5F1HA

Crystal structure of the brd9 bromodamian in complex with bi-9564.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
113
structure length
113
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bromodomain-containing protein 9
publication title Structure-Based Design of an in Vivo Active Selective BRD9 Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5f1hA00
4A9JA 3HMHA 5IGMA 2OUOA 5CQ8A 5D3TA 2GRCA 2E3KA 3S91A 5DFCA 5F2PA 4TU4A 4A9EA 4Z1QA 4CURA 5CU8A 4AKNA 5EWWA 4O7BA 5DBMA 5CGPA 1WUGA 4DONA 5CUGA 2RNYA 4O71A 4YADA 5ENIA 3SVHA 1JM4B 3MQMA 4KV4A 5D3RA 4OGJA 4QSQA 2KTBB 5A5NA 4QR4A 5L97A 5D24A 5KTWA 5E7DA 4NR6A 5E9LA 4LYSA 5DLZA 2R0SA 5F63A 2L5EA 3JVJA 4IR4A 5F36A 5EPBA 4CLBA 5I89A 4ZW1A 3U5NA 4CUTA 4LDFA 4RVRA 5KU3A 5D3HA 5E9VA 3LQIA 4ZC9A 4ALGA 5HRWA 4UYFA 4QSXA 4YYKA 3DAIA 5LKZA 5FE1A 4QSTA 3P1DA 3P1FA 4N4HA 3UV2A 4GPJA 4MR5A 4NYWA 5CUEA 4Q0NA 5H1TA 5LVQA 5FE4A 5CUBA 4N4FA 5C89A 4C67A 3UVWA 5EWDA 4C66A 5CRMA 5FG4A 4YBTA 2YDWA 4PKLA 4QSUA 5CTLA 5BT4A 4O75A 5K29A 4TZ8A 4XYAA 4Z1SA 5CZGA 4A9KA 2MJVB 3LQJA 4NRCA 3TLPA 4MEOA 4YYGA 5BT3A 5EICA 5FE2A 4TTEA 4BW3A 5HQ6A 4BW4A 4CFKA 5F3AA 5CQ6A 3S92A 2RS9B 4IOOA 4O72A 4QZSA 5EP7A 4WIVA 3LJWA 4XUBA 5FE3A 3P1CA 4YK0A 3Q2FA 2R0YA 5EPSA 5CQ5A 1N72A 4BJXA 5ACYA 4LC2A 5LJ0A 4NRAA 3MB3A 5KO4A 5AD2A 3UW9A 4O7CA 2DWWA 3SVGA 2DVRA 4QSRA 4QSWA 5AD3A 4A9FA 2E7OA 5ENGA 5D3LA 5E9YA 5I7YA 5E9KA 4YY4A 5A5QA 5D25A 5CQ3A 2DVVA 5EV9A 5HJCA 4YBSA 4YYIA 3NXBA 3O34A 4UITA 4MR4A 4YABA 5HCLA 2DATA 4NRBA 5DX4A 5E0RA 5G4RA 4MENA 5DLXA 5D0CA 3JVMA 4ZQLA 4NQNA 4TT4A 5FE0A 5IIDA 5F1LA 4CUUA 4YBMA 4NQMA 4CL9A 5HRXA 5H85A 5CUDA 4UIWA 3RCWA 4E96A 5E9MA 4NR7A 3U5PA 5DKDA 4QSSA 5C4QA 5L98A 5ETBA 4QC3A 4NUCA 4NR8A 2DVQA 3P1EA 5CP5A 3JVKA 5CQ4A 2R10A 4O7FA 4NYXA 3U5JA 5F60A 4BW2A 2YW5A 2L85A 4UYHA 4UIZA 5HQ5A 5ENFA 3U5LA 3LQHA 2E7NA 5L8TA 4LZRA 5I80A 5ENHA 3MULA 5FE6A 4LZSA 4N3WA 1X0JA 3MUKA 4PCEA 3G0JA 3UVXA 4A9IA 4QY4A 4A9LA 4X2IA 2DVSA 5ETDA 4N4GA 4O70A 3AADA 4HBWA 5C8GA 4HXMA 5LKXA 5I1QA 2WP2A 5I86A 4QB3A 5G4SA 3Q2EA 4NYVA 2H60A 5ENBA 5FFVA 5LJ1A 2N9GA 3I3JA 4O74A 4QNSA 3JVLA 3SVFA 3UV5A 4QUTA 4UIVA 5D3JA 5EPRA 4QUUA 5I7XA 5DYCA 5LVRA 4TU6A 4HXNA 4LRGA 5LJ2A 5IGKA 3FKMX 5EA1A 5F5ZA 2I8NA 5D3SA 4TQNA 4HXKA 3HMFA 5FH8A 3MB4A 4YH4A 2OO1A 4YH3A 4HXPA 4IOQA 4TZ2A 4YY6A 5H1UA 5II1A 4IORA 5F61A 4WHWA 5LUUA 5F1HA 5CQTA 4NR9A 2YYNA 5EU1A 5DKHA 4Q0OA 5HEMA 3IU6A 4O77A 2RO1A 5FE9A 5EWCA 5HFQA 5C87A 2YELA 4Z6IA 3QZTA 4MR6A 4HBXA 5D3NA 4F3IA 5A5PA 4TYLA 5COIA 5E74A 1JSPB 2YEKA 3U5KA 4UYEA 4A9OA 4CUQA 4A9MA 3QZVA 4QSVA 5CQ7A 5HFRA 3O36A 4Z93A 3HMEA 4KV1A 4YYNA 4O78A 4O76A 4QEUA 5KTXA 5DFDA 5L99A 5EI4A 2G4AA 3IU5A 2OSSA 5EGUA 5FBXA 5E3GA 2LSPB 3ZYUA 4HXSA 5FE5A 2FSAA 2F6NA 5A82A 3O37A 4NXJA 4PCIA 5F25A 5FH6A 5A83A 5AMFA 4A9NA 5EWHA 4FLPA 4TS8A 3G0LA 4LYIA 5IGLA 2D9EA 5FH7A 4LZ2A 4TT6A 5CFWA 5EWVA 5LKUA 3O33A 5FFWA 1EQFA 4OGIA 4O7EA 5II2A 4YAXA 4MEQA 4NR5A 3UVYA 5EK9A 4LYWA 4HXOA 4J1PA 5A5SA 5A7CA 4QR5A 3GG3A 2R0VA 4CUPA 4J0SA 2WP1A 5CS8A 5BT5A 1ZS5A 4UIYA 5FG6A 5CQAA 5F62A 4O7AA 5HELA 4NR4A 5J0DA 4IR3A 3DWYA 4NUEA 5FE7A 5FB0A 4IR5A 4XY8A 2RFJA 4WHUA 5FFYA 5DFBA 4CFLA 5EM3A 2D82A 1E6IA 2L84A 4KCXA 5CUCA 3AQAA 2DKWA 4UYDA 4MEPA 4HBVA 4YATA 4YYJA 5A5RA 3UVDA 5C85A 5ENCA 2YQDA 4PY6A 5HLSA 4Z6HA 4UIUA 5I29A 4UYGA 5TCMA 4UYFB 4QYDA 4QSPA 4PTBA 5HRVA 2YEMA 4QYLA 3P5OA 3UV4A 5LKTA 5CRZA 5H1VA 5IG6A 4NS5A 4LR6A 2F6JA 