5FH6A

Crystal structure of the fifth bromodomain of human pb1 in complex with compound 10
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
111
structure length
111
Chain Sequence
KYMTPMQQKLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQDIDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein polybromo-1
publication title Identification and Development of 2,3-Dihydropyrrolo[1,2-a]quinazolin-5(1H)-one Inhibitors Targeting Bromodomains within the Switch/Sucrose Nonfermenting Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 111
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5fh6A00
4LDFA 2OSSA 4TQNA 4KCXA 5DKHA 4DONA 5L99A 4ZC9A 5FE6A 3MULA 5KTWA 5CQ7A 4UIZA 4WHUA 5FE3A 2RO1A 4N4FA 5DW1A 4TT4A 5TCMA 2GRCA 2YW5A 5CP5A 5A5SA 5DYUA 4N4IA 5DKDA 4HBXA 3I3JA 2LSPB 5LKTA 2I7KA 5EWWA 5COIA 2E7NA 4TU6A 5FE8A 4TYLA 4LYIA 5HLSA 5LKZA 5FE5A 5LVRA 4CURA 4IR4A 5E73A 3O37A 4CL9A 5L8UA 5CQ6A 5KO4A 3JVLA 5ENBA 4BW3A 5F63A 5AD3A 3MB4A 5CUAA 5CUGA 4AKNA 5A85A 4O7BA 5EU1A 5D24A 4WHWA 5EQ1A 5E9YA 4UIVA 4O72A 5HFQA 5DLZA 3UVXA 5AD2A 4O7EA 3JVJA 5KHMA 5H1VA 2KTBB 5L8TA 5FE1A 4QNSA 4CUSA 4NRCA 5F60A 2DWWA 4O74A 5A5PA 1E6IA 5EWVA 2R10A 5LJ0A 5L96A 5II2A 3UVWA 5A7CA 4C67A 4YABA 3U5JA 5E74A 3UW9A 5D3RA 4J0RA 5E3DA 2E3KA 4X2IA 2YELA 4UYEA 4HXMA 4HBYA 5F36A 3G0LA 5ENGA 3QZSA 4YYKA 5CQ3A 4ZQLA 5LVQA 5CZGA 5HELA 3QZTA 4LC2A 5CU8A 5FG4A 5CPEA 5CUEA 4LZ2A 4Q0NA 4QSPA 2R0YA 5FB1A 5AMFA 4YH4A 4QSQA 4NQNA 3IU5A 5EV9A 5I88A 4NYXA 4A9HA 4MEQA 4PY6A 5TB6A 5FE2A 3MQMA 2DKWA 5LKXA 1JSPB 3UVYA 5EWDA 4A9IA 5D3NA 4QBMA 4NYWA 2D82A 4QUUA 5HJCA 3RCWA 2DVRA 3U5NA 4QSTA 4QC1A 4XUAA 4A9OA 5KTXA 2DVQA 5C4QA 5A5QA 2RNWA 4NRAA 4N4HA 4QR4A 5IBNA 3O36A 4MENA 4QYLA 5KU3A 5DBMA 3U5LA 5C89A 5HENA 3UV5A 5I83A 4PS5A 4YYJA 5FE7A 4O70A 4IOQA 2L85A 5FE9A 4A9MA 5FE0A 2DVVA 4UIXA 2E7OA 4UYFB 4LYSA 4HXRA 5CS8A 4FLPA 5HCLA 5I7XA 3UV2A 4PCEA 5DKCA 4TZ2A 5EM3A 5ETBA 3HMFA 4Q0OA 5FB0A 4RVRA 4YYIA 3ZYUA 4CUQA 2RNYA 5I1QA 5C8GA 3NXBA 4QR3A 3TLPA 5I40A 4BW1A 3ONIA 4NQMA 3Q2FA 5D3HA 4YY6A 4TT2A 5DYAA 4BW4A 5F2PA 5EPBA 5F1LA 4QSWA 2G4AA 1N72A 5FH7A 1F68A 4J0SA 4YYNA 5EVAA 5FFWA 3AQAA 4QEVA 5F25A 4WIVA 5CGPA 4QEWA 3S92A 4BHWA 4QUTA 4NR4A 3MB3A 4NXJA 4TT6A 2DATA 2RI7A 4UYDA 5CFWA 3LQJA 3MXFA 4YBSA 4A9JA 4NS5A 5D25A 4NR7A 5D7XA 5EPRA 4A9LA 3S91A 4UIWA 5ENIA 2F6JA 5ENJA 5JI8A 4ZW1A 3UVDA 5FG5A 2N9GA 4NR8A 4CUUA 2WP2A 5CRMA 2RNXA 5E7DA 4QSUA 4IOOA 3QZVA 5HEMA 2I8NA 5CQTA 4XY9A 5A81A 4BJXA 4UYFA 5CUDA 4YYMA 3LJWA 4HXSA 4MEOA 5CQAA 5G4RA 5FH6A 5CQ8A 5BT3A 4PTBA 5H85A 4O76A 3GG3A 4TZ8A 4BW2A 4QSVA 5I80A 5CY9A 4OGIA 3JVMA 5ENFA 4YATA 5DFCA 3UV4A 5I7YA 4A9NA 5FFYA 5A5NA 3P1FA 4UIYA 4NR9A 4IR5A 3FKMX 2OUOA 4QZSA 3MUKA 5CUCA 5DFBA 4LR6A 2NXBA 5C85A 5II1A 4YAXA 3LXJA 5DYCA 4E96A 4LZSA 4YYGA 5EPSA 5ENHA 3U5MA 3SVFA 5HFRA 4CUPA 5FG6A 4YYHA 5FH8A 4MR3A 5EICA 5D3LA 5EWHA 5HQ5A 5I86A 4J1PA 5KTUA 3G0JA 2F6NA 3LQHA 3Q2EA 5CUBA 5E3GA 5I89A 4QR5A 4NR6A 4NUEA 4NR5A 4CFLA 4UIUA 5E9IA 4MR4A 5IGLA 2MJVB 4UYGA 5EK9A 5BT4A 4MR5A 5DLXA 4KV4A 4C66A 4YYDA 4A9KA 4YK0A 5I29A 5F5ZA 5G4SA 5DW2A 5E0RA 5D0CA 4HBVA 1X0JA 2DVSA 2YEKA 4QSRA 1ZS5A 4TS8A 5FE4A 4HXOA 5LJ1A 2RFJA 3P5OA 5LJ2A 4N3WA 4HBWA 2R0SA 2WP1A 3SVHA 4QY4A 4HXNA 5C7NA 5FFVA 4A9FA 5HRWA 5EP7A 5LUUA 5K29A 2YYNA 2OO1A 3O33A 3O34A 5EWCA 2L5EA 5F62A 5EISA 2R0VA 5DY7A 5F61A 5CQ5A 4ALHA 4IR6A 4LYWA 3DAIA 5A82A 5D3SA 5ENEA 3U5PA 3HMEA 5HM0A 5A83A 1WUMA 4O7FA 5ENCA 5E9LA 5F3AA 1WUGA 4O77A 3HMHA 5EGUA 5A5OA 5HQ7A 5A5RA 4O7CA 4LZRA 5HRXA 4NUDA 