3IU5A

Crystal structure of the first bromodomain of human poly-bromodomain containing protein 1 (pb1)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
114
structure length
114
Chain Sequence
SMTVDPIAVCHELYNTIRDYKDEQGRLLCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVNLLTADFQLLFNNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Protein polybromo-1
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3iu5A00
2R0SA 4TT4A 4KCXA 4NYXA 4BW1A 4CFKA 2L85A 4QR4A 3MXFA 4QSQA 4O7FA 4UIXA 4CFLA 4QYDA 5FE2A 5L8UA 3P1EA 4O75A 5I80A 5DLXA 4QY4A 5FG5A 3MQMA 5CQ6A 4YYGA 5KTXA 4NXJA 4QSWA 5CQ8A 3UV2A 3HMFA 4YYNA 4ALHA 3I3JA 3UW9A 4O72A 5F63A 4N4IA 3DAIA 4F3IA 2YELA 5FBXA 4NRCA 4A9HA 2E7OA 5EWWA 4LRGA 5DBMA 5CGPA 4TZ2A 4O7EA 5I86A 3FKMX 3UV4A 5LJ1A 5II1A 4TYLA 3JVKA 4NYWA 4Z93A 3P5OA 3JVJA 4DONA 5C4QA 2LSPB 4WHUA 4GPJA 2DATA 4Z1SA 4A9NA 5HLSA 4TU6A 2RNXA 5EWDA 5EK9A 3IU5A 4O74A 5C7NA 2RNYA 1N72A 5CQ7A 4Z6IA 5E7DA 3NXBA 4UIWA 5C87A 5FE8A 4IR4A 4X2IA 5DY7A 5EWHA 5EPBA 5FFWA 4QC1A 4C67A 2F6JA 4UYGA 2E3KA 5FB0A 5HJCA 5F3AA 4CUTA 2YW5A 5A82A 5I7XA 3ONIA 4J0SA 5FH6A 2KTBB 5CUAA 4NR4A 5ENEA 2OUOA 4MR3A 4A9KA 5ENGA 3D7CA 4PS5A 3SVFA 4NR5A 4TTEA 5F61A 3K2JA 5E9MA 5DFCA 4PCIA 5HENA 2NXBA 2H60A 2L5EA 5EICA 4QNSA 4YYKA 4A9JA 5DKCA 3QZSA 4A9LA 2D82A 4NR7A 5FE3A 5HQ7A 5E9LA 4XUBA 4CUUA 5LKTA 5EWVA 3AQAA 3O37A 3AADA 5DYAA 4AKNA 4UYFB 4O76A 3UVWA 2DVVA 5HELA 4O70A 4MEPA 5EA1A 5H1UA 3SVHA 3TLPA 4YK0A 5AD3A 5C89A 4LZSA 5L96A 4A9FA 3Q2FA 1WUGA 4MEQA 3MULA 5CU8A 5EP7A 4A9MA 5FE5A 5AMFA 5F62A 4N4HA 5IBNA 5A5QA 3UVDA 4OGIA 4Y03A 5CUDA 5J0DA 4O77A 4YAXA 5EVAA 4C66A 4IR3A 4YBMA 5C85A 4O7CA 4MENA 4E96A 4QYLA 4LC2A 5F60A 4Q0OA 5I40A 5CFWA 2G4AA 4QUTA 5G4SA 4YABA 4QUUA 3U5PA 5COIA 5F1LA 5H1TA 4UYFA 4BW3A 5A5NA 5DW2A 4IORA 5EU1A 2DVSA 5F5ZA 4YY4A 5L99A 5KTUA 5CUBA 4UIYA 4LYIA 5D3RA 5HQ5A 2RFJA 4NR9A 4BW2A 3ZYUA 5ETDA 5A5SA 5D26A 2GRCA 4OGJA 4QSPA 2OSSA 5DKDA 5D0CA 2YYNA 4XY9A 5D3PA 4HXKA 5L8TA 4HXSA 4TQNA 5TCMA 5CPEA 1X0JA 5A5PA 2RS9B 4QR3A 4N3WA 5A5RA 4NR8A 4QEVA 5EV9A 5CQ4A 5EI4A 5II2A 5IGNA 5EWCA 5CQ3A 3IU6A 5LJ0A 3Q2EA 3LXJA 5D3LA 5ENHA 5AMEA 3U5NA 3QZTA 4BHWA 4YADA 5F25A 5I83A 4UIVA 5HM0A 4PY6A 5E9KA 4J1PA 5CUGA 5G4RA 3P1CA 4XUAA 5CQ5A 5EQ1A 3O35A 3MB4A 4BJXA 2OO1A 4HBVA 2R0VA 5JI8A 4PCEA 5LVQA 4CUQA 2L84A 3LQJA 5LKUA 4QSVA 3SVGA 3LQHA 4NQMA 3O36A 4FLPA 3UVYA 5D3NA 4IR6A 4J3IA 5HEMA 3MB3A 5ENJA 5DFDA 4YYMA 4PTBA 5HRXA 1ZS5A 5KU3A 5FG6A 3UVXA 5FE1A 5ACYA 4N4GA 5BT4A 1JSPB 5IG6A 4QSTA 5FFYA 2WP1A 4LYWA 5FH7A 2DVQA 4NQNA 5DFBA 4NRAA 4O71A 5D3TA 4A9IA 5I29A 4IOQA 4YYJA 1JM4B 4O7BA 5CTLA 5EPRA 4HXOA 5E73A 5A83A 3G0LA 5FE9A 5ETBA 5FE6A 4IOOA 5F36A 5A81A 5E74A 3P1DA 4CL9A 5CZGA 4LYSA 5EISA 5D25A 5DW1A 2RNWA 4NYVA 5DX4A 5FE0A 2RI7A 5HRVA 4UIZA 3MUKA 2FSAA 4HXRA 5C8GA 2R10A 3HMEA 5D7XA 3DWYA 2YEKA 4MR4A 5A85A 4TZ8A 4O78A 4QEWA 4HXLA 5BT3A 2DVRA 5EGUA 5FG4A 1WUMA 3JVMA 4TT6A 5LUUA 2R0YA 2N9GA 5A5OA 2D9EA 4TU4A 5CUCA 3P1FA 5KTWA 3O33A 2E7NA 5I88A 4A9OA 4YY6A 5F1HA 4BW4A 3U5KA 2F6NA 5KHMA 4J0RA 4YBTA 3S92A 5DKHA 4CLBA 4QZSA 3LQIA 5DYXA 5ENIA 5I7YA 4YC9A 4O7AA 3JVLA 4YBSA 5HQ6A 2DKWA 5D24A 4LZRA 4QB3A 4YH4A 5LVRA 5HFRA 5I1QA 3QZVA 5L97A 5FB1A 4UYDA 4Z6HA 4WIVA 4CURA 5CS8A 5BT5A 3GG3A 5E3GA 3HMHA 4HXPA 4LZ2A 4IR5A 5FFVA 3G0JA 2RO1A 5CUEA 4ALGA 4NRBA 4NUCA 4LR6A 4UITA 5FH8A 5D3SA 4XYAA 2YQDA 5HCLA 2YEMA 4UYHA 4HBWA 5A7CA 4Z1QA 5IGLA 4N4FA 4HBYA 4LDFA 5I89A 4XY8A 4YYDA 3U5LA 4A9EA 5EPSA 1E6IA 4QEUA 3RCWA 4MEOA 4OUFA 5LJ2A 5DYUA 