5DBMA

Crystal structure of the cbp bromodomain in complex with cpi703
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
114
structure length
114
Chain Sequence
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords CREB-binding protein
publication title Regulatory T Cell Modulation by CBP/EP300 Bromodomain Inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5dbmA00
4LYIA 5AD2A 5LJ2A 5H1UA 3SVGA 5I80A 5F62A 4C66A 5II1A 4QNSA 2I8NA 4NYWA 3DWYA 4YY6A 3HMHA 5CUEA 5K29A 5CTLA 5FE0A 5FFYA 4O7CA 4AKNA 5FFWA 4QC3A 4QSUA 4NUEA 3LQIA 4N4GA 4O77A 4PS5A 2GRCA 5JI8A 4TYLA 3UW9A 3IU5A 5F1HA 4NR5A 4ZC9A 4NR8A 1X0JA 2FSAA 5KTXA 5CUGA 2YELA 4YH3A 2LSPB 4QBMA 4QYLA 2YEKA 5DFBA 5HENA 4XUBA 2WP2A 5EGUA 4A9OA 5EWHA 4QSWA 5ENHA 3AQAA 3ONIA 4KV4A 5DBMA 5DX4A 4A9LA 4N4IA 4A9KA 2RNXA 5AMEA 4NXJA 5E0RA 4A9HA 4BW1A 4O7BA 4BJXA 4HXMA 3JVJA 5E7DA 5FDZA 5HFQA 1WUGA 5G4RA 5II2A 4QUUA 5IGMA 5F3AA 5F5ZA 4OGIA 4HXKA 5I1QA 4WHWA 3U5KA 1N72A 4NQNA 5LKZA 5D3RA 4TT4A 4HBVA 5D26A 3O34A 2L5EA 2E3KA 3HMEA 4NUDA 4ZW1A 3P1FA 5D3LA 3LQJA 5D3NA 4YYHA 5FE2A 4TU6A 5FE9A 3U5OA 3D7CA 4YYKA 3MQMA 5FE8A 4YY4A 5CRMA 3SVHA 5CQ7A 4HXOA 4QSSA 3G0LA 4MR6A 5D3HA 5CQ4A 5ENCA 5LKXA 3UV2A 4HXPA 5ACYA 5A83A 4OUFA 5IG6A 5C87A 5JWMA 5E9LA 5LVRA 5HQ7A 4MEQA 2DVVA 4A9MA 4YYMA 3O33A 4NR4A 4O76A 3UVWA 2I7KA 4UIWA 2RO1A 5EM3A 4O72A 4QR4A 4MEOA 5E9VA 4LR6A 5DW1A 5EWVA 2D82A 4LZ2A 5EI4A 5HFRA 3QZTA 4ZQLA 4UYEA 2OO1A 4WHUA 4QSPA 5FE6A 3U5PA 5IIDA 5CS8A 5FG5A 5HEMA 4A9EA 2E7OA 4YYGA 3HMFA 5CQ5A 4QSTA 4TT2A 5ENEA 2RFJA 4NYVA 5CPEA 4N4FA 4NR9A 4TTEA 5D3PA 5E3DA 5DKDA 5L98A 5DKHA 5AMFA 4QSRA 5I29A 3P5OA 4NR6A 4CFLA 4X2IA 4Z6HA 3MULA 4NYXA 5EWDA 4LRGA 2DATA 5L97A 4UYFB 4TU4A 5E73A 2KTBB 3UVXA 5CUAA 5FE4A 5C4QA 3K2JA 5KU3A 4TT6A 4TQNA 4LDFA 2NXBA 5EWWA 2N9GA 5IGKA 5KHMA 3UV5A 5F60A 4BHWA 4CUSA 5FE7A 3LQHA 5A5PA 5HM0A 4NS5A 4HXLA 5CU8A 5DKCA 3Q2FA 4KCXA 4QEUA 5LJ1A 5TB6A 3MUKA 5LKTA 5HCLA 4LZRA 4CL9A 2WP1A 4BW4A 4O78A 4Z93A 5E9YA 4UYGA 4FLPA 5CUBA 5CRZA 4RVRA 4Q0NA 2H60A 4J1PA 2R10A 4NR7A 5C89A 4HBWA 5CGPA 4HBYA 5ENFA 5H85A 4NRAA 3U5JA 3UVDA 5COIA 4ALGA 5DYCA 4YAXA 5CUCA 5CQ3A 5C85A 4A9FA 4QUTA 5D3JA 5D25A 4PTBA 2DWWA 4QEVA 2YYNA 5L8UA 4O74A 3UVYA 4DONA 4IORA 2R0YA 2R0SA 3MXFA 5FG4A 4GPJA 4CUUA 4YK0A 5FE3A 3U5LA 4QZSA 2DKWA 5BT3A 5FE5A 3UV4A 4PY6A 5ETBA 5LJ0A 5G4SA 5FBXA 4CLBA 5I86A 3G0JA 5CZGA 5C8GA 5DLXA 5LUUA 1F68A 2DVQA 4ALHA 4O7EA 2D9EA 4Z1QA 5FFVA 4O7FA 3O37A 4YC9A 3P1DA 3LXJA 3P1EA 4LZSA 5CQ6A 4UYHA 3FKMX 2OUOA 4HXNA 4IR4A 4YYDA 4QSQA 4QEWA 5IBNA 4YBMA 1JSPB 3QZSA 4CUTA 2L85A 4A9IA 4PCEA 2L84A 4CURA 5ENBA 2E7NA 5HRXA 5HELA 4A9JA 1WUMA 4O75A 5L96A 2OSSA 4UIUA 4CUQA 4QY4A 3QZVA 5F61A 4QYDA 4BW3A 5EU1A 4HXSA 3IU6A 3NXBA 5EK9A 4NRBA 4TS8A 4XYAA 4UIVA 5E74A 3JVKA 4CFKA 4C67A 4CUPA 5BT5A 5CUDA 4O70A 5EISA 5ENIA 4J3IA 3RCWA 4UIZA 4E96A 5IGLA 5EPRA 5A7CA 4YABA 4O71A 5HQ5A 5A5SA 5I40A 4UITA 2R0VA 4HBXA 4LC2A 5KO4A 5FE1A 2F6NA 3Q2EA 5DFCA 5F63A 4QB3A 4MR3A 4TZ8A 4IOOA 5ETDA 4LYWA 5D24A 4Z1SA 4UYFA 2G4AA 5DY7A 3P1CA 4YBSA 5A82A 5A5NA 5CFWA 5FH7A 5EV9A 5ENJA 4IR6A 2YEMA 3GG3A 5F25A 4O7AA 5E9KA 3ZYUA 4XUAA 4F3IA 4A9NA 4YADA 5D0CA 3I3JA 1E6IA 5CP5A 3JVMA 4QC1A 4YYJA 3DAIA 5FH8A 5LKUA 5I89A 2RI7A 5EA1A 5C7NA 4NUCA 3U5NA 3O35A 5FH6A 2RNWA 5F1LA 4YYNA 2RNYA 4J0RA 4PCIA 5H1TA 5E3GA 5I7XA 4QR5A 5LVQA 2YQDA 4J0SA 4QSVA 5A5OA 4LYSA 4NQMA 5E9MA 5L8TA 3S91A 4MENA 4XY8A 5IGNA 5DYXA 5EVAA 5AD3A 5HQ6A 3JVLA 4YBTA 4IR5A 5A81A 3S92A 5D3TA 4KV1A 5FB0A 5EQ1A 4N3WA 5ENGA 5F2PA 4IOQA 5TCMA 4QR3A 5EPSA 4HXRA 5HJCA 3SVFA 5FB1A 4MR5A 4XY9A 3MB4A 5F36A 2YW5A 4PKLA 5DFDA 4UIYA 4Q0OA 4QSXA 2F6JA 3U5MA 5E9IA 3TLPA 4IR3A 5CQTA 4OGJA 5EPBA 5DYAA 5DLZA 5A85A 2DVSA 5DW2A 4BW2A 3MB3A 3O36A 5KTWA 5CQAA 3AADA 2RS9B 5D3SA 5EICA 4MR4A 5A5RA 5HRVA 5EP7A 4N4HA 4UIXA 4NRCA 5BT4A 5J0DA 5L99A 4YATA 5I83A 5EWCA 5H1VA 4MEPA 4YH4A 5KTUA 5I88A 5A5QA 3LJWA 1ZS5A 2YDWA 4WIVA 5HRWA 4TZ2A 5CQ8A 2MJVB 5FG6A 5HLSA 5DYUA 4YYIA 5I7YA 1JM4B 5CY9A 1EQFA 5D7XA 4Y03A 2DVRA 4UYDA 4Z6IA