4QC3A 4YH3A 4TTEA 4LRGA 4MEPA 4N4GA 4QEUA 1JM4B 5H1TA 5IGMA 3LQIA 3SVGA 5F1HA 4O78A 4CFKA 4YBMA 5E9MA 4ALGA 5L98A 2YQDA 4Z1QA 4PKLA 5L97A 4QYDA 5C87A 5IIDA 5AMEA 5ACYA 4HXLA 4XYAA 5D26A 2H60A 2YEMA 4QB3A 5DYXA 5DX4A 4Z6IA 4O75A 4UYHA 4YBTA 5H1UA 5E9KA 3U5OA 4O71A 4YADA 4Z93A 5FBXA 3IU6A 4HXPA 4MR6A 4IORA 5ETDA 4XUBA 2D9EA 5EI4A 4J3IA 4Z6HA 3JVKA 3P1EA 5D3TA 4KV1A 4NUCA 5D3PA 5HRVA 2FSAA 4OUFA 4NRBA 5IG6A 3P1CA 3O35A 4QSSA 4CUTA 5EA1A 4O7AA 4CLBA 3AADA 5CRZA 2YDWA 4NYVA 3D7CA 4F3IA 3K2JA 5E9VA 5IGNA 4YC9A 5D3JA 2RS9B 5J0DA 3DWYA 5CTLA 4IR3A 4YY4A 4GPJA 4Y03A 4UITA 5JWMA 5HQ6A 5FDZA 3P1DA 5BT5A 5IGKA 5LKUA 4A9EA 2L84A 5DFDA 4TU4A 4OGJA 1EQFA 4QSXA 4XY8A 4Z1SA 5CQ4A 4HXKA 3U5KA 4PCIA
chains in the Genus database with same CATH superfamily
4LDFA 2OSSA 4TQNA 4KCXA 5DKHA 4DONA 5L99A 4ZC9A 5FE6A 3MULA 5KTWA 5CQ7A 4UIZA 4WHUA 5FE3A 2RO1A 4N4FA 5DW1A 4TT4A 5TCMA 2GRCA 2YW5A 5CP5A 5A5SA 5DYUA 4N4IA 5DKDA 4HBXA 3I3JA 2LSPB 5LKTA 2I7KA 5EWWA 5COIA 2E7NA 4TU6A 5FE8A 4TYLA 4LYIA 5HLSA 5LKZA 5FE5A 5LVRA 4CURA 4IR4A 5E73A 3O37A 4CL9A 5L8UA 5CQ6A 5KO4A 3JVLA 5ENBA 4BW3A 5F63A 5AD3A 3MB4A 5CUAA 5CUGA 4AKNA 5A85A 4O7BA 5EU1A 5D24A 4WHWA 5EQ1A 5E9YA 4UIVA 4O72A 5HFQA 5DLZA 3UVXA 5AD2A 4O7EA 3JVJA 5KHMA 5H1VA 2KTBB 5L8TA 5FE1A 4AKIA 4QNSA 4CUSA 4NRCA 5F60A 2DWWA 4O74A 5A5PA 1E6IA 3VKHA 5EWVA 2R10A 5LJ0A 5L96A 5II2A 3UVWA 5A7CA 4C67A 4YABA 3U5JA 5E74A 3UW9A 5D3RA 4J0RA 5E3DA 2E3KA 4X2IA 2YELA 4UYEA 4HXMA 4HBYA 5F36A 3G0LA 5ENGA 3QZSA 4YYKA 4AI6A 5CQ3A 4ZQLA 5LVQA 5CZGA 5HELA 3QZTA 4LC2A 5CU8A 5FG4A 5CPEA 5CUEA 4LZ2A 4Q0NA 4QSPA 2R0YA 5FB1A 5AMFA 4YH4A 4QSQA 4NQNA 3IU5A 5EV9A 5I88A 4NYXA 4A9HA 4MEQA 4PY6A 5TB6A 5FE2A 3MQMA 2DKWA 5LKXA 1JSPB 3UVYA 5EWDA 4A9IA 5D3NA 4QBMA 4NYWA 2D82A 4QUUA 5HJCA 3RCWA 2DVRA 3U5NA 4QSTA 4QC1A 4XUAA 4A9OA 5KTXA 2DVQA 5C4QA 5A5QA 2RNWA 4NRAA 4N4HA 4QR4A 5IBNA 3O36A 4MENA 4QYLA 5KU3A 5DBMA 3U5LA 5C89A 5HENA 3UV5A 5I83A 4PS5A 4YYJA 5FE7A 4O70A 4IOQA 2L85A 5FE9A 4A9MA 5FE0A 2DVVA 4UIXA 2E7OA 4UYFB 4LYSA 4HXRA 5CS8A 4FLPA 5HCLA 5I7XA 3UV2A 4PCEA 5DKCA 4TZ2A 5EM3A 5ETBA 3HMFA 4Q0OA 5FB0A 4RVRA 4YYIA 3ZYUA 4CUQA 2RNYA 5I1QA 5C8GA 3NXBA 4QR3A 3TLPA 5I40A 4BW1A 3ONIA 4NQMA 3Q2FA 5D3HA 4YY6A 4TT2A 5DYAA 4BW4A 5F2PA 5EPBA 5F1LA 4QSWA 2G4AA 1N72A 5FH7A 1F68A 4J0SA 4YYNA 3D1BA 5EVAA 5FFWA 3AQAA 4QEVA 5F25A 4WIVA 5CGPA 4QEWA 3S92A 4BHWA 4QUTA 4NR4A 3MB3A 4NXJA 4TT6A 2DATA 2RI7A 4UYDA 5CFWA 3LQJA 3MXFA 4YBSA 4A9JA 4NS5A 5D25A 4NR7A 5D7XA 5EPRA 4A9LA 3S91A 4UIWA 5ENIA 2F6JA 5ENJA 5JI8A 4ZW1A 3UVDA 5FG5A 2N9GA 4NR8A 4CUUA 2WP2A 5CRMA 2RNXA 5E7DA 4QSUA 4IOOA 3QZVA 5HEMA 2I8NA 5CQTA 4XY9A 5A81A 4BJXA 4UYFA 5CUDA 4YYMA 3LJWA 4HXSA 4MEOA 5CQAA 5G4RA 5FH6A 5CQ8A 5BT3A 4PTBA 5H85A 4O76A 3GG3A 4TZ8A 4BW2A 4QSVA 5I80A 5CY9A 4OGIA 3JVMA 5ENFA 4YATA 5DFCA 3UV4A 5I7YA 4A9NA 5FFYA 5A5NA 3P1FA 4UIYA 4NR9A 4IR5A 3FKMX 2OUOA 4QZSA 3MUKA 5CUCA 1ZKRA 5DFBA 4LR6A 2NXBA 5C85A 5II1A 4YAXA 3LXJA 5DYCA 4E96A 4LZSA 4YYGA 5EPSA 5ENHA 3U5MA 3SVFA 5HFRA 4CUPA 5FG6A 4YYHA 5FH8A 4MR3A 5EICA 5D3LA 5EWHA 5HQ5A 5I86A 4J1PA 5KTUA 3G0JA 2F6NA 3LQHA 3Q2EA 5CUBA 5E3GA 5I89A 4QR5A 4NR6A 4NUEA 4NR5A 4CFLA 4UIUA 5E9IA 4MR4A 5IGLA 2MJVB 4UYGA 5EK9A 5BT4A 4MR5A 5DLXA 4KV4A 4C66A 4YYDA 4A9KA 4YK0A 5I29A 5F5ZA 5G4SA 5DW2A 5E0RA 5D0CA 4HBVA 3D1DA 3VKGA 1X0JA 2DVSA 2YEKA 4QSRA 1ZS5A 4TS8A 5FE4A 4HXOA 5LJ1A 2RFJA 3P5OA 5LJ2A 4N3WA 4HBWA 2R0SA 2WP1A 3SVHA 4QY4A 3ERRA 4HXNA 5C7NA 5FFVA 4A9FA 5HRWA 5EP7A 5LUUA 5K29A 2YYNA 2OO1A 3O33A 3O34A 5EWCA 2L5EA 5F62A 5EISA 2R0VA 