5CRMA 4MR6A 3UV5A 5JWMA 5ENBA 4HXMA 5E9YA 5CY9A 5DLZA 2WP2A 5CP5A 5L98A 2DWWA 3LJWA 3U5MA 5AD2A 5CQTA 4NS5A 4QSXA 4WHWA 5CQAA 4QR5A 1F68A 5E9VA 5ENCA 4HBXA 5IGMA 4TT2A 4PKLA 5K29A 5LKZA 4RVRA 5KO4A 4YH3A 5E0RA 5HFQA 5HRWA 5E3DA 5DYCA 4KV1A 4QSUA 5TB6A 4QSSA 4UIUA 4YYHA 4TS8A 4QC3A 4CUPA 5IGKA 2I8NA 5IIDA 1EQFA 4ZW1A 4UYEA 4ZQLA 5FDZA 5H1VA 5F2PA 4Q0NA 5EM3A 4HXNA 3U5OA 3O34A 3S91A 4KV4A 4MR5A 2MJVB 2YDWA 4NUDA 4YATA 5H85A 4ZC9A 5CRZA 3U5JA 4YYIA 5E9IA 4QBMA 5D3HA 4NUEA 5ENFA 2I7KA 4CUSA 4NR6A 5FE7A 5LKXA 5D3JA 5FE4A 4QSRA
chains in the Genus database with same CATH superfamily
2R0SA 4TT4A 4KCXA 4NYXA 4BW1A 4CFKA 2L85A 4QR4A 3MXFA 4QSQA 4O7FA 4UIXA 4CFLA 4QYDA 5FE2A 5L8UA 3P1EA 4O75A 5I80A 5DLXA 4QY4A 2EJNA 5FG5A 3MQMA 5CQ6A 4YYGA 5KTXA 4NXJA 4QSWA 5CQ8A 3UV2A 3HMFA 4YYNA 4ALHA 3I3JA 3UW9A 4O72A 5F63A 4N4IA 3DAIA 4F3IA 2YELA 5FBXA 4NRCA 4A9HA 2E7OA 5EWWA 4LRGA 5DBMA 5CGPA 4TZ2A 4O7EA 5I86A 3FKMX 3UV4A 5LJ1A 5II1A 4TYLA 3JVKA 4NYWA 4Z93A 3P5OA 3JVJA 4DONA 5C4QA 2LSPB 4WHUA 4GPJA 2DATA 4Z1SA 4A9NA 5HLSA 4TU6A 2RNXA 5EWDA 5EK9A 3IU5A 4O74A 5C7NA 2RNYA 1N72A 5CQ7A 4Z6IA 5E7DA 1ZKRA 3NXBA 4UIWA 5C87A 5FE8A 4IR4A 4X2IA 5DY7A 5EWHA 5EPBA 5FFWA 4QC1A 4C67A 2F6JA 4UYGA 2E3KA 5FB0A 5HJCA 5F3AA 4CUTA 2YW5A 5A82A 5I7XA 3ONIA 4J0SA 5FH6A 2KTBB 5CUAA 4NR4A 5ENEA 2OUOA 4MR3A 4A9KA 5ENGA 3D7CA 4PS5A 3SVFA 4NR5A 4TTEA 5F61A 3K2JA 5E9MA 5DFCA 4PCIA 5HENA 2NXBA 2H60A 2L5EA 5EICA 4QNSA 4YYKA 4A9JA 5DKCA 3QZSA 4A9LA 2D82A 4NR7A 5FE3A 5HQ7A 5E9LA 4XUBA 4CUUA 5LKTA 5EWVA 3AQAA 3O37A 3AADA 5DYAA 4AKNA 4UYFB 4O76A 3UVWA 2DVVA 5HELA 4O70A 4MEPA 5EA1A 5H1UA 3SVHA 3TLPA 4YK0A 5AD3A 5C89A 3D1BA 4LZSA 5L96A 4A9FA 3Q2FA 1WUGA 4MEQA 3MULA 5CU8A 5EP7A 4A9MA 5FE5A 5AMFA 5F62A 4N4HA 5IBNA 5A5QA 3UVDA 4OGIA 4Y03A 5CUDA 5J0DA 4O77A 4YAXA 5EVAA 4C66A 4IR3A 4YBMA 5C85A 4O7CA 4MENA 4E96A 4AI6A 4QYLA 4LC2A 5F60A 4Q0OA 5I40A 5CFWA 2G4AA 4QUTA 5G4SA 4YABA 4QUUA 3U5PA 5COIA 5F1LA 4AKIA 5H1TA 4UYFA 4BW3A 5A5NA 5DW2A 4IORA 5EU1A 2DVSA 5F5ZA 4YY4A 5L99A 5KTUA 5CUBA 4UIYA 4LYIA 5D3RA 5HQ5A 2RFJA 4NR9A 4BW2A 3ZYUA 5ETDA 5A5SA 5D26A 2GRCA 4OGJA 4QSPA 2OSSA 5DKDA 5D0CA 2YYNA 4XY9A 5D3PA 4HXKA 5L8TA 4HXSA 4TQNA 5TCMA 5CPEA 1X0JA 5A5PA 2RS9B 4QR3A 4N3WA 5A5RA 4NR8A 4QEVA 5EV9A 5CQ4A 5EI4A 5II2A 5IGNA 5EWCA 5CQ3A 3IU6A 5LJ0A 3Q2EA 3LXJA 5D3LA 5ENHA 5AMEA 3U5NA 3QZTA 4BHWA 4YADA 5F25A 5I83A 4UIVA 5HM0A 4PY6A 5E9KA 4J1PA 5CUGA 5G4RA 3P1CA 4XUAA 5CQ5A 5EQ1A 3O35A 3MB4A 4BJXA 2OO1A 4HBVA 2R0VA 5JI8A 3ERRA 4PCEA 5LVQA 4CUQA 2L84A 3LQJA 5LKUA 4QSVA 3SVGA 3LQHA 4NQMA 3O36A 4FLPA 3UVYA 5D3NA 4AKGA 4IR6A 4J3IA 5HEMA 3MB3A 5ENJA 5DFDA 4YYMA 4PTBA 5HRXA 1ZS5A 5KU3A 5FG6A 3UVXA 5FE1A 5ACYA 4N4GA 5BT4A 1JSPB 5IG6A 4QSTA 5FFYA 2WP1A 4LYWA 5FH7A 2DVQA 4NQNA 5DFBA 4NRAA 4O71A 5D3TA 4A9IA 1PUOA 5I29A 4IOQA 4YYJA 1JM4B 4O7BA 5CTLA 5EPRA 4HXOA 5E73A 5A83A 3G0LA 5FE9A 5ETBA 5FE6A 4IOOA 5F36A 5A81A 5E74A 3P1DA 4CL9A 5CZGA 4LYSA 5EISA 5D25A 5DW1A 2RNWA 4NYVA 5DX4A 5FE0A 2RI7A 5HRVA 4UIZA 3MUKA 2FSAA 4HXRA 5C8GA 2R10A 3HMEA 5D7XA 3DWYA 2YEKA 4MR4A 5A85A 4TZ8A 4O78A 4QEWA 4HXLA 5BT3A 3VKHA 2DVRA 5EGUA 5FG4A 1WUMA 3JVMA 4TT6A 5LUUA 2R0YA 2N9GA 5A5OA 2D9EA 3D1DA 4TU4A 5CUCA 3P1FA 5KTWA 3O33A 2E7NA 5I88A 4A9OA 4YY6A 5F1HA 4BW4A 3U5KA 2F6NA 5KHMA 4J0RA 4YBTA 3S92A 5DKHA 4CLBA 4QZSA 3LQIA 5DYXA 5ENIA 5I7YA 4YC9A 4O7AA 3JVLA 4YBSA 5HQ6A 2DKWA 5D24A 4LZRA 4QB3A 4YH4A 5LVRA 5HFRA 5I1QA 3QZVA 5L97A 5FB1A 4UYDA 4Z6HA 4WIVA 4CURA 5CS8A 5BT5A 3GG3A 5E3GA 3HMHA 4HXPA 4LZ2A 4IR5A 