3QZSA 5FE8A 4HXLA 4QEWA 4QR3A 5FDZA 5I88A 2RNXA 5L8UA 3U5OA 5HQ7A 5C7NA 4NUDA 5HM0A 3ONIA 1WUMA 4N4IA 4YYDA 5CPEA 4YC9A 5JWMA 5DYUA 4UIXA 4J3IA 5ENJA 5CY9A 5JI8A 5DYXA 5A85A 5IBNA 5DKCA 4XUAA 4CUSA 4HXRA 5DY7A 4MR3A 2I7KA 5EVAA 4QEVA 5TB6A 4QBMA 4BHWA 5I83A 5CUAA 2RNWA 4Y03A 4IR6A 5E3DA 4QC1A 4ALHA 3D7CA 5A81A 5L96A 3U5MA 4YYHA 5AMEA 5IGNA 5DYAA 4YYMA 3LXJA 5I40A 5EQ1A 5KTUA 3O35A 4OUFA 4PS5A 2NXBA 5A5OA 5D3PA 4J0RA 4TT2A 4BW1A 5E73A 5ENEA 5D26A 5FG5A 4XY9A 5D7XA 5E9IA 5HENA 2RI7A 5DW2A 4HBYA 5DW1A 1F68A 3K2JA 3MXFA 5EISA 5FB1A 4A9HA 5KHMA
chains in the Genus database with same CATH superfamily
4A9JA 3HMHA 5IGMA 2OUOA 5CQ8A 5D3TA 2GRCA 2E3KA 3S91A 5DFCA 5F2PA 4TU4A 4A9EA 4Z1QA 4CURA 5CU8A 4AKNA 5EWWA 4O7BA 5DBMA 5CGPA 1WUGA 4DONA 5CUGA 2RNYA 4O71A 4YADA 5ENIA 3SVHA 1JM4B 3MQMA 4KV4A 5D3RA 4OGJA 4QSQA 2KTBB 5A5NA 4QR4A 5L97A 5D24A 5KTWA 5E7DA 4NR6A 5E9LA 4LYSA 5DLZA 2R0SA 5F63A 2L5EA 3JVJA 4IR4A 5F36A 5EPBA 4CLBA 5I89A 4ZW1A 3U5NA 4CUTA 4LDFA 4RVRA 5KU3A 5D3HA 5E9VA 3LQIA 4ZC9A 4ALGA 5HRWA 4UYFA 4QSXA 4YYKA 3DAIA 5LKZA 5FE1A 4QSTA 3P1DA 3P1FA 4N4HA 3UV2A 4GPJA 4MR5A 4NYWA 5CUEA 4Q0NA 5H1TA 5LVQA 5FE4A 5CUBA 4N4FA 5C89A 4C67A 3UVWA 5EWDA 4C66A 5CRMA 5FG4A 4YBTA 2YDWA 4PKLA 4QSUA 5CTLA 5BT4A 4O75A 5K29A 4TZ8A 4XYAA 4Z1SA 5CZGA 4A9KA 2MJVB 3LQJA 4NRCA 3TLPA 4MEOA 4YYGA 5BT3A 3VKHA 5EICA 5FE2A 4TTEA 4BW3A 5HQ6A 4BW4A 4CFKA 5F3AA 5CQ6A 3S92A 2RS9B 4IOOA 4O72A 4QZSA 5EP7A 4WIVA 3LJWA 3VKGA 4XUBA 5FE3A 3P1CA 4YK0A 3Q2FA 2R0YA 5EPSA 5CQ5A 1N72A 4BJXA 5ACYA 4LC2A 5LJ0A 4NRAA 3MB3A 5KO4A 5AD2A 3UW9A 4O7CA 2DWWA 3SVGA 2DVRA 4QSRA 4QSWA 5AD3A 4A9FA 2E7OA 5ENGA 5D3LA 5E9YA 5I7YA 5E9KA 4YY4A 5A5QA 5D25A 5CQ3A 2DVVA 5EV9A 5HJCA 4YBSA 4YYIA 3NXBA 3O34A 4UITA 4MR4A 4YABA 5HCLA 2DATA 4NRBA 5DX4A 5E0RA 5G4RA 4MENA 3D1DA 5DLXA 5D0CA 3JVMA 4ZQLA 4NQNA 4TT4A 5FE0A 5IIDA 5F1LA 4CUUA 4YBMA 4NQMA 4CL9A 5HRXA 5H85A 5CUDA 4UIWA 3RCWA 4E96A 5E9MA 4NR7A 3U5PA 5DKDA 4QSSA 5C4QA 5L98A 5ETBA 4QC3A 4NUCA 4NR8A 2DVQA 3P1EA 5CP5A 3JVKA 5CQ4A 2R10A 4O7FA 4NYXA 3U5JA 5F60A 4BW2A 2YW5A 2L85A 4UYHA 4UIZA 1PUOA 5ENFA 3U5LA 5HQ5A 3LQHA 2E7NA 5L8TA 4LZRA 5I80A 5ENHA 3MULA 5FE6A 4LZSA 4N3WA 1X0JA 3MUKA 4PCEA 3G0JA 3UVXA 4A9IA 4QY4A 4A9LA 4X2IA 2DVSA 5ETDA 4N4GA 4O70A 3AADA 4HBWA 5C8GA 4HXMA 5LKXA 5I1QA 2WP2A 5I86A 4QB3A 5G4SA 3Q2EA 4NYVA 2H60A 5ENBA 5FFVA 5LJ1A 2N9GA 1ZKRA 3I3JA 4O74A 4QNSA 3JVLA 3SVFA 3UV5A 4QUTA 4UIVA 5D3JA 5EPRA 4QUUA 5I7XA 5DYCA 5LVRA 4TU6A 4HXNA 4LRGA 5LJ2A 5IGKA 3FKMX 5EA1A 5F5ZA 2I8NA 5D3SA 4TQNA 4HXKA 3HMFA 5FH8A 3MB4A 4YH4A 2OO1A 4YH3A 4HXPA 4IOQA 4TZ2A 4YY6A 5H1UA 5II1A 4IORA 5F61A 4WHWA 5LUUA 5F1HA 5CQTA 4NR9A 2YYNA 5EU1A 5DKHA 4Q0OA 5HEMA 3IU6A 4O77A 2RO1A 5FE9A 5EWCA 5HFQA 5C87A 2YELA 4Z6IA 3QZTA 4MR6A 4HBXA 5D3NA 4F3IA 5A5PA 4TYLA 5COIA 5E74A 1JSPB 2YEKA 3U5KA 4UYEA 4A9OA 4CUQA 4A9MA 3QZVA 4QSVA 5CQ7A 5HFRA 3O36A 4Z93A 3HMEA 4KV1A 4YYNA 4O78A 4O76A 4QEUA 5KTXA 5DFDA 5L99A 5EI4A 2G4AA 3IU5A 2OSSA 5EGUA 5FBXA 5E3GA 2LSPB 3ZYUA 4HXSA 5FE5A 2FSAA 2F6NA 5A82A 3O37A 4NXJA 4PCIA 5F25A 5FH6A 5A83A 5AMFA 4A9NA 5EWHA 4FLPA 4TS8A 3G0LA 4LYIA 5IGLA 3D1BA 2D9EA 5FH7A 4LZ2A 4TT6A 5CFWA 5EWVA 5LKUA 3O33A 5FFWA 1EQFA 4OGIA 4O7EA 5II2A 4YAXA 4MEQA 4NR5A 3UVYA 5EK9A 4LYWA 4HXOA 4J1PA 5A5SA 5A7CA 4QR5A 3GG3A 2R0VA 4CUPA 4AKIA 4J0SA 2WP1A 5CS8A 5BT5A 1ZS5A 4UIYA 5FG6A 5CQAA 5F62A 4O7AA 5HELA 4NR4A 5J0DA 4AKGA 4IR3A 3DWYA 4NUEA 5FE7A 5FB0A 4IR5A 