1PUOA 5DY7A 5F61A 5CQ5A 4ALHA 4IR6A 4LYWA 3DAIA 5A82A 5D3SA 5ENEA 3U5PA 3HMEA 5HM0A 5A83A 1WUMA 4O7FA 2EJNA 5ENCA 5E9LA 5F3AA 1WUGA 4O77A 3HMHA 5EGUA 5A5OA 5HQ7A 5A5RA 4O7CA 4LZRA 5HRXA 4NUDA 4QC3A 4YH3A 4TTEA 4LRGA 4MEPA 4N4GA 4QEUA 1JM4B 5H1TA 5IGMA 3LQIA 3SVGA 5F1HA 4O78A 4CFKA 4YBMA 5E9MA 4ALGA 5L98A 2YQDA 4Z1QA 4PKLA 5L97A 4QYDA 5C87A 5IIDA 5AMEA 5ACYA 4HXLA 4XYAA 5D26A 2H60A 2YEMA 4QB3A 5DYXA 5DX4A 4Z6IA 4O75A 4UYHA 4YBTA 5H1UA 5E9KA 3U5OA 4O71A 4YADA 4Z93A 4AKHA 5FBXA 3IU6A 4HXPA 4MR6A 4IORA 5ETDA 4XUBA 2D9EA 5EI4A 4J3IA 4Z6HA 3JVKA 3P1EA 5D3TA 4KV1A 4NUCA 5D3PA 5HRVA 2FSAA 4OUFA 4NRBA 5IG6A 3P1CA 3O35A 4QSSA 4CUTA 5EA1A 4O7AA 4CLBA 3AADA 5CRZA 2YDWA 4NYVA 3D7CA 4F3IA 3K2JA 5E9VA 5IGNA 4YC9A 4AKGA 5D3JA 2RS9B 5J0DA 3DWYA 5CTLA 4IR3A 4YY4A 4GPJA 4Y03A 4UITA 5JWMA 5HQ6A 5FDZA 3P1DA 5BT5A 5IGKA 5LKUA 4A9EA 2L84A 5DFDA 4TU4A 4OGJA 1EQFA 4QSXA 4XY8A 4Z1SA 5CQ4A 4HXKA 3U5KA 4PCIA
chains in the Genus database with same CATH topology
4LDFA 2OSSA 4TQNA 4KCXA 5DKHA 4DONA 5L99A 4ZC9A 5FE6A 3MULA 5KTWA 5CQ7A 4UIZA 4WHUA 5FE3A 2RO1A 4N4FA 5DW1A 4TT4A 5TCMA 2GRCA 2YW5A 5CP5A 5A5SA 5DYUA 4N4IA 5DKDA 4HBXA 3I3JA 2LSPB 5LKTA 2I7KA 5EWWA 5COIA 2E7NA 4TU6A 5FE8A 4TYLA 4LYIA 5HLSA 5LKZA 5FE5A 5LVRA 4CURA 4IR4A 5E73A 3O37A 4CL9A 5L8UA 5CQ6A 5KO4A 3JVLA 5ENBA 4BW3A 5F63A 5AD3A 3MB4A 5CUAA 5CUGA 4AKNA 5A85A 4O7BA 5EU1A 5D24A 4WHWA 5EQ1A 5E9YA 4UIVA 4O72A 5HFQA 5DLZA 3UVXA 5AD2A 4O7EA 3JVJA 5KHMA 5H1VA 2KTBB 5L8TA 5FE1A 4QNSA 4CUSA 4NRCA 5F60A 2DWWA 4O74A 5A5PA 1E6IA 5EWVA 2R10A 5LJ0A 5L96A 5II2A 3UVWA 5A7CA 4C67A 4YABA 3U5JA 5E74A 3UW9A 5D3RA 4J0RA 5E3DA 2E3KA 4X2IA 2YELA 4UYEA 4HXMA 4HBYA 5F36A 3G0LA 5ENGA 3QZSA 4YYKA 5CQ3A 4ZQLA 5LVQA 5CZGA 5HELA 3QZTA 4LC2A 5CU8A 5FG4A 5CPEA 5CUEA 4LZ2A 4Q0NA 4QSPA 2R0YA 5FB1A 5AMFA 4YH4A 4QSQA 4NQNA 3IU5A 5EV9A 5I88A 4NYXA 4A9HA 4MEQA 4PY6A 5TB6A 5FE2A 3MQMA 2DKWA 5LKXA 1JSPB 3UVYA 5EWDA 4A9IA 5D3NA 4QBMA 4NYWA 2D82A 4QUUA 5HJCA 3RCWA 2DVRA 3U5NA 4QSTA 4QC1A 4XUAA 4A9OA 5KTXA 2DVQA 5C4QA 5A5QA 2RNWA 4NRAA 4N4HA 4QR4A 5IBNA 3O36A 4MENA 4QYLA 5KU3A 5DBMA 3U5LA 5C89A 5HENA 3UV5A 5I83A 4PS5A 4YYJA 5FE7A 4O70A 4IOQA 2L85A 5FE9A 4A9MA 5FE0A 2DVVA 4UIXA 2E7OA 4UYFB 4LYSA 4HXRA 5CS8A 4FLPA 5HCLA 5I7XA 3UV2A 4PCEA 5DKCA 4TZ2A 5EM3A 5ETBA 3HMFA 4Q0OA 5FB0A 4RVRA 4YYIA 3ZYUA 4CUQA 2RNYA 5I1QA 5C8GA 3NXBA 4QR3A 3TLPA 5I40A 4BW1A 3ONIA 4NQMA 3Q2FA 5D3HA 4YY6A 4TT2A 5DYAA 4BW4A 5F2PA 5EPBA 5F1LA 4QSWA 2G4AA 1N72A 5FH7A 1F68A 4J0SA 4YYNA 5EVAA 5FFWA 3AQAA 4QEVA 5F25A 4WIVA 5CGPA 4QEWA 3S92A 4BHWA 4QUTA 4NR4A 3MB3A 4NXJA 4TT6A 2DATA 2RI7A 4UYDA 5CFWA 3LQJA 3MXFA 4YBSA 4A9JA 4NS5A 5D25A 4NR7A 5D7XA 5EPRA 4A9LA 3S91A 4UIWA 5ENIA 2F6JA 5ENJA 5JI8A 4ZW1A 3UVDA 5FG5A 2N9GA 4NR8A 4CUUA 2WP2A 5CRMA 2RNXA 5E7DA 4QSUA 4IOOA 3QZVA 5HEMA 2I8NA 5CQTA 4XY9A 5A81A 4BJXA 4UYFA 5CUDA 4YYMA 3LJWA 4HXSA 4MEOA 5CQAA 5G4RA 5FH6A 5CQ8A 5BT3A 4PTBA 5H85A 4O76A 3GG3A 4TZ8A 4BW2A 4QSVA 5I80A 5CY9A 4OGIA 3JVMA 5ENFA 4YATA 5DFCA 3UV4A 5I7YA 4A9NA 5FFYA 5A5NA 3P1FA 4UIYA 4NR9A 4IR5A 3FKMX 2OUOA 4QZSA 3MUKA 5CUCA 5DFBA 4LR6A 2NXBA 5C85A 5II1A 4YAXA 3LXJA 5DYCA 4E96A 4LZSA 4YYGA 5EPSA 5ENHA 3U5MA 3SVFA 5HFRA 4CUPA 5FG6A 4YYHA 5FH8A 4MR3A 5EICA 5D3LA 5EWHA 5HQ5A 5I86A 4J1PA 5KTUA 3G0JA 2F6NA 3LQHA 3Q2EA 5CUBA 5E3GA 5I89A 4QR5A 4NR6A 4NUEA 4NR5A 4CFLA 4UIUA 5E9IA 4MR4A 5IGLA 2MJVB 4UYGA 5EK9A 5BT4A 4MR5A 5DLXA 4KV4A 4C66A 4YYDA 4A9KA 4YK0A 5I29A 5F5ZA 5G4SA 5DW2A 5E0RA 5D0CA 4HBVA 1X0JA 2DVSA 2YEKA 4QSRA 1ZS5A 4TS8A 5FE4A 4HXOA 5LJ1A 