chains in the Genus database with same CATH superfamily
4LYIA 5AD2A 5LJ2A 5H1UA 3SVGA 5I80A 5F62A 4C66A 4AKHA 5II1A 4QNSA 2I8NA 4NYWA 3DWYA 4YY6A 3HMHA 5CUEA 5K29A 5CTLA 5FE0A 5FFYA 4O7CA 4AKNA 5FFWA 4QC3A 4QSUA 4NUEA 3LQIA 4N4GA 4O77A 4PS5A 2GRCA 5JI8A 4TYLA 3UW9A 3IU5A 5F1HA 4NR5A 4ZC9A 4NR8A 1X0JA 2FSAA 5KTXA 5CUGA 2YELA 4YH3A 2LSPB 4QBMA 4QYLA 2YEKA 5DFBA 5HENA 4XUBA 2WP2A 5EGUA 4A9OA 5EWHA 4QSWA 5ENHA 3AQAA 3ONIA 4KV4A 5DBMA 5DX4A 4A9LA 4N4IA 4A9KA 2RNXA 5AMEA 4NXJA 5E0RA 4A9HA 4BW1A 4O7BA 4BJXA 4HXMA 3JVJA 5E7DA 5FDZA 5HFQA 1WUGA 5G4RA 5II2A 4QUUA 5IGMA 5F3AA 5F5ZA 4OGIA 4HXKA 5I1QA 4WHWA 3U5KA 1N72A 4NQNA 5LKZA 5D3RA 4TT4A 4HBVA 5D26A 3O34A 2L5EA 2E3KA 3HMEA 4NUDA 4ZW1A 3P1FA 5D3LA 3LQJA 5D3NA 4YYHA 5FE2A 1PUOA 4TU6A 5FE9A 3U5OA 3D7CA 4YYKA 3MQMA 3VKGA 5FE8A 4YY4A 5CRMA 3SVHA 5CQ7A 4HXOA 4QSSA 3G0LA 4MR6A 5D3HA 5CQ4A 5ENCA 5LKXA 3UV2A 4HXPA 5ACYA 5A83A 4OUFA 5IG6A 5C87A 5JWMA 5E9LA 5LVRA 5HQ7A 4MEQA 2DVVA 4A9MA 4YYMA 3O33A 4NR4A 4O76A 3UVWA 2I7KA 4UIWA 2RO1A 5EM3A 4O72A 4QR4A 4MEOA 5E9VA 4LR6A 5DW1A 5EWVA 2D82A 4LZ2A 5EI4A 5HFRA 3QZTA 4ZQLA 4UYEA 2OO1A 4WHUA 4QSPA 5FE6A 3U5PA 5IIDA 5CS8A 5FG5A 5HEMA 4A9EA 2E7OA 4YYGA 3HMFA 5CQ5A 4QSTA 4TT2A 5ENEA 2RFJA 4NYVA 5CPEA 4N4FA 4NR9A 4TTEA 5D3PA 5E3DA 5DKDA 5L98A 5DKHA 5AMFA 4QSRA 5I29A 3P5OA 4NR6A 4CFLA 4X2IA 4Z6HA 3MULA 4NYXA 5EWDA 4LRGA 2DATA 5L97A 4UYFB 4TU4A 5E73A 2KTBB 3UVXA 5CUAA 5FE4A 5C4QA 3K2JA 5KU3A 4TT6A 4TQNA 4LDFA 2NXBA 5EWWA 2N9GA 5IGKA 5KHMA 3UV5A 5F60A 4BHWA 4CUSA 5FE7A 3LQHA 5A5PA 5HM0A 4NS5A 4HXLA 5CU8A 5DKCA 3Q2FA 4KCXA 4QEUA 5LJ1A 5TB6A 3MUKA 5LKTA 5HCLA 4LZRA 2EJNA 4CL9A 2WP1A 4BW4A 4O78A 4Z93A 5E9YA 4UYGA 4FLPA 5CUBA 5CRZA 4RVRA 4Q0NA 2H60A 4J1PA 2R10A 4NR7A 3D1BA 5C89A 4HBWA 5CGPA 4HBYA 5ENFA 5H85A 4NRAA 3U5JA 3UVDA 5COIA 4ALGA 5DYCA 4YAXA 5CUCA 5CQ3A 5C85A 4A9FA 4QUTA 5D3JA 5D25A 4PTBA 2DWWA 4QEVA 2YYNA 5L8UA 4O74A 3UVYA 4DONA 4IORA 2R0YA 2R0SA 3MXFA 5FG4A 4GPJA 4CUUA 4YK0A 5FE3A 3U5LA 4QZSA 2DKWA 5BT3A 5FE5A 3UV4A 4PY6A 5ETBA 5LJ0A 5G4SA 5FBXA 4CLBA 5I86A 3G0JA 5CZGA 5C8GA 5DLXA 5LUUA 1F68A 2DVQA 4ALHA 4O7EA 2D9EA 4Z1QA 5FFVA 4O7FA 3O37A 4YC9A 3P1DA 3LXJA 3P1EA 4LZSA 5CQ6A 3VKHA 3ERRA 4UYHA 3FKMX 2OUOA 4HXNA 4IR4A 4YYDA 4QSQA 4QEWA 5IBNA 4YBMA 1JSPB 3QZSA 4CUTA 2L85A 4A9IA 4PCEA 2L84A 4CURA 5ENBA 2E7NA 5HRXA 5HELA 4A9JA 1WUMA 4O75A 5L96A 2OSSA 4UIUA 4CUQA 4QY4A 3QZVA 5F61A 4QYDA 4BW3A 5EU1A 4HXSA 3IU6A 3NXBA 5EK9A 4NRBA 4TS8A 4XYAA 4UIVA 1ZKRA 5E74A 3JVKA 4CFKA 4C67A 4CUPA 5BT5A 5CUDA 4O70A 5EISA 5ENIA 4J3IA 3RCWA 4UIZA 4E96A 5IGLA 5EPRA 5A7CA 4YABA 4O71A 5HQ5A 5A5SA 5I40A 4UITA 2R0VA 4AKIA 4HBXA 4LC2A 5KO4A 5FE1A 2F6NA 3Q2EA 5DFCA 5F63A 4QB3A 4MR3A 4TZ8A 4IOOA 5ETDA 4LYWA 5D24A 4Z1SA 4UYFA 2G4AA 5DY7A 3P1CA 4YBSA 5A82A 5A5NA 5CFWA 5FH7A 5EV9A 5ENJA 4IR6A 2YEMA 3GG3A 5F25A 4O7AA 5E9KA 3ZYUA 4XUAA 4F3IA 4A9NA 4YADA 5D0CA 3I3JA 1E6IA 5CP5A 3JVMA 4QC1A 4YYJA 3DAIA 5FH8A 5LKUA 5I89A 2RI7A 5EA1A 5C7NA 4NUCA 3U5NA 3O35A 5FH6A 2RNWA 5F1LA 