4XY8A 2RFJA 4WHUA 5FFYA 5DFBA 4CFLA 5EM3A 2D82A 1E6IA 2L84A 4KCXA 5CUCA 3AQAA 2DKWA 4UYDA 4MEPA 4HBVA 4YATA 4YYJA 5A5RA 3UVDA 5C85A 5ENCA 2YQDA 4PY6A 5HLSA 2EJNA 4Z6HA 4UIUA 5I29A 4UYGA 5TCMA 4UYFB 4AI6A 4QYDA 4QSPA 4PTBA 5HRVA 2YEMA 4QYLA 3P5OA 3UV4A 5LKTA 5CRZA 5H1VA 5IG6A 4NS5A 4LR6A 2F6JA 3QZSA 5FE8A 4HXLA 4QEWA 4QR3A 5FDZA 5I88A 2RNXA 5L8UA 3U5OA 5HQ7A 5C7NA 4NUDA 5HM0A 3ONIA 1WUMA 4N4IA 4YYDA 5CPEA 4YC9A 5JWMA 5DYUA 4UIXA 4J3IA 5ENJA 5CY9A 5JI8A 5DYXA 5A85A 5IBNA 5DKCA 4XUAA 4CUSA 4HXRA 5DY7A 4MR3A 2I7KA 5EVAA 4QEVA 5TB6A 4QBMA 4BHWA 5I83A 5CUAA 2RNWA 4Y03A 4IR6A 5E3DA 4QC1A 4ALHA 3D7CA 5A81A 5L96A 3U5MA 4YYHA 3ERRA 5AMEA 5IGNA 5DYAA 4AKHA 4YYMA 3LXJA 5I40A 5EQ1A 5KTUA 3O35A 4OUFA 4PS5A 2NXBA 5A5OA 5D3PA 4J0RA 4TT2A 4BW1A 5E73A 5ENEA 5D26A 5FG5A 4XY9A 5D7XA 5E9IA 5HENA 2RI7A 5DW2A 4HBYA 5DW1A 1F68A 3K2JA 3MXFA 5EISA 5FB1A 4A9HA 5KHMA
chains in the Genus database with same CATH topology
4A9JA 3HMHA 5IGMA 2OUOA 5CQ8A 5D3TA 2GRCA 2E3KA 3S91A 5DFCA 5F2PA 4TU4A 4A9EA 4Z1QA 4CURA 5CU8A 4AKNA 5EWWA 4O7BA 5DBMA 5CGPA 1WUGA 4DONA 5CUGA 2RNYA 4O71A 4YADA 5ENIA 3SVHA 1JM4B 3MQMA 4KV4A 5D3RA 4OGJA 4QSQA 2KTBB 5A5NA 4QR4A 5L97A 5D24A 5KTWA 5E7DA 4NR6A 5E9LA 4LYSA 5DLZA 2R0SA 5F63A 2L5EA 3JVJA 4IR4A 5F36A 5EPBA 4CLBA 5I89A 4ZW1A 3U5NA 4CUTA 4LDFA 4RVRA 5KU3A 5D3HA 5E9VA 3LQIA 4ZC9A 4ALGA 5HRWA 4UYFA 4QSXA 4YYKA 3DAIA 5LKZA 5FE1A 4QSTA 3P1DA 3P1FA 4N4HA 3UV2A 4GPJA 4MR5A 4NYWA 5CUEA 4Q0NA 5H1TA 5LVQA 5FE4A 5CUBA 4N4FA 5C89A 4C67A 3UVWA 5EWDA 4C66A 5CRMA 5FG4A 4YBTA 2YDWA 4PKLA 4QSUA 5CTLA 5BT4A 4O75A 5K29A 4TZ8A 4XYAA 4Z1SA 5CZGA 4A9KA 2MJVB 3LQJA 4NRCA 3TLPA 4MEOA 4YYGA 5BT3A 5EICA 5FE2A 4TTEA 4BW3A 5HQ6A 4BW4A 4CFKA 5F3AA 5CQ6A 3S92A 2RS9B 4IOOA 4O72A 4QZSA 5EP7A 4WIVA 3LJWA 4XUBA 5FE3A 3P1CA 4YK0A 3Q2FA 2R0YA 5EPSA 5CQ5A 1N72A 4BJXA 5ACYA 4LC2A 5LJ0A 4NRAA 3MB3A 5KO4A 5AD2A 3UW9A 4O7CA 2DWWA 3SVGA 2DVRA 4QSRA 4QSWA 5AD3A 4A9FA 2E7OA 5ENGA 5D3LA 5E9YA 5I7YA 5E9KA 4YY4A 5A5QA 5D25A 5CQ3A 2DVVA 5EV9A 5HJCA 4YBSA 4YYIA 3NXBA 3O34A 4UITA 4MR4A 4YABA 5HCLA 2DATA 4NRBA 5DX4A 5E0RA 5G4RA 4MENA 5DLXA 5D0CA 3JVMA 4ZQLA 4NQNA 4TT4A 5FE0A 5IIDA 5F1LA 4CUUA 4YBMA 4NQMA 4CL9A 5HRXA 5H85A 5CUDA 4UIWA 3RCWA 4E96A 5E9MA 4NR7A 3U5PA 5DKDA 4QSSA 5C4QA 5L98A 5ETBA 4QC3A 4NUCA 4NR8A 2DVQA 3P1EA 5CP5A 3JVKA 5CQ4A 2R10A 4O7FA 4NYXA 3U5JA 5F60A 4BW2A 2YW5A 2L85A 4UYHA 4UIZA 5HQ5A 5ENFA 3U5LA 3LQHA 2E7NA 5L8TA 4LZRA 5I80A 5ENHA 3MULA 5FE6A 4LZSA 4N3WA 1X0JA 3MUKA 4PCEA 3G0JA 3UVXA 4A9IA 4QY4A 4A9LA 4X2IA 2DVSA 5ETDA 4N4GA 4O70A 3AADA 4HBWA 5C8GA 4HXMA 5LKXA 5I1QA 2WP2A 5I86A 4QB3A 5G4SA 3Q2EA 4NYVA 2H60A 5ENBA 5FFVA 5LJ1A 2N9GA 3I3JA 4O74A 4QNSA 3JVLA 3SVFA 3UV5A 4QUTA 4UIVA 5D3JA 5EPRA 4QUUA 5I7XA 5DYCA 5LVRA 4TU6A 4HXNA 4LRGA 5LJ2A 5IGKA 3FKMX 5EA1A 5F5ZA 2I8NA 5D3SA 4TQNA 4HXKA 3HMFA 5FH8A 3MB4A 4YH4A 2OO1A 4YH3A 4HXPA 4IOQA 4TZ2A 4YY6A 5H1UA 5II1A 4IORA 5F61A 4WHWA 5LUUA 5F1HA 5CQTA 4NR9A 2YYNA 5EU1A 5DKHA 4Q0OA 5HEMA 3IU6A 4O77A 2RO1A 5FE9A 5EWCA 5HFQA 5C87A 2YELA 4Z6IA 3QZTA 4MR6A 4HBXA 5D3NA 4F3IA 5A5PA 4TYLA 5COIA 5E74A 1JSPB 2YEKA 3U5KA 4UYEA 4A9OA 4CUQA 4A9MA 3QZVA 4QSVA 5CQ7A 5HFRA 3O36A 4Z93A 3HMEA 4KV1A 4YYNA 4O78A 4O76A 4QEUA 5KTXA 5DFDA 5L99A 5EI4A 2G4AA 3IU5A 2OSSA 5EGUA 5FBXA 5E3GA 2LSPB 3ZYUA 4HXSA 5FE5A 2FSAA 2F6NA 5A82A 3O37A 4NXJA 4PCIA 5F25A 5FH6A 5A83A 5AMFA 4A9NA 5EWHA 4FLPA 4TS8A 3G0LA 4LYIA 5IGLA 2D9EA 5FH7A 4LZ2A 4TT6A 5CFWA 