5FFVA 3G0JA 2RO1A 5CUEA 4ALGA 4NRBA 4NUCA 4LR6A 4UITA 5FH8A 5D3SA 4XYAA 2YQDA 5HCLA 2YEMA 4UYHA 4HBWA 5A7CA 4Z1QA 5IGLA 4N4FA 4HBYA 4LDFA 5I89A 4XY8A 4YYDA 3U5LA 4A9EA 5EPSA 1E6IA 4QEUA 3RCWA 4MEOA 4OUFA 5LJ2A 5DYUA 5CRMA 4MR6A 3UV5A 5JWMA 5ENBA 4HXMA 5E9YA 5CY9A 5DLZA 2WP2A 5CP5A 5L98A 2DWWA 3LJWA 3U5MA 5AD2A 5CQTA 4NS5A 4QSXA 4WHWA 5CQAA 4QR5A 1F68A 5E9VA 5ENCA 4HBXA 5IGMA 4TT2A 4PKLA 5K29A 5LKZA 4RVRA 5KO4A 4YH3A 5E0RA 5HFQA 5HRWA 5E3DA 5DYCA 4KV1A 4QSUA 5TB6A 3VKGA 4QSSA 4UIUA 4YYHA 4TS8A 4QC3A 4CUPA 5IGKA 2I8NA 5IIDA 1EQFA 4ZW1A 4UYEA 4ZQLA 5FDZA 5H1VA 4AKHA 5F2PA 4Q0NA 5EM3A 4HXNA 3U5OA 3O34A 3S91A 4KV4A 4MR5A 2MJVB 2YDWA 4NUDA 4YATA 5H85A 4ZC9A 5CRZA 3U5JA 4YYIA 5E9IA 4QBMA 5D3HA 4NUEA 5ENFA 2I7KA 4CUSA 4NR6A 5FE7A 5LKXA 5D3JA 5FE4A 4QSRA
chains in the Genus database with same CATH topology
2R0SA 4TT4A 4KCXA 4NYXA 4BW1A 4CFKA 2L85A 4QR4A 3MXFA 4QSQA 4O7FA 4UIXA 4CFLA 4QYDA 5FE2A 5L8UA 3P1EA 4O75A 5I80A 5DLXA 4QY4A 5FG5A 3MQMA 5CQ6A 4YYGA 5KTXA 4NXJA 4QSWA 5CQ8A 3UV2A 3HMFA 4YYNA 4ALHA 3I3JA 3UW9A 4O72A 5F63A 4N4IA 3DAIA 4F3IA 2YELA 5FBXA 4NRCA 4A9HA 2E7OA 5EWWA 4LRGA 5DBMA 5CGPA 4TZ2A 4O7EA 5I86A 3FKMX 3UV4A 5LJ1A 5II1A 4TYLA 3JVKA 4NYWA 4Z93A 3P5OA 3JVJA 4DONA 5C4QA 2LSPB 4WHUA 4GPJA 2DATA 4Z1SA 4A9NA 5HLSA 4TU6A 2RNXA 5EWDA 5EK9A 3IU5A 4O74A 5C7NA 2RNYA 1N72A 5CQ7A 4Z6IA 5E7DA 3NXBA 4UIWA 5C87A 5FE8A 4IR4A 4X2IA 5DY7A 5EWHA 5EPBA 5FFWA 4QC1A 4C67A 2F6JA 4UYGA 2E3KA 5FB0A 5HJCA 5F3AA 4CUTA 2YW5A 5A82A 5I7XA 3ONIA 4J0SA 5FH6A 2KTBB 5CUAA 4NR4A 5ENEA 2OUOA 4MR3A 4A9KA 5ENGA 3D7CA 4PS5A 3SVFA 4NR5A 4TTEA 5F61A 3K2JA 5E9MA 5DFCA 4PCIA 5HENA 2NXBA 2H60A 2L5EA 5EICA 4QNSA 4YYKA 4A9JA 5DKCA 3QZSA 4A9LA 2D82A 4NR7A 5FE3A 5HQ7A 5E9LA 4XUBA 4CUUA 5LKTA 5EWVA 3AQAA 3O37A 3AADA 5DYAA 4AKNA 4UYFB 4O76A 3UVWA 2DVVA 5HELA 4O70A 4MEPA 5EA1A 5H1UA 3SVHA 3TLPA 4YK0A 5AD3A 5C89A 4LZSA 5L96A 4A9FA 3Q2FA 1WUGA 4MEQA 3MULA 5CU8A 5EP7A 4A9MA 5FE5A 5AMFA 5F62A 4N4HA 5IBNA 5A5QA 3UVDA 4OGIA 4Y03A 5CUDA 5J0DA 4O77A 4YAXA 5EVAA 4C66A 4IR3A 4YBMA 5C85A 4O7CA 4MENA 4E96A 4QYLA 4LC2A 5F60A 4Q0OA 5I40A 5CFWA 2G4AA 4QUTA 5G4SA 4YABA 4QUUA 3U5PA 5COIA 5F1LA 5H1TA 4UYFA 4BW3A 5A5NA 5DW2A 4IORA 5EU1A 2DVSA 5F5ZA 4YY4A 5L99A 5KTUA 5CUBA 4UIYA 4LYIA 5D3RA 5HQ5A 2RFJA 4NR9A 4BW2A 3ZYUA 5ETDA 5A5SA 5D26A 2GRCA 4OGJA 4QSPA 2OSSA 5DKDA 5D0CA 2YYNA 4XY9A 5D3PA 4HXKA 5L8TA 4HXSA 4TQNA 5TCMA 5CPEA 1X0JA 5A5PA 2RS9B 4QR3A 4N3WA 5A5RA 4NR8A 4QEVA 5EV9A 5CQ4A 5EI4A 5II2A 5IGNA 5EWCA 5CQ3A 3IU6A 5LJ0A 3Q2EA 3LXJA 5D3LA 5ENHA 5AMEA 3U5NA 3QZTA 4BHWA 4YADA 5F25A 5I83A 4UIVA 5HM0A 4PY6A 5E9KA 4J1PA 5CUGA 5G4RA 3P1CA 4XUAA 5CQ5A 5EQ1A 3O35A 3MB4A 4BJXA 2OO1A 4HBVA 2R0VA 5JI8A 4PCEA 5LVQA 4CUQA 2L84A 3LQJA 5LKUA 4QSVA 3SVGA 3LQHA 4NQMA 3O36A 4FLPA 3UVYA 5D3NA 4IR6A 4J3IA 5HEMA 3MB3A 5ENJA 5DFDA 4YYMA 4PTBA 5HRXA 1ZS5A 5KU3A 5FG6A 3UVXA 5FE1A 5ACYA 4N4GA 5BT4A 1JSPB 5IG6A 4QSTA 5FFYA 2WP1A 4LYWA 5FH7A 2DVQA 4NQNA 5DFBA 4NRAA 4O71A 5D3TA 4A9IA 5I29A 4IOQA 4YYJA 1JM4B 4O7BA 5CTLA 5EPRA 4HXOA 5E73A 5A83A 3G0LA 5FE9A 5ETBA 5FE6A 4IOOA 5F36A 5A81A 5E74A 3P1DA 4CL9A 5CZGA 4LYSA 5EISA 5D25A 5DW1A 2RNWA 4NYVA 5DX4A 5FE0A 2RI7A 5HRVA 4UIZA 3MUKA 2FSAA 4HXRA 5C8GA 2R10A 3HMEA 5D7XA 3DWYA 2YEKA 4MR4A 5A85A 4TZ8A 4O78A 4QEWA 4HXLA 5BT3A 2DVRA 5EGUA 5FG4A 1WUMA 3JVMA 4TT6A 5LUUA 2R0YA 2N9GA 5A5OA 2D9EA 4TU4A 5CUCA 3P1FA 5KTWA 3O33A 2E7NA 5I88A 4A9OA 4YY6A 5F1HA 4BW4A 3U5KA 2F6NA 5KHMA 4J0RA 4YBTA 3S92A 5DKHA 4CLBA 4QZSA 3LQIA 5DYXA 5ENIA 5I7YA 4YC9A 