4YYNA 2RNYA 4J0RA 4PCIA 5H1TA 5E3GA 5I7XA 4QR5A 5LVQA 2YQDA 4J0SA 4QSVA 5A5OA 4LYSA 4NQMA 5E9MA 5L8TA 3S91A 4MENA 4XY8A 5IGNA 5DYXA 5EVAA 5AD3A 5HQ6A 3JVLA 4AI6A 4YBTA 4IR5A 5A81A 3S92A 5D3TA 4KV1A 5FB0A 5EQ1A 4N3WA 5ENGA 5F2PA 4IOQA 5TCMA 4QR3A 5EPSA 4HXRA 5HJCA 3SVFA 5FB1A 4MR5A 4XY9A 3MB4A 5F36A 2YW5A 3D1DA 4PKLA 5DFDA 4UIYA 4Q0OA 4QSXA 2F6JA 3U5MA 5E9IA 3TLPA 4IR3A 5CQTA 4OGJA 5EPBA 5DYAA 5DLZA 5A85A 2DVSA 5DW2A 4BW2A 3MB3A 3O36A 5KTWA 5CQAA 3AADA 2RS9B 5D3SA 5EICA 4MR4A 5A5RA 5HRVA 5EP7A 4N4HA 4UIXA 4NRCA 5BT4A 5J0DA 5L99A 4YATA 5I83A 5EWCA 5H1VA 4MEPA 4YH4A 5KTUA 5I88A 5A5QA 3LJWA 1ZS5A 2YDWA 4WIVA 5HRWA 4TZ2A 5CQ8A 2MJVB 5FG6A 5HLSA 5DYUA 4YYIA 4AKGA 5I7YA 1JM4B 5CY9A 1EQFA 5D7XA 4Y03A 2DVRA 4UYDA 4Z6IA
chains in the Genus database with same CATH topology
4LYIA 5AD2A 5LJ2A 5H1UA 3SVGA 5I80A 5F62A 4C66A 5II1A 4QNSA 2I8NA 4NYWA 3DWYA 4YY6A 3HMHA 5CUEA 5K29A 5CTLA 5FE0A 5FFYA 4O7CA 4AKNA 5FFWA 4QC3A 4QSUA 4NUEA 3LQIA 4N4GA 4O77A 4PS5A 2GRCA 5JI8A 4TYLA 3UW9A 3IU5A 5F1HA 4NR5A 4ZC9A 4NR8A 1X0JA 2FSAA 5KTXA 5CUGA 2YELA 4YH3A 2LSPB 4QBMA 4QYLA 2YEKA 5DFBA 5HENA 4XUBA 2WP2A 5EGUA 4A9OA 5EWHA 4QSWA 5ENHA 3AQAA 3ONIA 4KV4A 5DBMA 5DX4A 4A9LA 4N4IA 4A9KA 2RNXA 5AMEA 4NXJA 5E0RA 4A9HA 4BW1A 4O7BA 4BJXA 4HXMA 3JVJA 5E7DA 5FDZA 5HFQA 1WUGA 5G4RA 5II2A 4QUUA 5IGMA 5F3AA 5F5ZA 4OGIA 4HXKA 5I1QA 4WHWA 3U5KA 1N72A 4NQNA 5LKZA 5D3RA 4TT4A 4HBVA 5D26A 3O34A 2L5EA 2E3KA 3HMEA 4NUDA 4ZW1A 3P1FA 5D3LA 3LQJA 5D3NA 4YYHA 5FE2A 4TU6A 5FE9A 3U5OA 3D7CA 4YYKA 3MQMA 5FE8A 4YY4A 5CRMA 3SVHA 5CQ7A 4HXOA 4QSSA 3G0LA 4MR6A 5D3HA 5CQ4A 5ENCA 5LKXA 3UV2A 4HXPA 5ACYA 5A83A 4OUFA 5IG6A 5C87A 5JWMA 5E9LA 5LVRA 5HQ7A 4MEQA 2DVVA 4A9MA 4YYMA 3O33A 4NR4A 4O76A 3UVWA 2I7KA 4UIWA 2RO1A 5EM3A 4O72A 4QR4A 4MEOA 5E9VA 4LR6A 5DW1A 5EWVA 2D82A 4LZ2A 5EI4A 5HFRA 3QZTA 4ZQLA 4UYEA 2OO1A 4WHUA 4QSPA 5FE6A 3U5PA 5IIDA 5CS8A 5FG5A 5HEMA 4A9EA 2E7OA 4YYGA 3HMFA 5CQ5A 4QSTA 4TT2A 5ENEA 2RFJA 4NYVA 5CPEA 4N4FA 4NR9A 4TTEA 5D3PA 5E3DA 5DKDA 5L98A 5DKHA 5AMFA 4QSRA 5I29A 3P5OA 4NR6A 4CFLA 4X2IA 4Z6HA 3MULA 4NYXA 5EWDA 4LRGA 2DATA 5L97A 4UYFB 4TU4A 5E73A 2KTBB 3UVXA 5CUAA 5FE4A 5C4QA 3K2JA 5KU3A 4TT6A 4TQNA 4LDFA 2NXBA 5EWWA 2N9GA 5IGKA 5KHMA 3UV5A 5F60A 4BHWA 4CUSA 5FE7A 3LQHA 5A5PA 5HM0A 4NS5A 4HXLA 5CU8A 5DKCA 3Q2FA 4KCXA 4QEUA 5LJ1A 5TB6A 3MUKA 5LKTA 5HCLA 4LZRA 4CL9A 2WP1A 4BW4A 4O78A 4Z93A 5E9YA 4UYGA 4FLPA 5CUBA 5CRZA 4RVRA 4Q0NA 2H60A 4J1PA 2R10A 4NR7A 5C89A 4HBWA 5CGPA 4HBYA 5ENFA 5H85A 4NRAA 3U5JA 3UVDA 5COIA 4ALGA 5DYCA 4YAXA 5CUCA 5CQ3A 5C85A 4A9FA 4QUTA 5D3JA 5D25A 4PTBA 2DWWA 4QEVA 2YYNA 5L8UA 4O74A 3UVYA 4DONA 4IORA 2R0YA 2R0SA 3MXFA 5FG4A 4GPJA 4CUUA 4YK0A 5FE3A 3U5LA 4QZSA 2DKWA 5BT3A 5FE5A 3UV4A 4PY6A 5ETBA 5LJ0A 5G4SA 5FBXA 4CLBA 5I86A 3G0JA 5CZGA 5C8GA 5DLXA 5LUUA 1F68A 2DVQA 4ALHA 4O7EA 2D9EA 4Z1QA 5FFVA 4O7FA 3O37A 4YC9A 3P1DA 3LXJA 3P1EA 4LZSA 5CQ6A 4UYHA 3FKMX 2OUOA 4HXNA 4IR4A 4YYDA 4QSQA 4QEWA 5IBNA 4YBMA 1JSPB 3QZSA 4CUTA 2L85A 4A9IA 4PCEA 2L84A 4CURA 5ENBA 2E7NA 5HRXA 5HELA 4A9JA 1WUMA 4O75A 5L96A 2OSSA 4UIUA 4CUQA 4QY4A 3QZVA 5F61A 4QYDA 4BW3A 5EU1A 4HXSA 3IU6A 3NXBA 5EK9A 4NRBA 4TS8A 4XYAA 4UIVA 5E74A 3JVKA 4CFKA 4C67A 4CUPA 5BT5A 5CUDA 4O70A 5EISA 5ENIA 4J3IA 3RCWA 4UIZA 4E96A 5IGLA 5EPRA 5A7CA 4YABA 4O71A 5HQ5A 5A5SA 5I40A 4UITA 2R0VA 4HBXA 4LC2A 5KO4A 5FE1A 2F6NA 3Q2EA 5DFCA 5F63A 4QB3A 4MR3A 4TZ8A 4IOOA 5ETDA 4LYWA 5D24A 4Z1SA 4UYFA 2G4AA 5DY7A 3P1CA 4YBSA 5A82A 5A5NA 5CFWA 5FH7A 5EV9A 5ENJA 4IR6A 2YEMA 