5EWVA 5LKUA 3O33A 5FFWA 1EQFA 4OGIA 4O7EA 5II2A 4YAXA 4MEQA 4NR5A 3UVYA 5EK9A 4LYWA 4HXOA 4J1PA 5A5SA 5A7CA 4QR5A 3GG3A 2R0VA 4CUPA 4J0SA 2WP1A 5CS8A 5BT5A 1ZS5A 4UIYA 5FG6A 5CQAA 5F62A 4O7AA 5HELA 4NR4A 5J0DA 4IR3A 3DWYA 4NUEA 5FE7A 5FB0A 4IR5A 4XY8A 2RFJA 4WHUA 5FFYA 5DFBA 4CFLA 5EM3A 2D82A 1E6IA 2L84A 4KCXA 5CUCA 3AQAA 2DKWA 4UYDA 4MEPA 4HBVA 4YATA 4YYJA 5A5RA 3UVDA 5C85A 5ENCA 2YQDA 4PY6A 5HLSA 4Z6HA 4UIUA 5I29A 4UYGA 5TCMA 4UYFB 4QYDA 4QSPA 4PTBA 5HRVA 2YEMA 4QYLA 3P5OA 3UV4A 5LKTA 5CRZA 5H1VA 5IG6A 4NS5A 4LR6A 2F6JA 3QZSA 5FE8A 4HXLA 4QEWA 4QR3A 5FDZA 5I88A 2RNXA 5L8UA 3U5OA 5HQ7A 5C7NA 4NUDA 5HM0A 3ONIA 1WUMA 4N4IA 4YYDA 5CPEA 4YC9A 5JWMA 5DYUA 4UIXA 4J3IA 5ENJA 5CY9A 5JI8A 5DYXA 5A85A 5IBNA 5DKCA 4XUAA 4CUSA 4HXRA 5DY7A 4MR3A 2I7KA 5EVAA 4QEVA 5TB6A 4QBMA 4BHWA 5I83A 5CUAA 2RNWA 4Y03A 4IR6A 5E3DA 4QC1A 4ALHA 3D7CA 5A81A 5L96A 3U5MA 4YYHA 5AMEA 5IGNA 5DYAA 4YYMA 3LXJA 5I40A 5EQ1A 5KTUA 3O35A 4OUFA 4PS5A 2NXBA 5A5OA 5D3PA 4J0RA 4TT2A 4BW1A 5E73A 5ENEA 5D26A 5FG5A 4XY9A 5D7XA 5E9IA 5HENA 2RI7A 5DW2A 4HBYA 5DW1A 1F68A 3K2JA 3MXFA 5EISA 5FB1A 4A9HA 5KHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A9J A;  3HMH A;  5IGM A;  2OUO A;  5CQ8 A;  5D3T A;  2GRC A;  2E3K A;  3S91 A;  5DFC A;  5F2P A;  4TU4 A;  4A9E A;  4Z1Q A;  4CUR A;  5CU8 A;  4AKN A;  5EWW A;  4O7B A;  5DBM A;  5CGP A;  1WUG A;  4DON A;  5CUG A;  2RNY A;  4O71 A;  4YAD A;  5ENI A;  3SVH A;  1JM4 B;  3MQM A;  4KV4 A;  5D3R A;  4OGJ A;  4QSQ A;  2KTB B;  5A5N A;  4QR4 A;  5L97 A;  5D24 A;  5KTW A;  5E7D A;  4NR6 A;  5E9L A;  4LYS A;  5DLZ A;  2R0S A;  5F63 A;  2L5E A;  3JVJ A;  4IR4 A;  5F36 A;  5EPB A;  4CLB A;  5I89 A;  4ZW1 A;  3U5N A;  4CUT A;  4LDF A;  4RVR A;  5KU3 A;  5D3H A;  5E9V A;  3LQI A;  4ZC9 A;  4ALG A;  5HRW A;  4UYF A;  4QSX A;  4YYK A;  3DAI A;  5LKZ A;  5FE1 A;  4QST A;  3P1D A;  3P1F A;  4N4H A;  3UV2 A;  4GPJ A;  4MR5 A;  4NYW A;  5CUE A;  4Q0N A;  5H1T A;  5LVQ A;  5FE4 A;  5CUB A;  4N4F A;  5C89 A;  4C67 A;  3UVW A;  5EWD A;  4C66 A;  5CRM A;  5FG4 A;  4YBT A;  2YDW A;  4PKL A;  4QSU A;  5CTL A;  5BT4 A;  4O75 A;  5K29 A;  4TZ8 A;  4XYA A;  4Z1S A;  5CZG A;  4A9K A;  2MJV B;  3LQJ A;  4NRC A;  3TLP A;  4MEO A;  4YYG A;  5BT3 A;  5EIC A;  5FE2 A;  4TTE A;  4BW3 A;  5HQ6 A;  4BW4 A;  4CFK A;  5F3A A;  5CQ6 A;  3S92 A;  2RS9 B;  4IOO A;  4O72 A;  4QZS A;  5EP7 A;  4WIV A;  3LJW A;  4XUB A;  5FE3 A;  3P1C A;  4YK0 A;  3Q2F A;  2R0Y A;  5EPS A;  5CQ5 A;  1N72 A;  4BJX A;  5ACY A;  4LC2 A;  5LJ0 A;  4NRA A;  3MB3 A;  5KO4 A;  5AD2 A;  3UW9 A;  4O7C A;  2DWW A;  3SVG A;  2DVR A;  4QSR A;  4QSW A;  5AD3 A;  4A9F A;  2E7O A;  5ENG A;  5D3L A;  5E9Y A;  5I7Y A;  5E9K A;  4YY4 A;  5A5Q A;  5D25 A;  5CQ3 A;  2DVV A;  5EV9 A;  5HJC A;  4YBS A;  4YYI A;  3NXB A;  3O34 A;  4UIT A;  4MR4 A;  4YAB A;  5HCL A;  2DAT A;  4NRB A;  5DX4 A;  5E0R A;  5G4R A;  4MEN A;  5DLX A;  5D0C A;  3JVM A;  4ZQL A;  4NQN A;  4TT4 A;  5FE0 A;  5IID A;  5F1L A;  4CUU A;  4YBM A;  4NQM A;  4CL9 A;  5HRX A;  5H85 A;  5CUD A;  4UIW A;  3RCW A;  4E96 A;  5E9M A;  4NR7 A;  3U5P A;  5DKD A;  4QSS A;  5C4Q A;  5L98 A;  5ETB A;  4QC3 A;  4NUC A;  4NR8 A;  2DVQ A;  3P1E A;  5CP5 A;  3JVK A;  5CQ4 A;  2R10 A;  4O7F A;  4NYX A;  3U5J A;  5F60 A;  4BW2 A;  2YW5 A;  2L85 A;  4UYH A;  4UIZ A;  5HQ5 A;  5ENF A;  3U5L A;  3LQH A;  2E7N A;  5L8T A;  4LZR A;  5I80 A;  5ENH A;  