;  4LYW A;  4N4I A;  5CTL A;  4Z93 A;  5FB1 A;  5CZG A;  4PTB A;  5FE8 A;  5C7N A;  4MR4 A;  4YY4 A;  4CUP A;  5CRZ A;  4PY6 A;  4NR6 A;  5F5Z A;  5EIC A;  4Z1Q A;  1JSP B;  5L96 A;  4A9M A;  2RFJ A;  5CUD A;  1N72 A;  4NUE A;  4O7B A;  4J0R A;  4IR6 A;  4PCI A;  5KTX A;  5LVQ A;  2D82 A;  4QR4 A;  5FE4 A;  2D9E A;  4NR8 A;  5EPB A;  5E73 A;  5BT3 A;  3S91 A;  4NQN A;  5C4Q A;  5F25 A;  4A9L A;  2E3K A;  5EQ1 A;  5H1U A;  5C89 A;  5EWW A;  4HBV A;  4TZ2 A;  5II1 A;  3U5J A;  4A9N A;  4LZS A;  4NRB A;  5DBM A;  5DYC A;  4ZW1 A;  4YYI A;  4LR6 A;  3LQH A;  4O78 A;  4CL9 A;  4YYN A;  5D0C A;  5FG5 A;  2WP1 A;  5TB6 A;  3HME A;  5ENC A;  4BW3 A;  4YYD A;  2R0Y A;  4PCE A;  4HXK A;  4QB3 A;  4LYI A;  2YEM A;  4J3I A;  2YYN A;  4YH3 A;  5EK9 A;  3JVM A;  5ETD A;  4QZS A;  1WUM A;  5CUG A;  5E9I A;  4MEQ A;  5A83 A;  5LKU A;  4UYF B;  5HRV A;  5IGM A;  3JVK A;  4LZ2 A;  4N3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...