2RFJA 3P5OA 5LJ2A 4N3WA 4HBWA 2R0SA 2WP1A 3SVHA 4QY4A 4HXNA 5C7NA 5FFVA 4A9FA 5HRWA 5EP7A 5LUUA 5K29A 2YYNA 2OO1A 3O33A 3O34A 5EWCA 2L5EA 5F62A 5EISA 2R0VA 5DY7A 5F61A 5CQ5A 4ALHA 4IR6A 4LYWA 3DAIA 5A82A 5D3SA 5ENEA 3U5PA 3HMEA 5HM0A 5A83A 1WUMA 4O7FA 5ENCA 5E9LA 5F3AA 1WUGA 4O77A 3HMHA 5EGUA 5A5OA 5HQ7A 5A5RA 4O7CA 4LZRA 5HRXA 4NUDA 4QC3A 4YH3A 4TTEA 4LRGA 4MEPA 4N4GA 4QEUA 1JM4B 5H1TA 5IGMA 3LQIA 3SVGA 5F1HA 4O78A 4CFKA 4YBMA 5E9MA 4ALGA 5L98A 2YQDA 4Z1QA 4PKLA 5L97A 4QYDA 5C87A 5IIDA 5AMEA 5ACYA 4HXLA 4XYAA 5D26A 2H60A 2YEMA 4QB3A 5DYXA 5DX4A 4Z6IA 4O75A 4UYHA 4YBTA 5H1UA 5E9KA 3U5OA 4O71A 4YADA 4Z93A 5FBXA 3IU6A 4HXPA 4MR6A 4IORA 5ETDA 4XUBA 2D9EA 5EI4A 4J3IA 4Z6HA 3JVKA 3P1EA 5D3TA 4KV1A 4NUCA 5D3PA 5HRVA 2FSAA 4OUFA 4NRBA 5IG6A 3P1CA 3O35A 4QSSA 4CUTA 5EA1A 4O7AA 4CLBA 3AADA 5CRZA 2YDWA 4NYVA 3D7CA 4F3IA 3K2JA 5E9VA 5IGNA 4YC9A 5D3JA 2RS9B 5J0DA 3DWYA 5CTLA 4IR3A 4YY4A 4GPJA 4Y03A 4UITA 5JWMA 5HQ6A 5FDZA 3P1DA 5BT5A 5IGKA 5LKUA 4A9EA 2L84A 5DFDA 4TU4A 4OGJA 1EQFA 4QSXA 4XY8A 4Z1SA 5CQ4A 4HXKA 3U5KA 4PCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDF A;  2OSS A;  4TQN A;  4KCX A;  5DKH A;  4DON A;  5L99 A;  4ZC9 A;  5FE6 A;  3MUL A;  5KTW A;  5CQ7 A;  4UIZ A;  4WHU A;  5FE3 A;  2RO1 A;  4N4F A;  5DW1 A;  4TT4 A;  5TCM A;  2GRC A;  2YW5 A;  5CP5 A;  5A5S A;  5DYU A;  4N4I A;  5DKD A;  4HBX A;  3I3J A;  2LSP B;  5LKT A;  2I7K A;  5EWW A;  5COI A;  2E7N A;  4TU6 A;  5FE8 A;  4TYL A;  4LYI A;  5HLS A;  5LKZ A;  5FE5 A;  5LVR A;  4CUR A;  4IR4 A;  5E73 A;  3O37 A;  4CL9 A;  5L8U A;  5CQ6 A;  5KO4 A;  3JVL A;  5ENB A;  4BW3 A;  5F63 A;  5AD3 A;  3MB4 A;  5CUA A;  5CUG A;  4AKN A;  5A85 A;  4O7B A;  5EU1 A;  5D24 A;  4WHW A;  5EQ1 A;  5E9Y A;  4UIV A;  4O72 A;  5HFQ A;  5DLZ A;  3UVX A;  5AD2 A;  4O7E A;  3JVJ A;  5KHM A;  5H1V A;  2KTB B;  5L8T A;  5FE1 A;  4QNS A;  4CUS A;  4NRC A;  5F60 A;  2DWW A;  4O74 A;  5A5P A;  1E6I A;  5EWV A;  2R10 A;  5LJ0 A;  5L96 A;  5II2 A;  3UVW A;  5A7C A;  4C67 A;  4YAB A;  3U5J A;  5E74 A;  3UW9 A;  5D3R A;  4J0R A;  5E3D A;  2E3K A;  4X2I A;  2YEL A;  4UYE A;  4HXM A;  4HBY A;  5F36 A;  3G0L A;  5ENG A;  3QZS A;  4YYK A;  5CQ3 A;  4ZQL A;  5LVQ A;  5CZG A;  5HEL A;  3QZT A;  4LC2 A;  5CU8 A;  5FG4 A;  5CPE A;  5CUE A;  4LZ2 A;  4Q0N A;  4QSP A;  2R0Y A;  5FB1 A;  5AMF A;  4YH4 A;  4QSQ A;  4NQN A;  3IU5 A;  5EV9 A;  5I88 A;  4NYX A;  4A9H A;  4MEQ A;  4PY6 A;  5TB6 A;  5FE2 A;  3MQM A;  2DKW A;  5LKX A;  1JSP B;  3UVY A;  5EWD A;  4A9I A;  5D3N A;  4QBM A;  4NYW A;  2D82 A;  4QUU A;  5HJC A;  3RCW A;  2DVR A;  3U5N A;  4QST A;  4QC1 A;  4XUA A;  4A9O A;  5KTX A;  2DVQ A;  5C4Q A;  5A5Q A;  2RNW A;  4NRA A;  4N4H A;  4QR4 A;  5IBN A;  3O36 A;  4MEN A;  4QYL A;  5KU3 A;  5DBM A;  3U5L A;  5C89 A;  5HEN A;  3UV5 A;  5I83 A;  4PS5 A;  4YYJ A;  5FE7 A;  4O70 A;  4IOQ A;  2L85 A;  5FE9 A;  4A9M A;  5FE0 A;  2DVV A;  4UIX A;  2E7O A;  4UYF B;  4LYS A;  4HXR A;  5CS8 A;  4FLP A;  5HCL A;  5I7X A;  3UV2 A;  4PCE A;  5DKC A;  4TZ2 A;  5EM3 A;  5ETB A;  3HMF A;  4Q0O A;  5FB0 A;  4RVR A;  4YYI A;  3ZYU A;  4CUQ A;  2RNY A;  5I1Q A;  5C8G A;  3NXB A;  4QR3 A;  3TLP A;  5I40 A;  4BW1 A;  3ONI A;  4NQM A;  3Q2F A;  5D3H A;  4YY6 A;  4TT2 A;  5DYA A;  4BW4 A;  5F2P A;  5EPB A;  5F1L A;  4QSW A;  2G4A A;  1N72 A;  5FH7 A;  1F68 A;  4J0S A;  4YYN A;  5EVA A;  5FFW A;  3AQA A;  4QEV A;  5F25 A;  4WIV A;  5CGP A;  4QEW A;  3S92 A;  4BHW A;  4QUT A;  4NR4 A;  3MB3 A;  4NXJ A;  4TT6 A;  2DAT