3MUL A;  5FE6 A;  4LZS A;  4N3W A;  1X0J A;  3MUK A;  4PCE A;  3G0J A;  3UVX A;  4A9I A;  4QY4 A;  4A9L A;  4X2I A;  2DVS A;  5ETD A;  4N4G A;  4O70 A;  3AAD A;  4HBW A;  5C8G A;  4HXM A;  5LKX A;  5I1Q A;  2WP2 A;  5I86 A;  4QB3 A;  5G4S A;  3Q2E A;  4NYV A;  2H60 A;  5ENB A;  5FFV A;  5LJ1 A;  2N9G A;  3I3J A;  4O74 A;  4QNS A;  3JVL A;  3SVF A;  3UV5 A;  4QUT A;  4UIV A;  5D3J A;  5EPR A;  4QUU A;  5I7X A;  5DYC A;  5LVR A;  4TU6 A;  4HXN A;  4LRG A;  5LJ2 A;  5IGK A;  3FKM X;  5EA1 A;  5F5Z A;  2I8N A;  5D3S A;  4TQN A;  4HXK A;  3HMF A;  5FH8 A;  3MB4 A;  4YH4 A;  2OO1 A;  4YH3 A;  4HXP A;  4IOQ A;  4TZ2 A;  4YY6 A;  5H1U A;  5II1 A;  4IOR A;  5F61 A;  4WHW A;  5LUU A;  5F1H A;  5CQT A;  4NR9 A;  2YYN A;  5EU1 A;  5DKH A;  4Q0O A;  5HEM A;  3IU6 A;  4O77 A;  2RO1 A;  5FE9 A;  5EWC A;  5HFQ A;  5C87 A;  2YEL A;  4Z6I A;  3QZT A;  4MR6 A;  4HBX A;  5D3N A;  4F3I A;  5A5P A;  4TYL A;  5COI A;  5E74 A;  1JSP B;  2YEK A;  3U5K A;  4UYE A;  4A9O A;  4CUQ A;  4A9M A;  3QZV A;  4QSV A;  5CQ7 A;  5HFR A;  3O36 A;  4Z93 A;  3HME A;  4KV1 A;  4YYN A;  4O78 A;  4O76 A;  4QEU A;  5KTX A;  5DFD A;  5L99 A;  5EI4 A;  2G4A A;  3IU5 A;  2OSS A;  5EGU A;  5FBX A;  5E3G A;  2LSP B;  3ZYU A;  4HXS A;  5FE5 A;  2FSA A;  2F6N A;  5A82 A;  3O37 A;  4NXJ A;  4PCI A;  5F25 A;  5FH6 A;  5A83 A;  5AMF A;  4A9N A;  5EWH A;  4FLP A;  4TS8 A;  3G0L A;  4LYI A;  5IGL A;  2D9E A;  5FH7 A;  4LZ2 A;  4TT6 A;  5CFW A;  5EWV A;  5LKU A;  3O33 A;  5FFW A;  1EQF A;  4OGI A;  4O7E A;  5II2 A;  4YAX A;  4MEQ A;  4NR5 A;  3UVY A;  5EK9 A;  4LYW A;  4HXO A;  4J1P A;  5A5S A;  5A7C A;  4QR5 A;  3GG3 A;  2R0V A;  4CUP A;  4J0S A;  2WP1 A;  5CS8 A;  5BT5 A;  1ZS5 A;  4UIY A;  5FG6 A;  5CQA A;  5F62 A;  4O7A A;  5HEL A;  4NR4 A;  5J0D A;  4IR3 A;  3DWY A;  4NUE A;  5FE7 A;  5FB0 A;  4IR5 A;  4XY8 A;  2RFJ A;  4WHU A;  5FFY A;  5DFB A;  4CFL A;  5EM3 A;  2D82 A;  1E6I A;  2L84 A;  4KCX A;  5CUC A;  3AQA A;  2DKW A;  4UYD A;  4MEP A;  4HBV A;  4YAT A;  4YYJ A;  5A5R A;  3UVD A;  5C85 A;  5ENC A;  2YQD A;  4PY6 A;  5HLS A;  4Z6H A;  4UIU A;  5I29 A;  4UYG A;  5TCM A;  4UYF B;  4QYD A;  4QSP A;  4PTB A;  5HRV A;  2YEM A;  4QYL A;  3P5O A;  3UV4 A;  5LKT A;  5CRZ A;  5H1V A;  5IG6 A;  4NS5 A;  4LR6 A;  2F6J A;  3QZS A;  5FE8 A;  4HXL A;  4QEW A;  4QR3 A;  5FDZ A;  5I88 A;  2RNX A;  5L8U A;  3U5O A;  5HQ7 A;  5C7N A;  4NUD A;  5HM0 A;  3ONI A;  1WUM A;  4N4I A;  4YYD A;  5CPE A;  4YC9 A;  5JWM A;  5DYU A;  4UIX A;  4J3I A;  5ENJ A;  5CY9 A;  5JI8 A;  5DYX A;  5A85 A;  5IBN A;  5DKC A;  4XUA A;  4CUS A;  4HXR A;  5DY7 A;  4MR3 A;  2I7K A;  5EVA A;  4QEV A;  5TB6 A;  4QBM A;  4BHW A;  5I83 A;  5CUA A;  2RNW A;  4Y03 A;  4IR6 A;  5E3D A;  4QC1 A;  4ALH A;  3D7C A;  5A81 A;  5L96 A;  3U5M A;  4YYH A;  5AME A;  5IGN A;  5DYA A;  4YYM A;  3LXJ A;  5I40 A;  5EQ1 A;  5KTU A;  3O35 A;  4OUF A;  4PS5 A;  2NXB A;  5A5O A;  5D3P A;  4J0R A;  4TT2 A;  4BW1 A;  5E73 A;  5ENE A;  5D26 A;  5FG5 A;  4XY9 A;  5D7X A;  5E9I A;  5HEN A;  2RI7 A;  5DW2 A;  4HBY A;  5DW1 A;  1F68 A;  3K2J A;  3MXF A;  5EIS A;  5FB1 A;  4A9H A;  5KHM A; 
#chains in the Genus database with same CATH topology