3GG3A 5F25A 4O7AA 5E9KA 3ZYUA 4XUAA 4F3IA 4A9NA 4YADA 5D0CA 3I3JA 1E6IA 5CP5A 3JVMA 4QC1A 4YYJA 3DAIA 5FH8A 5LKUA 5I89A 2RI7A 5EA1A 5C7NA 4NUCA 3U5NA 3O35A 5FH6A 2RNWA 5F1LA 4YYNA 2RNYA 4J0RA 4PCIA 5H1TA 5E3GA 5I7XA 4QR5A 5LVQA 2YQDA 4J0SA 4QSVA 5A5OA 4LYSA 4NQMA 5E9MA 5L8TA 3S91A 4MENA 4XY8A 5IGNA 5DYXA 5EVAA 5AD3A 5HQ6A 3JVLA 4YBTA 4IR5A 5A81A 3S92A 5D3TA 4KV1A 5FB0A 5EQ1A 4N3WA 5ENGA 5F2PA 4IOQA 5TCMA 4QR3A 5EPSA 4HXRA 5HJCA 3SVFA 5FB1A 4MR5A 4XY9A 3MB4A 5F36A 2YW5A 4PKLA 5DFDA 4UIYA 4Q0OA 4QSXA 2F6JA 3U5MA 5E9IA 3TLPA 4IR3A 5CQTA 4OGJA 5EPBA 5DYAA 5DLZA 5A85A 2DVSA 5DW2A 4BW2A 3MB3A 3O36A 5KTWA 5CQAA 3AADA 2RS9B 5D3SA 5EICA 4MR4A 5A5RA 5HRVA 5EP7A 4N4HA 4UIXA 4NRCA 5BT4A 5J0DA 5L99A 4YATA 5I83A 5EWCA 5H1VA 4MEPA 4YH4A 5KTUA 5I88A 5A5QA 3LJWA 1ZS5A 2YDWA 4WIVA 5HRWA 4TZ2A 5CQ8A 2MJVB 5FG6A 5HLSA 5DYUA 4YYIA 5I7YA 1JM4B 5CY9A 1EQFA 5D7XA 4Y03A 2DVRA 4UYDA 4Z6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LYI A;  5AD2 A;  5LJ2 A;  5H1U A;  3SVG A;  5I80 A;  5F62 A;  4C66 A;  5II1 A;  4QNS A;  2I8N A;  4NYW A;  3DWY A;  4YY6 A;  3HMH A;  5CUE A;  5K29 A;  5CTL A;  5FE0 A;  5FFY A;  4O7C A;  4AKN A;  5FFW A;  4QC3 A;  4QSU A;  4NUE A;  3LQI A;  4N4G A;  4O77 A;  4PS5 A;  2GRC A;  5JI8 A;  4TYL A;  3UW9 A;  3IU5 A;  5F1H A;  4NR5 A;  4ZC9 A;  4NR8 A;  1X0J A;  2FSA A;  5KTX A;  5CUG A;  2YEL A;  4YH3 A;  2LSP B;  4QBM A;  4QYL A;  2YEK A;  5DFB A;  5HEN A;  4XUB A;  2WP2 A;  5EGU A;  4A9O A;  5EWH A;  4QSW A;  5ENH A;  3AQA A;  3ONI A;  4KV4 A;  5DBM A;  5DX4 A;  4A9L A;  4N4I A;  4A9K A;  2RNX A;  5AME A;  4NXJ A;  5E0R A;  4A9H A;  4BW1 A;  4O7B A;  4BJX A;  4HXM A;  3JVJ A;  5E7D A;  5FDZ A;  5HFQ A;  1WUG A;  5G4R A;  5II2 A;  4QUU A;  5IGM A;  5F3A A;  5F5Z A;  4OGI A;  4HXK A;  5I1Q A;  4WHW A;  3U5K A;  1N72 A;  4NQN A;  5LKZ A;  5D3R A;  4TT4 A;  4HBV A;  5D26 A;  3O34 A;  2L5E A;  2E3K A;  3HME A;  4NUD A;  4ZW1 A;  3P1F A;  5D3L A;  3LQJ A;  5D3N A;  4YYH A;  5FE2 A;  4TU6 A;  5FE9 A;  3U5O A;  3D7C A;  4YYK A;  3MQM A;  5FE8 A;  4YY4 A;  5CRM A;  3SVH A;  5CQ7 A;  4HXO A;  4QSS A;  3G0L A;  4MR6 A;  5D3H A;  5CQ4 A;  5ENC A;  5LKX A;  3UV2 A;  4HXP A;  5ACY A;  5A83 A;  4OUF A;  5IG6 A;  5C87 A;  5JWM A;  5E9L A;  5LVR A;  5HQ7 A;  4MEQ A;  2DVV A;  4A9M A;  4YYM A;  3O33 A;  4NR4 A;  4O76 A;  3UVW A;  2I7K A;  4UIW A;  2RO1 A;  5EM3 A;  4O72 A;  4QR4 A;  4MEO A;  5E9V A;  4LR6 A;  5DW1 A;  5EWV A;  2D82 A;  4LZ2 A;  5EI4 A;  5HFR A;  3QZT A;  4ZQL A;  4UYE A;  2OO1 A;  4WHU A;  4QSP A;  5FE6 A;  3U5P A;  5IID A;  5CS8 A;  5FG5 A;  5HEM A;  4A9E A;  2E7O A;  4YYG A;  3HMF A;  5CQ5 A;  4QST A;  4TT2 A;  5ENE A;  2RFJ A;  4NYV A;  5CPE A;  4N4F A;  4NR9 A;  4TTE A;  5D3P A;  5E3D A;  5DKD A;  5L98 A;  5DKH A;  5AMF A;  4QSR A;  5I29 A;  3P5O A;  4NR6 A;  4CFL A;  4X2I A;  4Z6H A;  3MUL A;  4NYX A;  5EWD A;  4LRG A;  2DAT A;  5L97 A;  4UYF B;  4TU4 A;  5E73 A;  2KTB B;  3UVX A;  5CUA A;  5FE4 A;  5C4Q A;  3K2J A;  5KU3 A;  4TT6 A;  4TQN A;  4LDF A;  2NXB A;  5EWW A;  2N9G A;  5IGK A;  5KHM A;  3UV5 A;  5F60 A;  4BHW A;  4CUS A;  5FE7 A;  3LQH A;  5A5P A;  5HM0 A;  4NS5 A;  4HXL A;  5CU8 A;  5DKC A;  3Q2F A;  4KCX A;  4QEU A;  5LJ1 A;  5TB6 A;  3MUK A;  5LKT A;  5HCL A;  4LZR A;  4CL9 A;  2WP1 A;  4BW4 A;  4O78 A;  4Z93 A;  5E9Y A;  4UYG A;  4FLP A;  5CUB A;  5CRZ A;  4RVR A;  4Q0N A;  2H60 A;  4J1P A;  2R10 A;  4NR7 A;  5C89 A;  4HBW A;  5CGP A;  4HBY A;  5ENF A;  5H85 