A;  2RI7 A;  4UYD A;  5CFW A;  3LQJ A;  3MXF A;  4YBS A;  4A9J A;  4NS5 A;  5D25 A;  4NR7 A;  5D7X A;  5EPR A;  4A9L A;  3S91 A;  4UIW A;  5ENI A;  2F6J A;  5ENJ A;  5JI8 A;  4ZW1 A;  3UVD A;  5FG5 A;  2N9G A;  4NR8 A;  4CUU A;  2WP2 A;  5CRM A;  2RNX A;  5E7D A;  4QSU A;  4IOO A;  3QZV A;  5HEM A;  2I8N A;  5CQT A;  4XY9 A;  5A81 A;  4BJX A;  4UYF A;  5CUD A;  4YYM A;  3LJW A;  4HXS A;  4MEO A;  5CQA A;  5G4R A;  5FH6 A;  5CQ8 A;  5BT3 A;  4PTB A;  5H85 A;  4O76 A;  3GG3 A;  4TZ8 A;  4BW2 A;  4QSV A;  5I80 A;  5CY9 A;  4OGI A;  3JVM A;  5ENF A;  4YAT A;  5DFC A;  3UV4 A;  5I7Y A;  4A9N A;  5FFY A;  5A5N A;  3P1F A;  4UIY A;  4NR9 A;  4IR5 A;  3FKM X;  2OUO A;  4QZS A;  3MUK A;  5CUC A;  5DFB A;  4LR6 A;  2NXB A;  5C85 A;  5II1 A;  4YAX A;  3LXJ A;  5DYC A;  4E96 A;  4LZS A;  4YYG A;  5EPS A;  5ENH A;  3U5M A;  3SVF A;  5HFR A;  4CUP A;  5FG6 A;  4YYH A;  5FH8 A;  4MR3 A;  5EIC A;  5D3L A;  5EWH A;  5HQ5 A;  5I86 A;  4J1P A;  5KTU A;  3G0J A;  2F6N A;  3LQH A;  3Q2E A;  5CUB A;  5E3G A;  5I89 A;  4QR5 A;  4NR6 A;  4NUE A;  4NR5 A;  4CFL A;  4UIU A;  5E9I A;  4MR4 A;  5IGL A;  2MJV B;  4UYG A;  5EK9 A;  5BT4 A;  4MR5 A;  5DLX A;  4KV4 A;  4C66 A;  4YYD A;  4A9K A;  4YK0 A;  5I29 A;  5F5Z A;  5G4S A;  5DW2 A;  5E0R A;  5D0C A;  4HBV A;  1X0J A;  2DVS A;  2YEK A;  4QSR A;  1ZS5 A;  4TS8 A;  5FE4 A;  4HXO A;  5LJ1 A;  2RFJ A;  3P5O A;  5LJ2 A;  4N3W A;  4HBW A;  2R0S A;  2WP1 A;  3SVH A;  4QY4 A;  4HXN A;  5C7N A;  5FFV A;  4A9F A;  5HRW A;  5EP7 A;  5LUU A;  5K29 A;  2YYN A;  2OO1 A;  3O33 A;  3O34 A;  5EWC A;  2L5E A;  5F62 A;  5EIS A;  2R0V A;  5DY7 A;  5F61 A;  5CQ5 A;  4ALH A;  4IR6 A;  4LYW A;  3DAI A;  5A82 A;  5D3S A;  5ENE A;  3U5P A;  3HME A;  5HM0 A;  5A83 A;  1WUM A;  4O7F A;  5ENC A;  5E9L A;  5F3A A;  1WUG A;  4O77 A;  3HMH A;  5EGU A;  5A5O A;  5HQ7 A;  5A5R A;  4O7C A;  4LZR A;  5HRX A;  4NUD A;  4QC3 A;  4YH3 A;  4TTE A;  4LRG A;  4MEP A;  4N4G A;  4QEU A;  1JM4 B;  5H1T A;  5IGM A;  3LQI A;  3SVG A;  5F1H A;  4O78 A;  4CFK A;  4YBM A;  5E9M A;  4ALG A;  5L98 A;  2YQD A;  4Z1Q A;  4PKL A;  5L97 A;  4QYD A;  5C87 A;  5IID A;  5AME A;  5ACY A;  4HXL A;  4XYA A;  5D26 A;  2H60 A;  2YEM A;  4QB3 A;  5DYX A;  5DX4 A;  4Z6I A;  4O75 A;  4UYH A;  4YBT A;  5H1U A;  5E9K A;  3U5O A;  4O71 A;  4YAD A;  4Z93 A;  5FBX A;  3IU6 A;  4HXP A;  4MR6 A;  4IOR A;  5ETD A;  4XUB A;  2D9E A;  5EI4 A;  4J3I A;  4Z6H A;  3JVK A;  3P1E A;  5D3T A;  4KV1 A;  4NUC A;  5D3P A;  5HRV A;  2FSA A;  4OUF A;  4NRB A;  5IG6 A;  3P1C A;  3O35 A;  4QSS A;  4CUT A;  5EA1 A;  4O7A A;  4CLB A;  3AAD A;  5CRZ A;  2YDW A;  4NYV A;  3D7C A;  4F3I A;  3K2J A;  5E9V A;  5IGN A;  4YC9 A;  5D3J A;  2RS9 B;  5J0D A;  3DWY A;  5CTL A;  4IR3 A;  4YY4 A;  4GPJ A;  4Y03 A;  4UIT A;  5JWM A;  5HQ6 A;  5FDZ A;  3P1D A;  5BT5 A;  5IGK A;  5LKU A;  4A9E A;  2L84 A;  5DFD A;  4TU4 A;  4OGJ A;  1EQF A;  4QSX A;  4XY8 A;  4Z1S A;  5CQ4 A;  4HXK A;  3U5K A;  4PCI A; 
#chains in the Genus database with same CATH topology