 4A9J A;  3HMH A;  5IGM A;  2OUO A;  5CQ8 A;  5D3T A;  2GRC A;  2E3K A;  3S91 A;  5DFC A;  5F2P A;  4TU4 A;  4A9E A;  4Z1Q A;  4CUR A;  5CU8 A;  4AKN A;  5EWW A;  4O7B A;  5DBM A;  5CGP A;  1WUG A;  4DON A;  5CUG A;  2RNY A;  4O71 A;  4YAD A;  5ENI A;  3SVH A;  1JM4 B;  3MQM A;  4KV4 A;  5D3R A;  4OGJ A;  4QSQ A;  2KTB B;  5A5N A;  4QR4 A;  5L97 A;  5D24 A;  5KTW A;  5E7D A;  4NR6 A;  5E9L A;  4LYS A;  5DLZ A;  2R0S A;  5F63 A;  2L5E A;  3JVJ A;  4IR4 A;  5F36 A;  5EPB A;  4CLB A;  5I89 A;  4ZW1 A;  3U5N A;  4CUT A;  4LDF A;  4RVR A;  5KU3 A;  5D3H A;  5E9V A;  3LQI A;  4ZC9 A;  4ALG A;  5HRW A;  4UYF A;  4QSX A;  4YYK A;  3DAI A;  5LKZ A;  5FE1 A;  4QST A;  3P1D A;  3P1F A;  4N4H A;  3UV2 A;  4GPJ A;  4MR5 A;  4NYW A;  5CUE A;  4Q0N A;  5H1T A;  5LVQ A;  5FE4 A;  5CUB A;  4N4F A;  5C89 A;  4C67 A;  3UVW A;  5EWD A;  4C66 A;  5CRM A;  5FG4 A;  4YBT A;  2YDW A;  4PKL A;  4QSU A;  5CTL A;  5BT4 A;  4O75 A;  5K29 A;  4TZ8 A;  4XYA A;  4Z1S A;  5CZG A;  4A9K A;  2MJV B;  3LQJ A;  4NRC A;  3TLP A;  4MEO A;  4YYG A;  5BT3 A;  3VKH A;  5EIC A;  5FE2 A;  4TTE A;  4BW3 A;  5HQ6 A;  4BW4 A;  4CFK A;  5F3A A;  5CQ6 A;  3S92 A;  2RS9 B;  4IOO A;  4O72 A;  4QZS A;  5EP7 A;  4WIV A;  3LJW A;  3VKG A;  4XUB A;  5FE3 A;  3P1C A;  4YK0 A;  3Q2F A;  2R0Y A;  5EPS A;  5CQ5 A;  1N72 A;  4BJX A;  5ACY A;  4LC2 A;  5LJ0 A;  4NRA A;  3MB3 A;  5KO4 A;  5AD2 A;  3UW9 A;  4O7C A;  2DWW A;  3SVG A;  2DVR A;  4QSR A;  4QSW A;  5AD3 A;  4A9F A;  2E7O A;  5ENG A;  5D3L A;  5E9Y A;  5I7Y A;  5E9K A;  4YY4 A;  5A5Q A;  5D25 A;  5CQ3 A;  2DVV A;  5EV9 A;  5HJC A;  4YBS A;  4YYI A;  3NXB A;  3O34 A;  4UIT A;  4MR4 A;  4YAB A;  5HCL A;  2DAT A;  4NRB A;  5DX4 A;  5E0R A;  5G4R A;  4MEN A;  3D1D A;  5DLX A;  5D0C A;  3JVM A;  4ZQL A;  4NQN A;  4TT4 A;  5FE0 A;  5IID A;  5F1L A;  4CUU A;  4YBM A;  4NQM A;  4CL9 A;  5HRX A;  5H85 A;  5CUD A;  4UIW A;  3RCW A;  4E96 A;  5E9M A;  4NR7 A;  3U5P A;  5DKD A;  4QSS A;  5C4Q A;  5L98 A;  5ETB A;  4QC3 A;  4NUC A;  4NR8 A;  2DVQ A;  3P1E A;  5CP5 A;  3JVK A;  5CQ4 A;  2R10 A;  4O7F A;  4NYX A;  3U5J A;  5F60 A;  4BW2 A;  2YW5 A;  2L85 A;  4UYH A;  4UIZ A;  1PUO A;  5ENF A;  3U5L A;  5HQ5 A;  3LQH A;  2E7N A;  5L8T A;  4LZR A;  5I80 A;  5ENH A;  3MUL A;  5FE6 A;  4LZS A;  4N3W A;  1X0J A;  3MUK A;  4PCE A;  3G0J A;  3UVX A;  4A9I A;  4QY4 A;  4A9L A;  4X2I A;  2DVS A;  5ETD A;  4N4G A;  4O70 A;  3AAD A;  4HBW A;  5C8G A;  4HXM A;  5LKX A;  5I1Q A;  2WP2 A;  5I86 A;  4QB3 A;  5G4S A;  3Q2E A;  4NYV A;  2H60 A;  5ENB A;  5FFV A;  5LJ1 A;  2N9G A;  1ZKR A;  3I3J A;  4O74 A;  4QNS A;  3JVL A;  3SVF A;  3UV5 A;  4QUT A;  4UIV A;  5D3J A;  5EPR A;  4QUU A;  5I7X A;  5DYC A;  5LVR A;  4TU6 A;  4HXN A;  4LRG A;  5LJ2 A;  5IGK A;  3FKM X;  5EA1 A;  5F5Z A;  2I8N A;  5D3S A;  4TQN A;  4HXK A;  3HMF A;  5FH8 A;  3MB4 A;  4YH4 A;  2OO1 A;  4YH3 A;  4HXP A;  4IOQ A;  4TZ2 A;  4YY6 A;  5H1U A;  5II1 A;  4IOR A;  5F61 A;  4WHW A;  5LUU A;  5F1H A;  5CQT A;  4NR9 A;  2YYN A;  5EU1 A;  5DKH A;  4Q0O A;  5HEM A;  3IU6 A;  4O77 A;  2RO1 A;  5FE9 A;  5EWC A;  5HFQ A;  5C87 A;  2YEL A;  4Z6I A;  3QZT A;  4MR6 A;  4HBX A;  5D3N A;  4F3I A;  5A5P A;  4TYL A;  5COI A;  5E74 A;  1JSP B;  2YEK A;  3U5K A;  4UYE A;  4A9O A;  4CUQ A;  4A9M A;  3QZV A;  4QSV A;  5CQ7 A;  5HFR A;  3O36 A;  4Z93 A;  3HME A;  4KV1 A;  4YYN A;  4O78 A;  4O76 A;  4QEU A;  5KTX A;  5DFD A;  5L99 A;  5EI4 A;  2G4A A;  3IU5 A;  2OSS A;  5EGU A;  5FBX A;  5E3G A;  2LSP B;  3ZYU A;  4HXS A;  5FE5 A;  2FSA A;  2F6N A;  5A82 A;  3O37 A;  4NXJ A;  4PCI A;  5F25 A;  5FH6 