A;  4NRA A;  3U5J A;  3UVD A;  5COI A;  4ALG A;  5DYC A;  4YAX A;  5CUC A;  5CQ3 A;  5C85 A;  4A9F A;  4QUT A;  5D3J A;  5D25 A;  4PTB A;  2DWW A;  4QEV A;  2YYN A;  5L8U A;  4O74 A;  3UVY A;  4DON A;  4IOR A;  2R0Y A;  2R0S A;  3MXF A;  5FG4 A;  4GPJ A;  4CUU A;  4YK0 A;  5FE3 A;  3U5L A;  4QZS A;  2DKW A;  5BT3 A;  5FE5 A;  3UV4 A;  4PY6 A;  5ETB A;  5LJ0 A;  5G4S A;  5FBX A;  4CLB A;  5I86 A;  3G0J A;  5CZG A;  5C8G A;  5DLX A;  5LUU A;  1F68 A;  2DVQ A;  4ALH A;  4O7E A;  2D9E A;  4Z1Q A;  5FFV A;  4O7F A;  3O37 A;  4YC9 A;  3P1D A;  3LXJ A;  3P1E A;  4LZS A;  5CQ6 A;  4UYH A;  3FKM X;  2OUO A;  4HXN A;  4IR4 A;  4YYD A;  4QSQ A;  4QEW A;  5IBN A;  4YBM A;  1JSP B;  3QZS A;  4CUT A;  2L85 A;  4A9I A;  4PCE A;  2L84 A;  4CUR A;  5ENB A;  2E7N A;  5HRX A;  5HEL A;  4A9J A;  1WUM A;  4O75 A;  5L96 A;  2OSS A;  4UIU A;  4CUQ A;  4QY4 A;  3QZV A;  5F61 A;  4QYD A;  4BW3 A;  5EU1 A;  4HXS A;  3IU6 A;  3NXB A;  5EK9 A;  4NRB A;  4TS8 A;  4XYA A;  4UIV A;  5E74 A;  3JVK A;  4CFK A;  4C67 A;  4CUP A;  5BT5 A;  5CUD A;  4O70 A;  5EIS A;  5ENI A;  4J3I A;  3RCW A;  4UIZ A;  4E96 A;  5IGL A;  5EPR A;  5A7C A;  4YAB A;  4O71 A;  5HQ5 A;  5A5S A;  5I40 A;  4UIT A;  2R0V A;  4HBX A;  4LC2 A;  5KO4 A;  5FE1 A;  2F6N A;  3Q2E A;  5DFC A;  5F63 A;  4QB3 A;  4MR3 A;  4TZ8 A;  4IOO A;  5ETD A;  4LYW A;  5D24 A;  4Z1S A;  4UYF A;  2G4A A;  5DY7 A;  3P1C A;  4YBS A;  5A82 A;  5A5N A;  5CFW A;  5FH7 A;  5EV9 A;  5ENJ A;  4IR6 A;  2YEM A;  3GG3 A;  5F25 A;  4O7A A;  5E9K A;  3ZYU A;  4XUA A;  4F3I A;  4A9N A;  4YAD A;  5D0C A;  3I3J A;  1E6I A;  5CP5 A;  3JVM A;  4QC1 A;  4YYJ A;  3DAI A;  5FH8 A;  5LKU A;  5I89 A;  2RI7 A;  5EA1 A;  5C7N A;  4NUC A;  3U5N A;  3O35 A;  5FH6 A;  2RNW A;  5F1L A;  4YYN A;  2RNY A;  4J0R A;  4PCI A;  5H1T A;  5E3G A;  5I7X A;  4QR5 A;  5LVQ A;  2YQD A;  4J0S A;  4QSV A;  5A5O A;  4LYS A;  4NQM A;  5E9M A;  5L8T A;  3S91 A;  4MEN A;  4XY8 A;  5IGN A;  5DYX A;  5EVA A;  5AD3 A;  5HQ6 A;  3JVL A;  4YBT A;  4IR5 A;  5A81 A;  3S92 A;  5D3T A;  4KV1 A;  5FB0 A;  5EQ1 A;  4N3W A;  5ENG A;  5F2P A;  4IOQ A;  5TCM A;  4QR3 A;  5EPS A;  4HXR A;  5HJC A;  3SVF A;  5FB1 A;  4MR5 A;  4XY9 A;  3MB4 A;  5F36 A;  2YW5 A;  4PKL A;  5DFD A;  4UIY A;  4Q0O A;  4QSX A;  2F6J A;  3U5M A;  5E9I A;  3TLP A;  4IR3 A;  5CQT A;  4OGJ A;  5EPB A;  5DYA A;  5DLZ A;  5A85 A;  2DVS A;  5DW2 A;  4BW2 A;  3MB3 A;  3O36 A;  5KTW A;  5CQA A;  3AAD A;  2RS9 B;  5D3S A;  5EIC A;  4MR4 A;  5A5R A;  5HRV A;  5EP7 A;  4N4H A;  4UIX A;  4NRC A;  5BT4 A;  5J0D A;  5L99 A;  4YAT A;  5I83 A;  5EWC A;  5H1V A;  4MEP A;  4YH4 A;  5KTU A;  5I88 A;  5A5Q A;  3LJW A;  1ZS5 A;  2YDW A;  4WIV A;  5HRW A;  4TZ2 A;  5CQ8 A;  2MJV B;  5FG6 A;  5HLS A;  5DYU A;  4YYI A;  5I7Y A;  1JM4 B;  5CY9 A;  1EQF A;  5D7X A;  4Y03 A;  2DVR A;  4UYD A;  4Z6I A; 
#chains in the Genus database with same CATH topology
 4LYI A;  5AD2 A;  5LJ2 A;  5H1U A;  3SVG A;  5I80 A;  5F62 A;  4C66 A;  4AKH A;  5II1 A;  4QNS A;  2I8N A;  4NYW A;  3DWY A;  4YY6 A;  3HMH A;  5CUE A;  5K29 A;  5CTL A;  5FE0 A;  5FFY A;  4O7C A;  4AKN A;  5FFW A;  4QC3 A;  4QSU A;  4NUE A;  3LQI A;  4N4G A;  4O77 A;  4PS5 A;  2GRC A;  5JI8 A;  4TYL A;  3UW9 A;  3IU5 A;  5F1H A;  4NR5 A;  4ZC9 A;  4NR8 A;  1X0J A;  2FSA A;  5KTX A;  5CUG A;  2YEL A;  4YH3 A;  2LSP B;  4QBM A;  4QYL A;  2YEK A;  5DFB A;  5HEN A;  4XUB A;  2WP2 A;  5EGU A;  4A9O A;  5EWH A;  4QSW A;  5ENH A;  