4O7AA 3JVLA 4YBSA 5HQ6A 2DKWA 5D24A 4LZRA 4QB3A 4YH4A 5LVRA 5HFRA 5I1QA 3QZVA 5L97A 5FB1A 4UYDA 4Z6HA 4WIVA 4CURA 5CS8A 5BT5A 3GG3A 5E3GA 3HMHA 4HXPA 4LZ2A 4IR5A 5FFVA 3G0JA 2RO1A 5CUEA 4ALGA 4NRBA 4NUCA 4LR6A 4UITA 5FH8A 5D3SA 4XYAA 2YQDA 5HCLA 2YEMA 4UYHA 4HBWA 5A7CA 4Z1QA 5IGLA 4N4FA 4HBYA 4LDFA 5I89A 4XY8A 4YYDA 3U5LA 4A9EA 5EPSA 1E6IA 4QEUA 3RCWA 4MEOA 4OUFA 5LJ2A 5DYUA 5CRMA 4MR6A 3UV5A 5JWMA 5ENBA 4HXMA 5E9YA 5CY9A 5DLZA 2WP2A 5CP5A 5L98A 2DWWA 3LJWA 3U5MA 5AD2A 5CQTA 4NS5A 4QSXA 4WHWA 5CQAA 4QR5A 1F68A 5E9VA 5ENCA 4HBXA 5IGMA 4TT2A 4PKLA 5K29A 5LKZA 4RVRA 5KO4A 4YH3A 5E0RA 5HFQA 5HRWA 5E3DA 5DYCA 4KV1A 4QSUA 5TB6A 4QSSA 4UIUA 4YYHA 4TS8A 4QC3A 4CUPA 5IGKA 2I8NA 5IIDA 1EQFA 4ZW1A 4UYEA 4ZQLA 5FDZA 5H1VA 5F2PA 4Q0NA 5EM3A 4HXNA 3U5OA 3O34A 3S91A 4KV4A 4MR5A 2MJVB 2YDWA 4NUDA 4YATA 5H85A 4ZC9A 5CRZA 3U5JA 4YYIA 5E9IA 4QBMA 5D3HA 4NUEA 5ENFA 2I7KA 4CUSA 4NR6A 5FE7A 5LKXA 5D3JA 5FE4A 4QSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R0S A;  4TT4 A;  4KCX A;  4NYX A;  4BW1 A;  4CFK A;  2L85 A;  4QR4 A;  3MXF A;  4QSQ A;  4O7F A;  4UIX A;  4CFL A;  4QYD A;  5FE2 A;  5L8U A;  3P1E A;  4O75 A;  5I80 A;  5DLX A;  4QY4 A;  5FG5 A;  3MQM A;  5CQ6 A;  4YYG A;  5KTX A;  4NXJ A;  4QSW A;  5CQ8 A;  3UV2 A;  3HMF A;  4YYN A;  4ALH A;  3I3J A;  3UW9 A;  4O72 A;  5F63 A;  4N4I A;  3DAI A;  4F3I A;  2YEL A;  5FBX A;  4NRC A;  4A9H A;  2E7O A;  5EWW A;  4LRG A;  5DBM A;  5CGP A;  4TZ2 A;  4O7E A;  5I86 A;  3FKM X;  3UV4 A;  5LJ1 A;  5II1 A;  4TYL A;  3JVK A;  4NYW A;  4Z93 A;  3P5O A;  3JVJ A;  4DON A;  5C4Q A;  2LSP B;  4WHU A;  4GPJ A;  2DAT A;  4Z1S A;  4A9N A;  5HLS A;  4TU6 A;  2RNX A;  5EWD A;  5EK9 A;  3IU5 A;  4O74 A;  5C7N A;  2RNY A;  1N72 A;  5CQ7 A;  4Z6I A;  5E7D A;  3NXB A;  4UIW A;  5C87 A;  5FE8 A;  4IR4 A;  4X2I A;  5DY7 A;  5EWH A;  5EPB A;  5FFW A;  4QC1 A;  4C67 A;  2F6J A;  4UYG A;  2E3K A;  5FB0 A;  5HJC A;  5F3A A;  4CUT A;  2YW5 A;  5A82 A;  5I7X A;  3ONI A;  4J0S A;  5FH6 A;  2KTB B;  5CUA A;  4NR4 A;  5ENE A;  2OUO A;  4MR3 A;  4A9K A;  5ENG A;  3D7C A;  4PS5 A;  3SVF A;  4NR5 A;  4TTE A;  5F61 A;  3K2J A;  5E9M A;  5DFC A;  4PCI A;  5HEN A;  2NXB A;  2H60 A;  2L5E A;  5EIC A;  4QNS A;  4YYK A;  4A9J A;  5DKC A;  3QZS A;  4A9L A;  2D82 A;  4NR7 A;  5FE3 A;  5HQ7 A;  5E9L A;  4XUB A;  4CUU A;  5LKT A;  5EWV A;  3AQA A;  3O37 A;  3AAD A;  5DYA A;  4AKN A;  4UYF B;  4O76 A;  3UVW A;  2DVV A;  5HEL A;  4O70 A;  4MEP A;  5EA1 A;  5H1U A;  3SVH A;  3TLP A;  4YK0 A;  5AD3 A;  5C89 A;  4LZS A;  5L96 A;  4A9F A;  3Q2F A;  1WUG A;  4MEQ A;  3MUL A;  5CU8 A;  5EP7 A;  4A9M A;  5FE5 A;  5AMF A;  5F62 A;  4N4H A;  5IBN A;  5A5Q A;  3UVD A;  4OGI A;  4Y03 A;  5CUD A;  5J0D A;  4O77 A;  4YAX A;  5EVA A;  4C66 A;  4IR3 A;  4YBM A;  5C85 A;  4O7C A;  4MEN A;  4E96 A;  4QYL A;  4LC2 A;  5F60 A;  4Q0O A;  5I40 A;  5CFW A;  2G4A A;  4QUT A;  5G4S A;  4YAB A;  4QUU A;  3U5P A;  5COI A;  5F1L A;  5H1T A;  4UYF A;  4BW3 A;  5A5N A;  5DW2 A;  4IOR A;  5EU1 A;  2DVS A;  5F5Z A;  4YY4 A;  5L99 A;  5KTU A;  5CUB A;  4UIY A;  4LYI A;  5D3R A;  5HQ5 A;  2RFJ A;  4NR9 A;  4BW2 A;  3ZYU A;  5ETD A;  5A5S A;  5D26 A;  2GRC A;  4OGJ A;  4QSP A;  2OSS A;  5DKD A;  5D0C A;  2YYN A;  4XY9 A;  5D3P A;  4HXK A;  5L8T A;  4HXS A;  4TQN A;  5TCM A;  5CPE A;  1X0J A;  5A5P A;  2RS9 B;  4QR3 A;  4N3W A;  5A5R A;  4NR8 A;  4QEV A;  5EV9 A;  5CQ4 A;  5EI4 A;  5II2 A;  5IGN A;  5EWC A;  5CQ3 A;  3IU6 A;  5LJ0 A;  