 4LDF A;  2OSS A;  4TQN A;  4KCX A;  5DKH A;  4DON A;  5L99 A;  4ZC9 A;  5FE6 A;  3MUL A;  5KTW A;  5CQ7 A;  4UIZ A;  4WHU A;  5FE3 A;  2RO1 A;  4N4F A;  5DW1 A;  4TT4 A;  5TCM A;  2GRC A;  2YW5 A;  5CP5 A;  5A5S A;  5DYU A;  4N4I A;  5DKD A;  4HBX A;  3I3J A;  2LSP B;  5LKT A;  2I7K A;  5EWW A;  5COI A;  2E7N A;  4TU6 A;  5FE8 A;  4TYL A;  4LYI A;  5HLS A;  5LKZ A;  5FE5 A;  5LVR A;  4CUR A;  4IR4 A;  5E73 A;  3O37 A;  4CL9 A;  5L8U A;  5CQ6 A;  5KO4 A;  3JVL A;  5ENB A;  4BW3 A;  5F63 A;  5AD3 A;  3MB4 A;  5CUA A;  5CUG A;  4AKN A;  5A85 A;  4O7B A;  5EU1 A;  5D24 A;  4WHW A;  5EQ1 A;  5E9Y A;  4UIV A;  4O72 A;  5HFQ A;  5DLZ A;  3UVX A;  5AD2 A;  4O7E A;  3JVJ A;  5KHM A;  5H1V A;  2KTB B;  5L8T A;  5FE1 A;  4AKI A;  4QNS A;  4CUS A;  4NRC A;  5F60 A;  2DWW A;  4O74 A;  5A5P A;  1E6I A;  3VKH A;  5EWV A;  2R10 A;  5LJ0 A;  5L96 A;  5II2 A;  3UVW A;  5A7C A;  4C67 A;  4YAB A;  3U5J A;  5E74 A;  3UW9 A;  5D3R A;  4J0R A;  5E3D A;  2E3K A;  4X2I A;  2YEL A;  4UYE A;  4HXM A;  4HBY A;  5F36 A;  3G0L A;  5ENG A;  3QZS A;  4YYK A;  4AI6 A;  5CQ3 A;  4ZQL A;  5LVQ A;  5CZG A;  5HEL A;  3QZT A;  4LC2 A;  5CU8 A;  5FG4 A;  5CPE A;  5CUE A;  4LZ2 A;  4Q0N A;  4QSP A;  2R0Y A;  5FB1 A;  5AMF A;  4YH4 A;  4QSQ A;  4NQN A;  3IU5 A;  5EV9 A;  5I88 A;  4NYX A;  4A9H A;  4MEQ A;  4PY6 A;  5TB6 A;  5FE2 A;  3MQM A;  2DKW A;  5LKX A;  1JSP B;  3UVY A;  5EWD A;  4A9I A;  5D3N A;  4QBM A;  4NYW A;  2D82 A;  4QUU A;  5HJC A;  3RCW A;  2DVR A;  3U5N A;  4QST A;  4QC1 A;  4XUA A;  4A9O A;  5KTX A;  2DVQ A;  5C4Q A;  5A5Q A;  2RNW A;  4NRA A;  4N4H A;  4QR4 A;  5IBN A;  3O36 A;  4MEN A;  4QYL A;  5KU3 A;  5DBM A;  3U5L A;  5C89 A;  5HEN A;  3UV5 A;  5I83 A;  4PS5 A;  4YYJ A;  5FE7 A;  4O70 A;  4IOQ A;  2L85 A;  5FE9 A;  4A9M A;  5FE0 A;  2DVV A;  4UIX A;  2E7O A;  4UYF B;  4LYS A;  4HXR A;  5CS8 A;  4FLP A;  5HCL A;  5I7X A;  3UV2 A;  4PCE A;  5DKC A;  4TZ2 A;  5EM3 A;  5ETB A;  3HMF A;  4Q0O A;  5FB0 A;  4RVR A;  4YYI A;  3ZYU A;  4CUQ A;  2RNY A;  5I1Q A;  5C8G A;  3NXB A;  4QR3 A;  3TLP A;  5I40 A;  4BW1 A;  3ONI A;  4NQM A;  3Q2F A;  5D3H A;  4YY6 A;  4TT2 A;  5DYA A;  4BW4 A;  5F2P A;  5EPB A;  5F1L A;  4QSW A;  2G4A A;  1N72 A;  5FH7 A;  1F68 A;  4J0S A;  4YYN A;  3D1B A;  5EVA A;  5FFW A;  3AQA A;  4QEV A;  5F25 A;  4WIV A;  5CGP A;  4QEW A;  3S92 A;  4BHW A;  4QUT A;  4NR4 A;  3MB3 A;  4NXJ A;  4TT6 A;  2DAT A;  2RI7 A;  4UYD A;  5CFW A;  3LQJ A;  3MXF A;  4YBS A;  4A9J A;  4NS5 A;  5D25 A;  4NR7 A;  5D7X A;  5EPR A;  4A9L A;  3S91 A;  4UIW A;  5ENI A;  2F6J A;  5ENJ A;  5JI8 A;  4ZW1 A;  3UVD A;  5FG5 A;  2N9G A;  4NR8 A;  4CUU A;  2WP2 A;  5CRM A;  2RNX A;  5E7D A;  4QSU A;  4IOO A;  3QZV A;  5HEM A;  2I8N A;  5CQT A;  4XY9 A;  5A81 A;  4BJX A;  4UYF A;  5CUD A;  4YYM A;  3LJW A;  4HXS A;  4MEO A;  5CQA A;  5G4R A;  5FH6 A;  5CQ8 A;  5BT3 A;  4PTB A;  5H85 A;  4O76 A;  3GG3 A;  4TZ8 A;  4BW2 A;  4QSV A;  5I80 A;  5CY9 A;  4OGI A;  3JVM A;  5ENF A;  4YAT A;  5DFC A;  3UV4 A;  5I7Y A;  4A9N A;  5FFY A;  5A5N A;  3P1F A;  4UIY A;  4NR9 A;  4IR5 A;  3FKM X;  2OUO A;  4QZS A;  3MUK A;  5CUC A;  1ZKR A;  5DFB A;  4LR6 A;  2NXB A;  5C85 A;  5II1 A;  4YAX A;  3LXJ A;  5DYC A;  4E96 A;  4LZS A;  4YYG A;  5EPS A;  5ENH A;  3U5M A;  3SVF A;  5HFR A;  4CUP A;  5FG6 A;  4YYH A;  5FH8 A;  4MR3 A;  5EIC A;  5D3L A;  5EWH A;  5HQ5 A;  5I86 A;  4J1P A;  5KTU A;  3G0J A;  2F6N A;  3LQH A;  3Q2E A;  5CUB A;  5E3G A;  5I89 A;  4QR5 A;  4NR6 A;  4NUE A;  4NR5 A;  4CFL A;  4UIU A;  5E9I A;  4MR4 A;  5IGL A;  2MJV B;  4UYG A;  5EK9 A;  5BT4 A;  4MR5 A;  5DLX A;  4KV4 A;  4C66 A;  4YYD A;  4A9K A;  4YK0 A;  5I29 A;  5F5Z A;  5G4S A;  5DW2 A;  5E0R A;  5D0C A;  4HBV A;  3D1D A;  3VKG A;  1X0J A;  2DVS A;  2YEK A;  4QSR A;  1ZS5 A;  4TS8 A;  5FE4 A;  4HXO A;  5LJ1 A;  2RFJ A;  3P5O A;  5LJ2 A;  4N3W A;  4HBW A;  2R0S A;  2WP1 A;  3SVH A;  4QY4 A;  3ERR A;  4HXN A;  5C7N A;  5FFV A;  