3AQA A;  3ONI A;  4KV4 A;  5DBM A;  5DX4 A;  4A9L A;  4N4I A;  4A9K A;  2RNX A;  5AME A;  4NXJ A;  5E0R A;  4A9H A;  4BW1 A;  4O7B A;  4BJX A;  4HXM A;  3JVJ A;  5E7D A;  5FDZ A;  5HFQ A;  1WUG A;  5G4R A;  5II2 A;  4QUU A;  5IGM A;  5F3A A;  5F5Z A;  4OGI A;  4HXK A;  5I1Q A;  4WHW A;  3U5K A;  1N72 A;  4NQN A;  5LKZ A;  5D3R A;  4TT4 A;  4HBV A;  5D26 A;  3O34 A;  2L5E A;  2E3K A;  3HME A;  4NUD A;  4ZW1 A;  3P1F A;  5D3L A;  3LQJ A;  5D3N A;  4YYH A;  5FE2 A;  1PUO A;  4TU6 A;  5FE9 A;  3U5O A;  3D7C A;  4YYK A;  3MQM A;  3VKG A;  5FE8 A;  4YY4 A;  5CRM A;  3SVH A;  5CQ7 A;  4HXO A;  4QSS A;  3G0L A;  4MR6 A;  5D3H A;  5CQ4 A;  5ENC A;  5LKX A;  3UV2 A;  4HXP A;  5ACY A;  5A83 A;  4OUF A;  5IG6 A;  5C87 A;  5JWM A;  5E9L A;  5LVR A;  5HQ7 A;  4MEQ A;  2DVV A;  4A9M A;  4YYM A;  3O33 A;  4NR4 A;  4O76 A;  3UVW A;  2I7K A;  4UIW A;  2RO1 A;  5EM3 A;  4O72 A;  4QR4 A;  4MEO A;  5E9V A;  4LR6 A;  5DW1 A;  5EWV A;  2D82 A;  4LZ2 A;  5EI4 A;  5HFR A;  3QZT A;  4ZQL A;  4UYE A;  2OO1 A;  4WHU A;  4QSP A;  5FE6 A;  3U5P A;  5IID A;  5CS8 A;  5FG5 A;  5HEM A;  4A9E A;  2E7O A;  4YYG A;  3HMF A;  5CQ5 A;  4QST A;  4TT2 A;  5ENE A;  2RFJ A;  4NYV A;  5CPE A;  4N4F A;  4NR9 A;  4TTE A;  5D3P A;  5E3D A;  5DKD A;  5L98 A;  5DKH A;  5AMF A;  4QSR A;  5I29 A;  3P5O A;  4NR6 A;  4CFL A;  4X2I A;  4Z6H A;  3MUL A;  4NYX A;  5EWD A;  4LRG A;  2DAT A;  5L97 A;  4UYF B;  4TU4 A;  5E73 A;  2KTB B;  3UVX A;  5CUA A;  5FE4 A;  5C4Q A;  3K2J A;  5KU3 A;  4TT6 A;  4TQN A;  4LDF A;  2NXB A;  5EWW A;  2N9G A;  5IGK A;  5KHM A;  3UV5 A;  5F60 A;  4BHW A;  4CUS A;  5FE7 A;  3LQH A;  5A5P A;  5HM0 A;  4NS5 A;  4HXL A;  5CU8 A;  5DKC A;  3Q2F A;  4KCX A;  4QEU A;  5LJ1 A;  5TB6 A;  3MUK A;  5LKT A;  5HCL A;  4LZR A;  2EJN A;  4CL9 A;  2WP1 A;  4BW4 A;  4O78 A;  4Z93 A;  5E9Y A;  4UYG A;  4FLP A;  5CUB A;  5CRZ A;  4RVR A;  4Q0N A;  2H60 A;  4J1P A;  2R10 A;  4NR7 A;  3D1B A;  5C89 A;  4HBW A;  5CGP A;  4HBY A;  5ENF A;  5H85 A;  4NRA A;  3U5J A;  3UVD A;  5COI A;  4ALG A;  5DYC A;  4YAX A;  5CUC A;  5CQ3 A;  5C85 A;  4A9F A;  4QUT A;  5D3J A;  5D25 A;  4PTB A;  2DWW A;  4QEV A;  2YYN A;  5L8U A;  4O74 A;  3UVY A;  4DON A;  4IOR A;  2R0Y A;  2R0S A;  3MXF A;  5FG4 A;  4GPJ A;  4CUU A;  4YK0 A;  5FE3 A;  3U5L A;  4QZS A;  2DKW A;  5BT3 A;  5FE5 A;  3UV4 A;  4PY6 A;  5ETB A;  5LJ0 A;  5G4S A;  5FBX A;  4CLB A;  5I86 A;  3G0J A;  5CZG A;  5C8G A;  5DLX A;  5LUU A;  1F68 A;  2DVQ A;  4ALH A;  4O7E A;  2D9E A;  4Z1Q A;  5FFV A;  4O7F A;  3O37 A;  4YC9 A;  3P1D A;  3LXJ A;  3P1E A;  4LZS A;  5CQ6 A;  3VKH A;  3ERR A;  4UYH A;  3FKM X;  2OUO A;  4HXN A;  4IR4 A;  4YYD A;  4QSQ A;  4QEW A;  5IBN A;  4YBM A;  1JSP B;  3QZS A;  4CUT A;  2L85 A;  4A9I A;  4PCE A;  2L84 A;  4CUR A;  5ENB A;  2E7N A;  5HRX A;  5HEL A;  4A9J A;  1WUM A;  4O75 A;  5L96 A;  2OSS A;  4UIU A;  4CUQ A;  4QY4 A;  3QZV A;  5F61 A;  4QYD A;  4BW3 A;  5EU1 A;  4HXS A;  3IU6 A;  3NXB A;  5EK9 A;  4NRB A;  4TS8 A;  4XYA A;  4UIV A;  1ZKR A;  5E74 A;  3JVK A;  4CFK A;  4C67 A;  4CUP A;  5BT5 A;  5CUD A;  4O70 A;  5EIS A;  5ENI A;  4J3I A;  3RCW A;  4UIZ A;  4E96 A;  5IGL A;  5EPR A;  5A7C A;  4YAB A;  4O71 A;  5HQ5 A;  5A5S A;  5I40 A;  4UIT A;  2R0V A;  4AKI A;  4HBX A;  4LC2 A;  5KO4 A;  5FE1 A;  2F6N A;  3Q2E A;  5DFC A;  5F63 A;  4QB3 A;  4MR3 A;  4TZ8 A;  4IOO A;  5ETD A;  4LYW A;  5D24 A;  4Z1S A;  4UYF A;  2G4A A;  5DY7 A;  3P1C A;  4YBS A;  5A82 