3Q2E A;  3LXJ A;  5D3L A;  5ENH A;  5AME A;  3U5N A;  3QZT A;  4BHW A;  4YAD A;  5F25 A;  5I83 A;  4UIV A;  5HM0 A;  4PY6 A;  5E9K A;  4J1P A;  5CUG A;  5G4R A;  3P1C A;  4XUA A;  5CQ5 A;  5EQ1 A;  3O35 A;  3MB4 A;  4BJX A;  2OO1 A;  4HBV A;  2R0V A;  5JI8 A;  4PCE A;  5LVQ A;  4CUQ A;  2L84 A;  3LQJ A;  5LKU A;  4QSV A;  3SVG A;  3LQH A;  4NQM A;  3O36 A;  4FLP A;  3UVY A;  5D3N A;  4IR6 A;  4J3I A;  5HEM A;  3MB3 A;  5ENJ A;  5DFD A;  4YYM A;  4PTB A;  5HRX A;  1ZS5 A;  5KU3 A;  5FG6 A;  3UVX A;  5FE1 A;  5ACY A;  4N4G A;  5BT4 A;  1JSP B;  5IG6 A;  4QST A;  5FFY A;  2WP1 A;  4LYW A;  5FH7 A;  2DVQ A;  4NQN A;  5DFB A;  4NRA A;  4O71 A;  5D3T A;  4A9I A;  5I29 A;  4IOQ A;  4YYJ A;  1JM4 B;  4O7B A;  5CTL A;  5EPR A;  4HXO A;  5E73 A;  5A83 A;  3G0L A;  5FE9 A;  5ETB A;  5FE6 A;  4IOO A;  5F36 A;  5A81 A;  5E74 A;  3P1D A;  4CL9 A;  5CZG A;  4LYS A;  5EIS A;  5D25 A;  5DW1 A;  2RNW A;  4NYV A;  5DX4 A;  5FE0 A;  2RI7 A;  5HRV A;  4UIZ A;  3MUK A;  2FSA A;  4HXR A;  5C8G A;  2R10 A;  3HME A;  5D7X A;  3DWY A;  2YEK A;  4MR4 A;  5A85 A;  4TZ8 A;  4O78 A;  4QEW A;  4HXL A;  5BT3 A;  2DVR A;  5EGU A;  5FG4 A;  1WUM A;  3JVM A;  4TT6 A;  5LUU A;  2R0Y A;  2N9G A;  5A5O A;  2D9E A;  4TU4 A;  5CUC A;  3P1F A;  5KTW A;  3O33 A;  2E7N A;  5I88 A;  4A9O A;  4YY6 A;  5F1H A;  4BW4 A;  3U5K A;  2F6N A;  5KHM A;  4J0R A;  4YBT A;  3S92 A;  5DKH A;  4CLB A;  4QZS A;  3LQI A;  5DYX A;  5ENI A;  5I7Y A;  4YC9 A;  4O7A A;  3JVL A;  4YBS A;  5HQ6 A;  2DKW A;  5D24 A;  4LZR A;  4QB3 A;  4YH4 A;  5LVR A;  5HFR A;  5I1Q A;  3QZV A;  5L97 A;  5FB1 A;  4UYD A;  4Z6H A;  4WIV A;  4CUR A;  5CS8 A;  5BT5 A;  3GG3 A;  5E3G A;  3HMH A;  4HXP A;  4LZ2 A;  4IR5 A;  5FFV A;  3G0J A;  2RO1 A;  5CUE A;  4ALG A;  4NRB A;  4NUC A;  4LR6 A;  4UIT A;  5FH8 A;  5D3S A;  4XYA A;  2YQD A;  5HCL A;  2YEM A;  4UYH A;  4HBW A;  5A7C A;  4Z1Q A;  5IGL A;  4N4F A;  4HBY A;  4LDF A;  5I89 A;  4XY8 A;  4YYD A;  3U5L A;  4A9E A;  5EPS A;  1E6I A;  4QEU A;  3RCW A;  4MEO A;  4OUF A;  5LJ2 A;  5DYU A;  5CRM A;  4MR6 A;  3UV5 A;  5JWM A;  5ENB A;  4HXM A;  5E9Y A;  5CY9 A;  5DLZ A;  2WP2 A;  5CP5 A;  5L98 A;  2DWW A;  3LJW A;  3U5M A;  5AD2 A;  5CQT A;  4NS5 A;  4QSX A;  4WHW A;  5CQA A;  4QR5 A;  1F68 A;  5E9V A;  5ENC A;  4HBX A;  5IGM A;  4TT2 A;  4PKL A;  5K29 A;  5LKZ A;  4RVR A;  5KO4 A;  4YH3 A;  5E0R A;  5HFQ A;  5HRW A;  5E3D A;  5DYC A;  4KV1 A;  4QSU A;  5TB6 A;  4QSS A;  4UIU A;  4YYH A;  4TS8 A;  4QC3 A;  4CUP A;  5IGK A;  2I8N A;  5IID A;  1EQF A;  4ZW1 A;  4UYE A;  4ZQL A;  5FDZ A;  5H1V A;  5F2P A;  4Q0N A;  5EM3 A;  4HXN A;  3U5O A;  3O34 A;  3S91 A;  4KV4 A;  4MR5 A;  2MJV B;  2YDW A;  4NUD A;  4YAT A;  5H85 A;  4ZC9 A;  5CRZ A;  3U5J A;  4YYI A;  5E9I A;  4QBM A;  5D3H A;  4NUE A;  5ENF A;  2I7K A;  4CUS A;  4NR6 A;  5FE7 A;  5LKX A;  5D3J A;  5FE4 A;  4QSR A; 
#chains in the Genus database with same CATH topology
 2R0S A;  4TT4 A;  4KCX A;  4NYX A;  4BW1 A;  4CFK A;  2L85 A;  4QR4 A;  3MXF A;  4QSQ A;  4O7F A;  4UIX A;  4CFL A;  4QYD A;  5FE2 A;  5L8U A;  3P1E A;  4O75 A;  5I80 A;  5DLX A;  4QY4 A;  2EJN A;  5FG5 A;  3MQM A;  5CQ6 A;  4YYG A;  5KTX A;  4NXJ A;  4QSW A;  5CQ8 A;  3UV2 A;  3HMF A;  4YYN A;  4ALH A;  3I3J A;  3UW9 A;  4O72 A;  5F63 A;  4N4I A;  3DAI A;  4F3I A;  2YEL A;  5FBX A;  4NRC A;  4A9H A;  2E7O A;  5EWW A;  4LRG A;  5DBM A;  5CGP A;  4TZ2 A;  4O7E A;  5I86 A;  3FKM X;  3UV4 A;  5LJ1 A;  5II1 A;  