A;  5A83 A;  5AMF A;  4A9N A;  5EWH A;  4FLP A;  4TS8 A;  3G0L A;  4LYI A;  5IGL A;  3D1B A;  2D9E A;  5FH7 A;  4LZ2 A;  4TT6 A;  5CFW A;  5EWV A;  5LKU A;  3O33 A;  5FFW A;  1EQF A;  4OGI A;  4O7E A;  5II2 A;  4YAX A;  4MEQ A;  4NR5 A;  3UVY A;  5EK9 A;  4LYW A;  4HXO A;  4J1P A;  5A5S A;  5A7C A;  4QR5 A;  3GG3 A;  2R0V A;  4CUP A;  4AKI A;  4J0S A;  2WP1 A;  5CS8 A;  5BT5 A;  1ZS5 A;  4UIY A;  5FG6 A;  5CQA A;  5F62 A;  4O7A A;  5HEL A;  4NR4 A;  5J0D A;  4AKG A;  4IR3 A;  3DWY A;  4NUE A;  5FE7 A;  5FB0 A;  4IR5 A;  4XY8 A;  2RFJ A;  4WHU A;  5FFY A;  5DFB A;  4CFL A;  5EM3 A;  2D82 A;  1E6I A;  2L84 A;  4KCX A;  5CUC A;  3AQA A;  2DKW A;  4UYD A;  4MEP A;  4HBV A;  4YAT A;  4YYJ A;  5A5R A;  3UVD A;  5C85 A;  5ENC A;  2YQD A;  4PY6 A;  5HLS A;  2EJN A;  4Z6H A;  4UIU A;  5I29 A;  4UYG A;  5TCM A;  4UYF B;  4AI6 A;  4QYD A;  4QSP A;  4PTB A;  5HRV A;  2YEM A;  4QYL A;  3P5O A;  3UV4 A;  5LKT A;  5CRZ A;  5H1V A;  5IG6 A;  4NS5 A;  4LR6 A;  2F6J A;  3QZS A;  5FE8 A;  4HXL A;  4QEW A;  4QR3 A;  5FDZ A;  5I88 A;  2RNX A;  5L8U A;  3U5O A;  5HQ7 A;  5C7N A;  4NUD A;  5HM0 A;  3ONI A;  1WUM A;  4N4I A;  4YYD A;  5CPE A;  4YC9 A;  5JWM A;  5DYU A;  4UIX A;  4J3I A;  5ENJ A;  5CY9 A;  5JI8 A;  5DYX A;  5A85 A;  5IBN A;  5DKC A;  4XUA A;  4CUS A;  4HXR A;  5DY7 A;  4MR3 A;  2I7K A;  5EVA A;  4QEV A;  5TB6 A;  4QBM A;  4BHW A;  5I83 A;  5CUA A;  2RNW A;  4Y03 A;  4IR6 A;  5E3D A;  4QC1 A;  4ALH A;  3D7C A;  5A81 A;  5L96 A;  3U5M A;  4YYH A;  3ERR A;  5AME A;  5IGN A;  5DYA A;  4AKH A;  4YYM A;  3LXJ A;  5I40 A;  5EQ1 A;  5KTU A;  3O35 A;  4OUF A;  4PS5 A;  2NXB A;  5A5O A;  5D3P A;  4J0R A;  4TT2 A;  4BW1 A;  5E73 A;  5ENE A;  5D26 A;  5FG5 A;  4XY9 A;  5D7X A;  5E9I A;  5HEN A;  2RI7 A;  5DW2 A;  4HBY A;  5DW1 A;  1F68 A;  3K2J A;  3MXF A;  5EIS A;  5FB1 A;  4A9H A;  5KHM A; 
#chains in the Genus database with same CATH homology
 4A9J A;  3HMH A;  5IGM A;  2OUO A;  5CQ8 A;  5D3T A;  2GRC A;  2E3K A;  3S91 A;  5DFC A;  5F2P A;  4TU4 A;  4A9E A;  4Z1Q A;  4CUR A;  5CU8 A;  4AKN A;  5EWW A;  4O7B A;  5DBM A;  5CGP A;  1WUG A;  4DON A;  5CUG A;  2RNY A;  4O71 A;  4YAD A;  5ENI A;  3SVH A;  1JM4 B;  3MQM A;  4KV4 A;  5D3R A;  4OGJ A;  4QSQ A;  2KTB B;  5A5N A;  4QR4 A;  5L97 A;  5D24 A;  5KTW A;  5E7D A;  4NR6 A;  5E9L A;  4LYS A;  5DLZ A;  2R0S A;  5F63 A;  2L5E A;  3JVJ A;  4IR4 A;  5F36 A;  5EPB A;  4CLB A;  5I89 A;  4ZW1 A;  3U5N A;  4CUT A;  4LDF A;  4RVR A;  5KU3 A;  5D3H A;  5E9V A;  3LQI A;  4ZC9 A;  4ALG A;  5HRW A;  4UYF A;  4QSX A;  4YYK A;  3DAI A;  5LKZ A;  5FE1 A;  4QST A;  3P1D A;  3P1F A;  4N4H A;  3UV2 A;  4GPJ A;  4MR5 A;  4NYW A;  5CUE A;  4Q0N A;  5H1T A;  5LVQ A;  5FE4 A;  5CUB A;  4N4F A;  5C89 A;  4C67 A;  3UVW A;  5EWD A;  4C66 A;  5CRM A;  5FG4 A;  4YBT A;  2YDW A;  4PKL A;  4QSU A;  5CTL A;  5BT4 A;  4O75 A;  5K29 A;  4TZ8 A;  4XYA A;  4Z1S A;  5CZG A;  4A9K A;  2MJV B;  3LQJ A;  4NRC A;  3TLP A;  4MEO A;  4YYG A;  5BT3 A;  5EIC A;  5FE2 A;  4TTE A;  4BW3 A;  5HQ6 A;  4BW4 A;  4CFK A;  5F3A A;  5CQ6 A;  3S92 A;  2RS9 B;  4IOO A;  4O72 A;  4QZS A;  5EP7 A;  4WIV A;  3LJW A;  4XUB A;  5FE3 A;  3P1C A;  4YK0 A;  3Q2F A;  2R0Y A;  5EPS A;  5CQ5 A;  1N72 A;  4BJX A;  5ACY A;  4LC2 A;  5LJ0 A;  4NRA A;  3MB3 A;  5KO4 A;  5AD2 A;  3UW9 A;  4O7C A;  2DWW A;  3SVG A;  2DVR A;  4QSR A;  4QSW A;  5AD3 A;  4A9F