A;  5A5N A;  5CFW A;  5FH7 A;  5EV9 A;  5ENJ A;  4IR6 A;  2YEM A;  3GG3 A;  5F25 A;  4O7A A;  5E9K A;  3ZYU A;  4XUA A;  4F3I A;  4A9N A;  4YAD A;  5D0C A;  3I3J A;  1E6I A;  5CP5 A;  3JVM A;  4QC1 A;  4YYJ A;  3DAI A;  5FH8 A;  5LKU A;  5I89 A;  2RI7 A;  5EA1 A;  5C7N A;  4NUC A;  3U5N A;  3O35 A;  5FH6 A;  2RNW A;  5F1L A;  4YYN A;  2RNY A;  4J0R A;  4PCI A;  5H1T A;  5E3G A;  5I7X A;  4QR5 A;  5LVQ A;  2YQD A;  4J0S A;  4QSV A;  5A5O A;  4LYS A;  4NQM A;  5E9M A;  5L8T A;  3S91 A;  4MEN A;  4XY8 A;  5IGN A;  5DYX A;  5EVA A;  5AD3 A;  5HQ6 A;  3JVL A;  4AI6 A;  4YBT A;  4IR5 A;  5A81 A;  3S92 A;  5D3T A;  4KV1 A;  5FB0 A;  5EQ1 A;  4N3W A;  5ENG A;  5F2P A;  4IOQ A;  5TCM A;  4QR3 A;  5EPS A;  4HXR A;  5HJC A;  3SVF A;  5FB1 A;  4MR5 A;  4XY9 A;  3MB4 A;  5F36 A;  2YW5 A;  3D1D A;  4PKL A;  5DFD A;  4UIY A;  4Q0O A;  4QSX A;  2F6J A;  3U5M A;  5E9I A;  3TLP A;  4IR3 A;  5CQT A;  4OGJ A;  5EPB A;  5DYA A;  5DLZ A;  5A85 A;  2DVS A;  5DW2 A;  4BW2 A;  3MB3 A;  3O36 A;  5KTW A;  5CQA A;  3AAD A;  2RS9 B;  5D3S A;  5EIC A;  4MR4 A;  5A5R A;  5HRV A;  5EP7 A;  4N4H A;  4UIX A;  4NRC A;  5BT4 A;  5J0D A;  5L99 A;  4YAT A;  5I83 A;  5EWC A;  5H1V A;  4MEP A;  4YH4 A;  5KTU A;  5I88 A;  5A5Q A;  3LJW A;  1ZS5 A;  2YDW A;  4WIV A;  5HRW A;  4TZ2 A;  5CQ8 A;  2MJV B;  5FG6 A;  5HLS A;  5DYU A;  4YYI A;  4AKG A;  5I7Y A;  1JM4 B;  5CY9 A;  1EQF A;  5D7X A;  4Y03 A;  2DVR A;  4UYD A;  4Z6I A; 
#chains in the Genus database with same CATH homology
 4LYI A;  5AD2 A;  5LJ2 A;  5H1U A;  3SVG A;  5I80 A;  5F62 A;  4C66 A;  5II1 A;  4QNS A;  2I8N A;  4NYW A;  3DWY A;  4YY6 A;  3HMH A;  5CUE A;  5K29 A;  5CTL A;  5FE0 A;  5FFY A;  4O7C A;  4AKN A;  5FFW A;  4QC3 A;  4QSU A;  4NUE A;  3LQI A;  4N4G A;  4O77 A;  4PS5 A;  2GRC A;  5JI8 A;  4TYL A;  3UW9 A;  3IU5 A;  5F1H A;  4NR5 A;  4ZC9 A;  4NR8 A;  1X0J A;  2FSA A;  5KTX A;  5CUG A;  2YEL A;  4YH3 A;  2LSP B;  4QBM A;  4QYL A;  2YEK A;  5DFB A;  5HEN A;  4XUB A;  2WP2 A;  5EGU A;  4A9O A;  5EWH A;  4QSW A;  5ENH A;  3AQA A;  3ONI A;  4KV4 A;  5DBM A;  5DX4 A;  4A9L A;  4N4I A;  4A9K A;  2RNX A;  5AME A;  4NXJ A;  5E0R A;  4A9H A;  4BW1 A;  4O7B A;  4BJX A;  4HXM A;  3JVJ A;  5E7D A;  5FDZ A;  5HFQ A;  1WUG A;  5G4R A;  5II2 A;  4QUU A;  5IGM A;  5F3A A;  5F5Z A;  4OGI A;  4HXK A;  5I1Q A;  4WHW A;  3U5K A;  1N72 A;  4NQN A;  5LKZ A;  5D3R A;  4TT4 A;  4HBV A;  5D26 A;  3O34 A;  2L5E A;  2E3K A;  3HME A;  4NUD A;  4ZW1 A;  3P1F A;  5D3L A;  3LQJ A;  5D3N A;  4YYH A;  5FE2 A;  4TU6 A;  5FE9 A;  3U5O A;  3D7C A;  4YYK A;  3MQM A;  5FE8 A;  4YY4 A;  5CRM A;  3SVH A;  5CQ7 A;  4HXO A;  4QSS A;  3G0L A;  4MR6 A;  5D3H A;  5CQ4 A;  5ENC A;  5LKX A;  3UV2 A;  4HXP A;  5ACY A;  5A83 A;  4OUF A;  5IG6 A;  5C87 A;  5JWM A;  5E9L A;  5LVR A;  5HQ7 A;  4MEQ A;  2DVV A;  4A9M A;  4YYM A;  3O33 A;  4NR4 A;  4O76 A;  3UVW A;  2I7K A;  4UIW A;  2RO1 A;  5EM3 A;  4O72 A;  4QR4 A;  4MEO A;  5E9V A;  4LR6 A;  5DW1 A;  5EWV A;  2D82 A;  4LZ2 A;  5EI4 A;  5HFR A;  3QZT A;  4ZQL A;  4UYE A;  2OO1 A;  4WHU A;  4QSP A;  5FE6 A;  3U5P A;  5IID A;  5CS8 A;  5FG5 A;  5HEM A;  4A9E A;  2E7O A;  4YYG A;  3HMF A;  5CQ5 A;  4QST A;  4TT2 A;  5ENE A;  2RFJ A;  4NYV A;  5CPE A;  4N4F A;  4NR9 A;  4TTE A;  5D3P A;  5E3D A;  5DKD A;  5L98 A;  5DKH A;  5AMF A;  4QSR A;  5I29 A;  3P5O A;  4NR6 A;  4CFL A;  4X2I A;  4Z6H A;  3MUL A;  4NYX A;  5EWD A;  4LRG A;  2DAT A;  5L97 A;  4UYF B;  