4TYL A;  3JVK A;  4NYW A;  4Z93 A;  3P5O A;  3JVJ A;  4DON A;  5C4Q A;  2LSP B;  4WHU A;  4GPJ A;  2DAT A;  4Z1S A;  4A9N A;  5HLS A;  4TU6 A;  2RNX A;  5EWD A;  5EK9 A;  3IU5 A;  4O74 A;  5C7N A;  2RNY A;  1N72 A;  5CQ7 A;  4Z6I A;  5E7D A;  1ZKR A;  3NXB A;  4UIW A;  5C87 A;  5FE8 A;  4IR4 A;  4X2I A;  5DY7 A;  5EWH A;  5EPB A;  5FFW A;  4QC1 A;  4C67 A;  2F6J A;  4UYG A;  2E3K A;  5FB0 A;  5HJC A;  5F3A A;  4CUT A;  2YW5 A;  5A82 A;  5I7X A;  3ONI A;  4J0S A;  5FH6 A;  2KTB B;  5CUA A;  4NR4 A;  5ENE A;  2OUO A;  4MR3 A;  4A9K A;  5ENG A;  3D7C A;  4PS5 A;  3SVF A;  4NR5 A;  4TTE A;  5F61 A;  3K2J A;  5E9M A;  5DFC A;  4PCI A;  5HEN A;  2NXB A;  2H60 A;  2L5E A;  5EIC A;  4QNS A;  4YYK A;  4A9J A;  5DKC A;  3QZS A;  4A9L A;  2D82 A;  4NR7 A;  5FE3 A;  5HQ7 A;  5E9L A;  4XUB A;  4CUU A;  5LKT A;  5EWV A;  3AQA A;  3O37 A;  3AAD A;  5DYA A;  4AKN A;  4UYF B;  4O76 A;  3UVW A;  2DVV A;  5HEL A;  4O70 A;  4MEP A;  5EA1 A;  5H1U A;  3SVH A;  3TLP A;  4YK0 A;  5AD3 A;  5C89 A;  3D1B A;  4LZS A;  5L96 A;  4A9F A;  3Q2F A;  1WUG A;  4MEQ A;  3MUL A;  5CU8 A;  5EP7 A;  4A9M A;  5FE5 A;  5AMF A;  5F62 A;  4N4H A;  5IBN A;  5A5Q A;  3UVD A;  4OGI A;  4Y03 A;  5CUD A;  5J0D A;  4O77 A;  4YAX A;  5EVA A;  4C66 A;  4IR3 A;  4YBM A;  5C85 A;  4O7C A;  4MEN A;  4E96 A;  4AI6 A;  4QYL A;  4LC2 A;  5F60 A;  4Q0O A;  5I40 A;  5CFW A;  2G4A A;  4QUT A;  5G4S A;  4YAB A;  4QUU A;  3U5P A;  5COI A;  5F1L A;  4AKI A;  5H1T A;  4UYF A;  4BW3 A;  5A5N A;  5DW2 A;  4IOR A;  5EU1 A;  2DVS A;  5F5Z A;  4YY4 A;  5L99 A;  5KTU A;  5CUB A;  4UIY A;  4LYI A;  5D3R A;  5HQ5 A;  2RFJ A;  4NR9 A;  4BW2 A;  3ZYU A;  5ETD A;  5A5S A;  5D26 A;  2GRC A;  4OGJ A;  4QSP A;  2OSS A;  5DKD A;  5D0C A;  2YYN A;  4XY9 A;  5D3P A;  4HXK A;  5L8T A;  4HXS A;  4TQN A;  5TCM A;  5CPE A;  1X0J A;  5A5P A;  2RS9 B;  4QR3 A;  4N3W A;  5A5R A;  4NR8 A;  4QEV A;  5EV9 A;  5CQ4 A;  5EI4 A;  5II2 A;  5IGN A;  5EWC A;  5CQ3 A;  3IU6 A;  5LJ0 A;  3Q2E A;  3LXJ A;  5D3L A;  5ENH A;  5AME A;  3U5N A;  3QZT A;  4BHW A;  4YAD A;  5F25 A;  5I83 A;  4UIV A;  5HM0 A;  4PY6 A;  5E9K A;  4J1P A;  5CUG A;  5G4R A;  3P1C A;  4XUA A;  5CQ5 A;  5EQ1 A;  3O35 A;  3MB4 A;  4BJX A;  2OO1 A;  4HBV A;  2R0V A;  5JI8 A;  3ERR A;  4PCE A;  5LVQ A;  4CUQ A;  2L84 A;  3LQJ A;  5LKU A;  4QSV A;  3SVG A;  3LQH A;  4NQM A;  3O36 A;  4FLP A;  3UVY A;  5D3N A;  4AKG A;  4IR6 A;  4J3I A;  5HEM A;  3MB3 A;  5ENJ A;  5DFD A;  4YYM A;  4PTB A;  5HRX A;  1ZS5 A;  5KU3 A;  5FG6 A;  3UVX A;  5FE1 A;  5ACY A;  4N4G A;  5BT4 A;  1JSP B;  5IG6 A;  4QST A;  5FFY A;  2WP1 A;  4LYW A;  5FH7 A;  2DVQ A;  4NQN A;  5DFB A;  4NRA A;  4O71 A;  5D3T A;  4A9I A;  1PUO A;  5I29 A;  4IOQ A;  4YYJ A;  1JM4 B;  4O7B A;  5CTL A;  5EPR A;  4HXO A;  5E73 A;  5A83 A;  3G0L A;  5FE9 A;  5ETB A;  5FE6 A;  4IOO A;  5F36 A;  5A81 A;  5E74 A;  3P1D A;  4CL9 A;  5CZG A;  4LYS A;  5EIS A;  5D25 A;  5DW1 A;  2RNW A;  4NYV A;  5DX4 A;  5FE0 A;  2RI7 A;  5HRV A;  4UIZ A;  3MUK A;  2FSA A;  4HXR A;  5C8G A;  2R10 A;  3HME A;  5D7X A;  3DWY A;  2YEK A;  4MR4 A;  5A85 A;  4TZ8 A;  4O78 A;  4QEW A;  4HXL A;  5BT3 A;  3VKH A;  2DVR A;  5EGU A;  5FG4 A;  1WUM A;  3JVM A;  4TT6 A;  5LUU A;  2R0Y A;  2N9G A;  5A5O A;  2D9E A;  3D1D A;  4TU4 A;  5CUC A;  3P1F A;  5KTW A;  3O33 A;  2E7N A;  5I88 A;  4A9O A;  4YY6 A;  5F1H A;  4BW4 A;  3U5K A;  2F6N A;  5KHM A;  4J0R A;  4YBT A;  3S92 A;  5DKH A;  4CLB A;  4QZS A;  