4A9F A;  5HRW A;  5EP7 A;  5LUU A;  5K29 A;  2YYN A;  2OO1 A;  3O33 A;  3O34 A;  5EWC A;  2L5E A;  5F62 A;  5EIS A;  2R0V A;  1PUO A;  5DY7 A;  5F61 A;  5CQ5 A;  4ALH A;  4IR6 A;  4LYW A;  3DAI A;  5A82 A;  5D3S A;  5ENE A;  3U5P A;  3HME A;  5HM0 A;  5A83 A;  1WUM A;  4O7F A;  2EJN A;  5ENC A;  5E9L A;  5F3A A;  1WUG A;  4O77 A;  3HMH A;  5EGU A;  5A5O A;  5HQ7 A;  5A5R A;  4O7C A;  4LZR A;  5HRX A;  4NUD A;  4QC3 A;  4YH3 A;  4TTE A;  4LRG A;  4MEP A;  4N4G A;  4QEU A;  1JM4 B;  5H1T A;  5IGM A;  3LQI A;  3SVG A;  5F1H A;  4O78 A;  4CFK A;  4YBM A;  5E9M A;  4ALG A;  5L98 A;  2YQD A;  4Z1Q A;  4PKL A;  5L97 A;  4QYD A;  5C87 A;  5IID A;  5AME A;  5ACY A;  4HXL A;  4XYA A;  5D26 A;  2H60 A;  2YEM A;  4QB3 A;  5DYX A;  5DX4 A;  4Z6I A;  4O75 A;  4UYH A;  4YBT A;  5H1U A;  5E9K A;  3U5O A;  4O71 A;  4YAD A;  4Z93 A;  4AKH A;  5FBX A;  3IU6 A;  4HXP A;  4MR6 A;  4IOR A;  5ETD A;  4XUB A;  2D9E A;  5EI4 A;  4J3I A;  4Z6H A;  3JVK A;  3P1E A;  5D3T A;  4KV1 A;  4NUC A;  5D3P A;  5HRV A;  2FSA A;  4OUF A;  4NRB A;  5IG6 A;  3P1C A;  3O35 A;  4QSS A;  4CUT A;  5EA1 A;  4O7A A;  4CLB A;  3AAD A;  5CRZ A;  2YDW A;  4NYV A;  3D7C A;  4F3I A;  3K2J A;  5E9V A;  5IGN A;  4YC9 A;  4AKG A;  5D3J A;  2RS9 B;  5J0D A;  3DWY A;  5CTL A;  4IR3 A;  4YY4 A;  4GPJ A;  4Y03 A;  4UIT A;  5JWM A;  5HQ6 A;  5FDZ A;  3P1D A;  5BT5 A;  5IGK A;  5LKU A;  4A9E A;  2L84 A;  5DFD A;  4TU4 A;  4OGJ A;  1EQF A;  4QSX A;  4XY8 A;  4Z1S A;  5CQ4 A;  4HXK A;  3U5K A;  4PCI A; 
#chains in the Genus database with same CATH homology
 4LDF A;  2OSS A;  4TQN A;  4KCX A;  5DKH A;  4DON A;  5L99 A;  4ZC9 A;  5FE6 A;  3MUL A;  5KTW A;  5CQ7 A;  4UIZ A;  4WHU A;  5FE3 A;  2RO1 A;  4N4F A;  5DW1 A;  4TT4 A;  5TCM A;  2GRC A;  2YW5 A;  5CP5 A;  5A5S A;  5DYU A;  4N4I A;  5DKD A;  4HBX A;  3I3J A;  2LSP B;  5LKT A;  2I7K A;  5EWW A;  5COI A;  2E7N A;  4TU6 A;  5FE8 A;  4TYL A;  4LYI A;  5HLS A;  5LKZ A;  5FE5 A;  5LVR A;  4CUR A;  4IR4 A;  5E73 A;  3O37 A;  4CL9 A;  5L8U A;  5CQ6 A;  5KO4 A;  3JVL A;  5ENB A;  4BW3 A;  5F63 A;  5AD3 A;  3MB4 A;  5CUA A;  5CUG A;  4AKN A;  5A85 A;  4O7B A;  5EU1 A;  5D24 A;  4WHW A;  5EQ1 A;  5E9Y A;  4UIV A;  4O72 A;  5HFQ A;  5DLZ A;  3UVX A;  5AD2 A;  4O7E A;  3JVJ A;  5KHM A;  5H1V A;  2KTB B;  5L8T A;  5FE1 A;  4QNS A;  4CUS A;  4NRC A;  5F60 A;  2DWW A;  4O74 A;  5A5P A;  1E6I A;  5EWV A;  2R10 A;  5LJ0 A;  5L96 A;  5II2 A;  3UVW A;  5A7C A;  4C67 A;  4YAB A;  3U5J A;  5E74 A;  3UW9 A;  5D3R A;  4J0R A;  5E3D A;  2E3K A;  4X2I A;  2YEL A;  4UYE A;  4HXM A;  4HBY A;  5F36 A;  3G0L A;  5ENG A;  3QZS A;  4YYK A;  5CQ3 A;  4ZQL A;  5LVQ A;  5CZG A;  5HEL A;  3QZT A;  4LC2 A;  5CU8 A;  5FG4 A;  5CPE A;  5CUE A;  4LZ2 A;  4Q0N A;  4QSP A;  2R0Y A;  5FB1 A;  5AMF A;  4YH4 A;  4QSQ A;  4NQN A;  3IU5 A;  5EV9 A;  5I88 A;  4NYX A;  4A9H A;  4MEQ A;  4PY6 A;  5TB6 A;  5FE2 A;  3MQM A;  2DKW A;  5LKX A;  1JSP B;  3UVY A;  5EWD A;  4A9I A;  5D3N A;  4QBM A;  4NYW A;  2D82 A;  4QUU A;  5HJC A;  3RCW A;  2DVR A;  3U5N A;  4QST A;  4QC1 A;  4XUA A;  4A9O A;  5KTX A;  2DVQ A;  5C4Q A;  5A5Q A;  2RNW A;  4NRA A;  4N4H A;  4QR4 A;  5IBN A;  3O36 A;  4MEN A;  4QYL A;  5KU3 A;  5DBM A;  3U5L A;  5C89 A;  5HEN A;  3UV5 A;  5I83 A;  4PS5 A;  4YYJ A;  5FE7 A;  4O70 A;  4IOQ A;  2L85 A;  5FE9 A;  4A9M A;  5FE0 A;  2DVV A;  4UIX A;  2E7O A;  4UYF B;  4LYS A;  4HXR A;  5CS8 A;  4FLP A;  5HCL A;  5I7X A;  3UV2 A;  4PCE A;  5DKC A;  4TZ2 A;  5EM3 A;  