4TU4 A;  5E73 A;  2KTB B;  3UVX A;  5CUA A;  5FE4 A;  5C4Q A;  3K2J A;  5KU3 A;  4TT6 A;  4TQN A;  4LDF A;  2NXB A;  5EWW A;  2N9G A;  5IGK A;  5KHM A;  3UV5 A;  5F60 A;  4BHW A;  4CUS A;  5FE7 A;  3LQH A;  5A5P A;  5HM0 A;  4NS5 A;  4HXL A;  5CU8 A;  5DKC A;  3Q2F A;  4KCX A;  4QEU A;  5LJ1 A;  5TB6 A;  3MUK A;  5LKT A;  5HCL A;  4LZR A;  4CL9 A;  2WP1 A;  4BW4 A;  4O78 A;  4Z93 A;  5E9Y A;  4UYG A;  4FLP A;  5CUB A;  5CRZ A;  4RVR A;  4Q0N A;  2H60 A;  4J1P A;  2R10 A;  4NR7 A;  5C89 A;  4HBW A;  5CGP A;  4HBY A;  5ENF A;  5H85 A;  4NRA A;  3U5J A;  3UVD A;  5COI A;  4ALG A;  5DYC A;  4YAX A;  5CUC A;  5CQ3 A;  5C85 A;  4A9F A;  4QUT A;  5D3J A;  5D25 A;  4PTB A;  2DWW A;  4QEV A;  2YYN A;  5L8U A;  4O74 A;  3UVY A;  4DON A;  4IOR A;  2R0Y A;  2R0S A;  3MXF A;  5FG4 A;  4GPJ A;  4CUU A;  4YK0 A;  5FE3 A;  3U5L A;  4QZS A;  2DKW A;  5BT3 A;  5FE5 A;  3UV4 A;  4PY6 A;  5ETB A;  5LJ0 A;  5G4S A;  5FBX A;  4CLB A;  5I86 A;  3G0J A;  5CZG A;  5C8G A;  5DLX A;  5LUU A;  1F68 A;  2DVQ A;  4ALH A;  4O7E A;  2D9E A;  4Z1Q A;  5FFV A;  4O7F A;  3O37 A;  4YC9 A;  3P1D A;  3LXJ A;  3P1E A;  4LZS A;  5CQ6 A;  4UYH A;  3FKM X;  2OUO A;  4HXN A;  4IR4 A;  4YYD A;  4QSQ A;  4QEW A;  5IBN A;  4YBM A;  1JSP B;  3QZS A;  4CUT A;  2L85 A;  4A9I A;  4PCE A;  2L84 A;  4CUR A;  5ENB A;  2E7N A;  5HRX A;  5HEL A;  4A9J A;  1WUM A;  4O75 A;  5L96 A;  2OSS A;  4UIU A;  4CUQ A;  4QY4 A;  3QZV A;  5F61 A;  4QYD A;  4BW3 A;  5EU1 A;  4HXS A;  3IU6 A;  3NXB A;  5EK9 A;  4NRB A;  4TS8 A;  4XYA A;  4UIV A;  5E74 A;  3JVK A;  4CFK A;  4C67 A;  4CUP A;  5BT5 A;  5CUD A;  4O70 A;  5EIS A;  5ENI A;  4J3I A;  3RCW A;  4UIZ A;  4E96 A;  5IGL A;  5EPR A;  5A7C A;  4YAB A;  4O71 A;  5HQ5 A;  5A5S A;  5I40 A;  4UIT A;  2R0V A;  4HBX A;  4LC2 A;  5KO4 A;  5FE1 A;  2F6N A;  3Q2E A;  5DFC A;  5F63 A;  4QB3 A;  4MR3 A;  4TZ8 A;  4IOO A;  5ETD A;  4LYW A;  5D24 A;  4Z1S A;  4UYF A;  2G4A A;  5DY7 A;  3P1C A;  4YBS A;  5A82 A;  5A5N A;  5CFW A;  5FH7 A;  5EV9 A;  5ENJ A;  4IR6 A;  2YEM A;  3GG3 A;  5F25 A;  4O7A A;  5E9K A;  3ZYU A;  4XUA A;  4F3I A;  4A9N A;  4YAD A;  5D0C A;  3I3J A;  1E6I A;  5CP5 A;  3JVM A;  4QC1 A;  4YYJ A;  3DAI A;  5FH8 A;  5LKU A;  5I89 A;  2RI7 A;  5EA1 A;  5C7N A;  4NUC A;  3U5N A;  3O35 A;  5FH6 A;  2RNW A;  5F1L A;  4YYN A;  2RNY A;  4J0R A;  4PCI A;  5H1T A;  5E3G A;  5I7X A;  4QR5 A;  5LVQ A;  2YQD A;  4J0S A;  4QSV A;  5A5O A;  4LYS A;  4NQM A;  5E9M A;  5L8T A;  3S91 A;  4MEN A;  4XY8 A;  5IGN A;  5DYX A;  5EVA A;  5AD3 A;  5HQ6 A;  3JVL A;  4YBT A;  4IR5 A;  5A81 A;  3S92 A;  5D3T A;  4KV1 A;  5FB0 A;  5EQ1 A;  4N3W A;  5ENG A;  5F2P A;  4IOQ A;  5TCM A;  4QR3 A;  5EPS A;  4HXR A;  5HJC A;  3SVF A;  5FB1 A;  4MR5 A;  4XY9 A;  3MB4 A;  5F36 A;  2YW5 A;  4PKL A;  5DFD A;  4UIY A;  4Q0O A;  4QSX A;  2F6J A;  3U5M A;  5E9I A;  3TLP A;  4IR3 A;  5CQT A;  4OGJ A;  5EPB A;  5DYA A;  5DLZ A;  5A85 A;  2DVS A;  5DW2 A;  4BW2 A;  3MB3 A;  3O36 A;  5KTW A;  5CQA A;  3AAD A;  2RS9 B;  5D3S A;  5EIC A;  4MR4 A;  5A5R A;  5HRV A;  5EP7 A;  4N4H A;  4UIX A;  4NRC A;  5BT4 A;  5J0D A;  5L99 A;  4YAT A;  5I83 A;  5EWC A;  5H1V A;  4MEP A;  4YH4 A;  5KTU A;  5I88 A;  5A5Q A;  3LJW A;  1ZS5 A;  2YDW A;  4WIV A;  5HRW A;  4TZ2 A;  5CQ8 A;  2MJV B;  5FG6 A;  5HLS A;  5DYU A;  4YYI A;  5I7Y A;  1JM4 B;  5CY9 A;  1EQF A;  5D7X A;  4Y03 A;  2DVR A;  4UYD A;  4Z6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...