3LQI A;  5DYX A;  5ENI A;  5I7Y A;  4YC9 A;  4O7A A;  3JVL A;  4YBS A;  5HQ6 A;  2DKW A;  5D24 A;  4LZR A;  4QB3 A;  4YH4 A;  5LVR A;  5HFR A;  5I1Q A;  3QZV A;  5L97 A;  5FB1 A;  4UYD A;  4Z6H A;  4WIV A;  4CUR A;  5CS8 A;  5BT5 A;  3GG3 A;  5E3G A;  3HMH A;  4HXP A;  4LZ2 A;  4IR5 A;  5FFV A;  3G0J A;  2RO1 A;  5CUE A;  4ALG A;  4NRB A;  4NUC A;  4LR6 A;  4UIT A;  5FH8 A;  5D3S A;  4XYA A;  2YQD A;  5HCL A;  2YEM A;  4UYH A;  4HBW A;  5A7C A;  4Z1Q A;  5IGL A;  4N4F A;  4HBY A;  4LDF A;  5I89 A;  4XY8 A;  4YYD A;  3U5L A;  4A9E A;  5EPS A;  1E6I A;  4QEU A;  3RCW A;  4MEO A;  4OUF A;  5LJ2 A;  5DYU A;  5CRM A;  4MR6 A;  3UV5 A;  5JWM A;  5ENB A;  4HXM A;  5E9Y A;  5CY9 A;  5DLZ A;  2WP2 A;  5CP5 A;  5L98 A;  2DWW A;  3LJW A;  3U5M A;  5AD2 A;  5CQT A;  4NS5 A;  4QSX A;  4WHW A;  5CQA A;  4QR5 A;  1F68 A;  5E9V A;  5ENC A;  4HBX A;  5IGM A;  4TT2 A;  4PKL A;  5K29 A;  5LKZ A;  4RVR A;  5KO4 A;  4YH3 A;  5E0R A;  5HFQ A;  5HRW A;  5E3D A;  5DYC A;  4KV1 A;  4QSU A;  5TB6 A;  3VKG A;  4QSS A;  4UIU A;  4YYH A;  4TS8 A;  4QC3 A;  4CUP A;  5IGK A;  2I8N A;  5IID A;  1EQF A;  4ZW1 A;  4UYE A;  4ZQL A;  5FDZ A;  5H1V A;  4AKH A;  5F2P A;  4Q0N A;  5EM3 A;  4HXN A;  3U5O A;  3O34 A;  3S91 A;  4KV4 A;  4MR5 A;  2MJV B;  2YDW A;  4NUD A;  4YAT A;  5H85 A;  4ZC9 A;  5CRZ A;  3U5J A;  4YYI A;  5E9I A;  4QBM A;  5D3H A;  4NUE A;  5ENF A;  2I7K A;  4CUS A;  4NR6 A;  5FE7 A;  5LKX A;  5D3J A;  5FE4 A;  4QSR A; 
#chains in the Genus database with same CATH homology
 2R0S A;  4TT4 A;  4KCX A;  4NYX A;  4BW1 A;  4CFK A;  2L85 A;  4QR4 A;  3MXF A;  4QSQ A;  4O7F A;  4UIX A;  4CFL A;  4QYD A;  5FE2 A;  5L8U A;  3P1E A;  4O75 A;  5I80 A;  5DLX A;  4QY4 A;  5FG5 A;  3MQM A;  5CQ6 A;  4YYG A;  5KTX A;  4NXJ A;  4QSW A;  5CQ8 A;  3UV2 A;  3HMF A;  4YYN A;  4ALH A;  3I3J A;  3UW9 A;  4O72 A;  5F63 A;  4N4I A;  3DAI A;  4F3I A;  2YEL A;  5FBX A;  4NRC A;  4A9H A;  2E7O A;  5EWW A;  4LRG A;  5DBM A;  5CGP A;  4TZ2 A;  4O7E A;  5I86 A;  3FKM X;  3UV4 A;  5LJ1 A;  5II1 A;  4TYL A;  3JVK A;  4NYW A;  4Z93 A;  3P5O A;  3JVJ A;  4DON A;  5C4Q A;  2LSP B;  4WHU A;  4GPJ A;  2DAT A;  4Z1S A;  4A9N A;  5HLS A;  4TU6 A;  2RNX A;  5EWD A;  5EK9 A;  3IU5 A;  4O74 A;  5C7N A;  2RNY A;  1N72 A;  5CQ7 A;  4Z6I A;  5E7D A;  3NXB A;  4UIW A;  5C87 A;  5FE8 A;  4IR4 A;  4X2I A;  5DY7 A;  5EWH A;  5EPB A;  5FFW A;  4QC1 A;  4C67 A;  2F6J A;  4UYG A;  2E3K A;  5FB0 A;  5HJC A;  5F3A A;  4CUT A;  2YW5 A;  5A82 A;  5I7X A;  3ONI A;  4J0S A;  5FH6 A;  2KTB B;  5CUA A;  4NR4 A;  5ENE A;  2OUO A;  4MR3 A;  4A9K A;  5ENG A;  3D7C A;  4PS5 A;  3SVF A;  4NR5 A;  4TTE A;  5F61 A;  3K2J A;  5E9M A;  5DFC A;  4PCI A;  5HEN A;  2NXB A;  2H60 A;  2L5E A;  5EIC A;  4QNS A;  4YYK A;  4A9J A;  5DKC A;  3QZS A;  4A9L A;  2D82 A;  4NR7 A;  5FE3 A;  5HQ7 A;  5E9L A;  4XUB A;  4CUU A;  5LKT A;  5EWV A;  3AQA A;  3O37 A;  3AAD A;  5DYA A;  4AKN A;  4UYF B;  4O76 A;  3UVW A;  2DVV A;  5HEL A;  4O70 A;  4MEP A;  5EA1 A;  5H1U A;  3SVH A;  3TLP A;  4YK0 A;  5AD3 A;  5C89 A;  4LZS A;  5L96 A;  4A9F A;  3Q2F A;  1WUG A;  4MEQ A;  3MUL A;  5CU8 A;  5EP7 A;  4A9M A;  5FE5 A;  5AMF A;  5F62 A;  4N4H A;  5IBN A;  5A5Q A;  3UVD A;  4OGI A;  4Y03 A;  5CUD A;  5J0D A;  4O77 A;  4YAX A;  5EVA A;  4C66 A;  4IR3 A;  4YBM A;  5C85 A;  4O7C A;  4MEN A;  4E96 A;  4QYL A;  4LC2 A;  5F60 A;  4Q0O A;  5I40 A;  5CFW A;  2G4A A;  4QUT A;  5G4S A;  4YAB A;  4QUU A;  3U5P A;  5COI