5ETB A;  3HMF A;  4Q0O A;  5FB0 A;  4RVR A;  4YYI A;  3ZYU A;  4CUQ A;  2RNY A;  5I1Q A;  5C8G A;  3NXB A;  4QR3 A;  3TLP A;  5I40 A;  4BW1 A;  3ONI A;  4NQM A;  3Q2F A;  5D3H A;  4YY6 A;  4TT2 A;  5DYA A;  4BW4 A;  5F2P A;  5EPB A;  5F1L A;  4QSW A;  2G4A A;  1N72 A;  5FH7 A;  1F68 A;  4J0S A;  4YYN A;  5EVA A;  5FFW A;  3AQA A;  4QEV A;  5F25 A;  4WIV A;  5CGP A;  4QEW A;  3S92 A;  4BHW A;  4QUT A;  4NR4 A;  3MB3 A;  4NXJ A;  4TT6 A;  2DAT A;  2RI7 A;  4UYD A;  5CFW A;  3LQJ A;  3MXF A;  4YBS A;  4A9J A;  4NS5 A;  5D25 A;  4NR7 A;  5D7X A;  5EPR A;  4A9L A;  3S91 A;  4UIW A;  5ENI A;  2F6J A;  5ENJ A;  5JI8 A;  4ZW1 A;  3UVD A;  5FG5 A;  2N9G A;  4NR8 A;  4CUU A;  2WP2 A;  5CRM A;  2RNX A;  5E7D A;  4QSU A;  4IOO A;  3QZV A;  5HEM A;  2I8N A;  5CQT A;  4XY9 A;  5A81 A;  4BJX A;  4UYF A;  5CUD A;  4YYM A;  3LJW A;  4HXS A;  4MEO A;  5CQA A;  5G4R A;  5FH6 A;  5CQ8 A;  5BT3 A;  4PTB A;  5H85 A;  4O76 A;  3GG3 A;  4TZ8 A;  4BW2 A;  4QSV A;  5I80 A;  5CY9 A;  4OGI A;  3JVM A;  5ENF A;  4YAT A;  5DFC A;  3UV4 A;  5I7Y A;  4A9N A;  5FFY A;  5A5N A;  3P1F A;  4UIY A;  4NR9 A;  4IR5 A;  3FKM X;  2OUO A;  4QZS A;  3MUK A;  5CUC A;  5DFB A;  4LR6 A;  2NXB A;  5C85 A;  5II1 A;  4YAX A;  3LXJ A;  5DYC A;  4E96 A;  4LZS A;  4YYG A;  5EPS A;  5ENH A;  3U5M A;  3SVF A;  5HFR A;  4CUP A;  5FG6 A;  4YYH A;  5FH8 A;  4MR3 A;  5EIC A;  5D3L A;  5EWH A;  5HQ5 A;  5I86 A;  4J1P A;  5KTU A;  3G0J A;  2F6N A;  3LQH A;  3Q2E A;  5CUB A;  5E3G A;  5I89 A;  4QR5 A;  4NR6 A;  4NUE A;  4NR5 A;  4CFL A;  4UIU A;  5E9I A;  4MR4 A;  5IGL A;  2MJV B;  4UYG A;  5EK9 A;  5BT4 A;  4MR5 A;  5DLX A;  4KV4 A;  4C66 A;  4YYD A;  4A9K A;  4YK0 A;  5I29 A;  5F5Z A;  5G4S A;  5DW2 A;  5E0R A;  5D0C A;  4HBV A;  1X0J A;  2DVS A;  2YEK A;  4QSR A;  1ZS5 A;  4TS8 A;  5FE4 A;  4HXO A;  5LJ1 A;  2RFJ A;  3P5O A;  5LJ2 A;  4N3W A;  4HBW A;  2R0S A;  2WP1 A;  3SVH A;  4QY4 A;  4HXN A;  5C7N A;  5FFV A;  4A9F A;  5HRW A;  5EP7 A;  5LUU A;  5K29 A;  2YYN A;  2OO1 A;  3O33 A;  3O34 A;  5EWC A;  2L5E A;  5F62 A;  5EIS A;  2R0V A;  5DY7 A;  5F61 A;  5CQ5 A;  4ALH A;  4IR6 A;  4LYW A;  3DAI A;  5A82 A;  5D3S A;  5ENE A;  3U5P A;  3HME A;  5HM0 A;  5A83 A;  1WUM A;  4O7F A;  5ENC A;  5E9L A;  5F3A A;  1WUG A;  4O77 A;  3HMH A;  5EGU A;  5A5O A;  5HQ7 A;  5A5R A;  4O7C A;  4LZR A;  5HRX A;  4NUD A;  4QC3 A;  4YH3 A;  4TTE A;  4LRG A;  4MEP A;  4N4G A;  4QEU A;  1JM4 B;  5H1T A;  5IGM A;  3LQI A;  3SVG A;  5F1H A;  4O78 A;  4CFK A;  4YBM A;  5E9M A;  4ALG A;  5L98 A;  2YQD A;  4Z1Q A;  4PKL A;  5L97 A;  4QYD A;  5C87 A;  5IID A;  5AME A;  5ACY A;  4HXL A;  4XYA A;  5D26 A;  2H60 A;  2YEM A;  4QB3 A;  5DYX A;  5DX4 A;  4Z6I A;  4O75 A;  4UYH A;  4YBT A;  5H1U A;  5E9K A;  3U5O A;  4O71 A;  4YAD A;  4Z93 A;  5FBX A;  3IU6 A;  4HXP A;  4MR6 A;  4IOR A;  5ETD A;  4XUB A;  2D9E A;  5EI4 A;  4J3I A;  4Z6H A;  3JVK A;  3P1E A;  5D3T A;  4KV1 A;  4NUC A;  5D3P A;  5HRV A;  2FSA A;  4OUF A;  4NRB A;  5IG6 A;  3P1C A;  3O35 A;  4QSS A;  4CUT A;  5EA1 A;  4O7A A;  4CLB A;  3AAD A;  5CRZ A;  2YDW A;  4NYV A;  3D7C A;  4F3I A;  3K2J A;  5E9V A;  5IGN A;  4YC9 A;  5D3J A;  2RS9 B;  5J0D A;  3DWY A;  5CTL A;  4IR3 A;  4YY4 A;  4GPJ A;  4Y03 A;  4UIT A;  5JWM A;  5HQ6 A;  5FDZ A;  3P1D A;  5BT5 A;  5IGK A;  5LKU A;  4A9E A;  2L84 A;  5DFD A;  4TU4 A;  4OGJ A;  1EQF A;  4QSX A;  4XY8 A;  4Z1S A;  5CQ4 A;  4HXK A;  3U5K A;  4PCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...