A;  5F1L A;  5H1T A;  4UYF A;  4BW3 A;  5A5N A;  5DW2 A;  4IOR A;  5EU1 A;  2DVS A;  5F5Z A;  4YY4 A;  5L99 A;  5KTU A;  5CUB A;  4UIY A;  4LYI A;  5D3R A;  5HQ5 A;  2RFJ A;  4NR9 A;  4BW2 A;  3ZYU A;  5ETD A;  5A5S A;  5D26 A;  2GRC A;  4OGJ A;  4QSP A;  2OSS A;  5DKD A;  5D0C A;  2YYN A;  4XY9 A;  5D3P A;  4HXK A;  5L8T A;  4HXS A;  4TQN A;  5TCM A;  5CPE A;  1X0J A;  5A5P A;  2RS9 B;  4QR3 A;  4N3W A;  5A5R A;  4NR8 A;  4QEV A;  5EV9 A;  5CQ4 A;  5EI4 A;  5II2 A;  5IGN A;  5EWC A;  5CQ3 A;  3IU6 A;  5LJ0 A;  3Q2E A;  3LXJ A;  5D3L A;  5ENH A;  5AME A;  3U5N A;  3QZT A;  4BHW A;  4YAD A;  5F25 A;  5I83 A;  4UIV A;  5HM0 A;  4PY6 A;  5E9K A;  4J1P A;  5CUG A;  5G4R A;  3P1C A;  4XUA A;  5CQ5 A;  5EQ1 A;  3O35 A;  3MB4 A;  4BJX A;  2OO1 A;  4HBV A;  2R0V A;  5JI8 A;  4PCE A;  5LVQ A;  4CUQ A;  2L84 A;  3LQJ A;  5LKU A;  4QSV A;  3SVG A;  3LQH A;  4NQM A;  3O36 A;  4FLP A;  3UVY A;  5D3N A;  4IR6 A;  4J3I A;  5HEM A;  3MB3 A;  5ENJ A;  5DFD A;  4YYM A;  4PTB A;  5HRX A;  1ZS5 A;  5KU3 A;  5FG6 A;  3UVX A;  5FE1 A;  5ACY A;  4N4G A;  5BT4 A;  1JSP B;  5IG6 A;  4QST A;  5FFY A;  2WP1 A;  4LYW A;  5FH7 A;  2DVQ A;  4NQN A;  5DFB A;  4NRA A;  4O71 A;  5D3T A;  4A9I A;  5I29 A;  4IOQ A;  4YYJ A;  1JM4 B;  4O7B A;  5CTL A;  5EPR A;  4HXO A;  5E73 A;  5A83 A;  3G0L A;  5FE9 A;  5ETB A;  5FE6 A;  4IOO A;  5F36 A;  5A81 A;  5E74 A;  3P1D A;  4CL9 A;  5CZG A;  4LYS A;  5EIS A;  5D25 A;  5DW1 A;  2RNW A;  4NYV A;  5DX4 A;  5FE0 A;  2RI7 A;  5HRV A;  4UIZ A;  3MUK A;  2FSA A;  4HXR A;  5C8G A;  2R10 A;  3HME A;  5D7X A;  3DWY A;  2YEK A;  4MR4 A;  5A85 A;  4TZ8 A;  4O78 A;  4QEW A;  4HXL A;  5BT3 A;  2DVR A;  5EGU A;  5FG4 A;  1WUM A;  3JVM A;  4TT6 A;  5LUU A;  2R0Y A;  2N9G A;  5A5O A;  2D9E A;  4TU4 A;  5CUC A;  3P1F A;  5KTW A;  3O33 A;  2E7N A;  5I88 A;  4A9O A;  4YY6 A;  5F1H A;  4BW4 A;  3U5K A;  2F6N A;  5KHM A;  4J0R A;  4YBT A;  3S92 A;  5DKH A;  4CLB A;  4QZS A;  3LQI A;  5DYX A;  5ENI A;  5I7Y A;  4YC9 A;  4O7A A;  3JVL A;  4YBS A;  5HQ6 A;  2DKW A;  5D24 A;  4LZR A;  4QB3 A;  4YH4 A;  5LVR A;  5HFR A;  5I1Q A;  3QZV A;  5L97 A;  5FB1 A;  4UYD A;  4Z6H A;  4WIV A;  4CUR A;  5CS8 A;  5BT5 A;  3GG3 A;  5E3G A;  3HMH A;  4HXP A;  4LZ2 A;  4IR5 A;  5FFV A;  3G0J A;  2RO1 A;  5CUE A;  4ALG A;  4NRB A;  4NUC A;  4LR6 A;  4UIT A;  5FH8 A;  5D3S A;  4XYA A;  2YQD A;  5HCL A;  2YEM A;  4UYH A;  4HBW A;  5A7C A;  4Z1Q A;  5IGL A;  4N4F A;  4HBY A;  4LDF A;  5I89 A;  4XY8 A;  4YYD A;  3U5L A;  4A9E A;  5EPS A;  1E6I A;  4QEU A;  3RCW A;  4MEO A;  4OUF A;  5LJ2 A;  5DYU A;  5CRM A;  4MR6 A;  3UV5 A;  5JWM A;  5ENB A;  4HXM A;  5E9Y A;  5CY9 A;  5DLZ A;  2WP2 A;  5CP5 A;  5L98 A;  2DWW A;  3LJW A;  3U5M A;  5AD2 A;  5CQT A;  4NS5 A;  4QSX A;  4WHW A;  5CQA A;  4QR5 A;  1F68 A;  5E9V A;  5ENC A;  4HBX A;  5IGM A;  4TT2 A;  4PKL A;  5K29 A;  5LKZ A;  4RVR A;  5KO4 A;  4YH3 A;  5E0R A;  5HFQ A;  5HRW A;  5E3D A;  5DYC A;  4KV1 A;  4QSU A;  5TB6 A;  4QSS A;  4UIU A;  4YYH A;  4TS8 A;  4QC3 A;  4CUP A;  5IGK A;  2I8N A;  5IID A;  1EQF A;  4ZW1 A;  4UYE A;  4ZQL A;  5FDZ A;  5H1V A;  5F2P A;  4Q0N A;  5EM3 A;  4HXN A;  3U5O A;  3O34 A;  3S91 A;  4KV4 A;  4MR5 A;  2MJV B;  2YDW A;  4NUD A;  4YAT A;  5H85 A;  4ZC9 A;  5CRZ A;  3U5J A;  4YYI A;  5E9I A;  4QBM A;  5D3H A;  4NUE A;  5ENF A;  2I7K A;  4CUS A;  4NR6 A;  5FE7 A;  5LKX A;  5D3J A;  5FE4 A;  4QSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...