A;  2E7O A;  5ENG A;  5D3L A;  5E9Y A;  5I7Y A;  5E9K A;  4YY4 A;  5A5Q A;  5D25 A;  5CQ3 A;  2DVV A;  5EV9 A;  5HJC A;  4YBS A;  4YYI A;  3NXB A;  3O34 A;  4UIT A;  4MR4 A;  4YAB A;  5HCL A;  2DAT A;  4NRB A;  5DX4 A;  5E0R A;  5G4R A;  4MEN A;  5DLX A;  5D0C A;  3JVM A;  4ZQL A;  4NQN A;  4TT4 A;  5FE0 A;  5IID A;  5F1L A;  4CUU A;  4YBM A;  4NQM A;  4CL9 A;  5HRX A;  5H85 A;  5CUD A;  4UIW A;  3RCW A;  4E96 A;  5E9M A;  4NR7 A;  3U5P A;  5DKD A;  4QSS A;  5C4Q A;  5L98 A;  5ETB A;  4QC3 A;  4NUC A;  4NR8 A;  2DVQ A;  3P1E A;  5CP5 A;  3JVK A;  5CQ4 A;  2R10 A;  4O7F A;  4NYX A;  3U5J A;  5F60 A;  4BW2 A;  2YW5 A;  2L85 A;  4UYH A;  4UIZ A;  5HQ5 A;  5ENF A;  3U5L A;  3LQH A;  2E7N A;  5L8T A;  4LZR A;  5I80 A;  5ENH A;  3MUL A;  5FE6 A;  4LZS A;  4N3W A;  1X0J A;  3MUK A;  4PCE A;  3G0J A;  3UVX A;  4A9I A;  4QY4 A;  4A9L A;  4X2I A;  2DVS A;  5ETD A;  4N4G A;  4O70 A;  3AAD A;  4HBW A;  5C8G A;  4HXM A;  5LKX A;  5I1Q A;  2WP2 A;  5I86 A;  4QB3 A;  5G4S A;  3Q2E A;  4NYV A;  2H60 A;  5ENB A;  5FFV A;  5LJ1 A;  2N9G A;  3I3J A;  4O74 A;  4QNS A;  3JVL A;  3SVF A;  3UV5 A;  4QUT A;  4UIV A;  5D3J A;  5EPR A;  4QUU A;  5I7X A;  5DYC A;  5LVR A;  4TU6 A;  4HXN A;  4LRG A;  5LJ2 A;  5IGK A;  3FKM X;  5EA1 A;  5F5Z A;  2I8N A;  5D3S A;  4TQN A;  4HXK A;  3HMF A;  5FH8 A;  3MB4 A;  4YH4 A;  2OO1 A;  4YH3 A;  4HXP A;  4IOQ A;  4TZ2 A;  4YY6 A;  5H1U A;  5II1 A;  4IOR A;  5F61 A;  4WHW A;  5LUU A;  5F1H A;  5CQT A;  4NR9 A;  2YYN A;  5EU1 A;  5DKH A;  4Q0O A;  5HEM A;  3IU6 A;  4O77 A;  2RO1 A;  5FE9 A;  5EWC A;  5HFQ A;  5C87 A;  2YEL A;  4Z6I A;  3QZT A;  4MR6 A;  4HBX A;  5D3N A;  4F3I A;  5A5P A;  4TYL A;  5COI A;  5E74 A;  1JSP B;  2YEK A;  3U5K A;  4UYE A;  4A9O A;  4CUQ A;  4A9M A;  3QZV A;  4QSV A;  5CQ7 A;  5HFR A;  3O36 A;  4Z93 A;  3HME A;  4KV1 A;  4YYN A;  4O78 A;  4O76 A;  4QEU A;  5KTX A;  5DFD A;  5L99 A;  5EI4 A;  2G4A A;  3IU5 A;  2OSS A;  5EGU A;  5FBX A;  5E3G A;  2LSP B;  3ZYU A;  4HXS A;  5FE5 A;  2FSA A;  2F6N A;  5A82 A;  3O37 A;  4NXJ A;  4PCI A;  5F25 A;  5FH6 A;  5A83 A;  5AMF A;  4A9N A;  5EWH A;  4FLP A;  4TS8 A;  3G0L A;  4LYI A;  5IGL A;  2D9E A;  5FH7 A;  4LZ2 A;  4TT6 A;  5CFW A;  5EWV A;  5LKU A;  3O33 A;  5FFW A;  1EQF A;  4OGI A;  4O7E A;  5II2 A;  4YAX A;  4MEQ A;  4NR5 A;  3UVY A;  5EK9 A;  4LYW A;  4HXO A;  4J1P A;  5A5S A;  5A7C A;  4QR5 A;  3GG3 A;  2R0V A;  4CUP A;  4J0S A;  2WP1 A;  5CS8 A;  5BT5 A;  1ZS5 A;  4UIY A;  5FG6 A;  5CQA A;  5F62 A;  4O7A A;  5HEL A;  4NR4 A;  5J0D A;  4IR3 A;  3DWY A;  4NUE A;  5FE7 A;  5FB0 A;  4IR5 A;  4XY8 A;  2RFJ A;  4WHU A;  5FFY A;  5DFB A;  4CFL A;  5EM3 A;  2D82 A;  1E6I A;  2L84 A;  4KCX A;  5CUC A;  3AQA A;  2DKW A;  4UYD A;  4MEP A;  4HBV A;  4YAT A;  4YYJ A;  5A5R A;  3UVD A;  5C85 A;  5ENC A;  2YQD A;  4PY6 A;  5HLS A;  4Z6H A;  4UIU A;  5I29 A;  4UYG A;  5TCM A;  4UYF B;  4QYD A;  4QSP A;  4PTB A;  5HRV A;  2YEM A;  4QYL A;  3P5O A;  3UV4 A;  5LKT A;  5CRZ A;  5H1V A;  5IG6 A;  4NS5 A;  4LR6 A;  2F6J A;  3QZS A;  5FE8 A;  4HXL A;  4QEW A;  4QR3 A;  5FDZ A;  5I88 A;  2RNX A;  5L8U A;  3U5O A;  5HQ7 A;  5C7N A;  4NUD A;  5HM0 A;  3ONI A;  1WUM A;  4N4I A;  4YYD A;  5CPE A;  4YC9 A;  5JWM A;  5DYU A;  4UIX A;  4J3I A;  5ENJ A;  5CY9 A;  5JI8 A;  5DYX A;  5A85 A;  5IBN A;  5DKC A;  4XUA A;  4CUS A;  4HXR A;  5DY7 A;  4MR3 A;  2I7K A;  5EVA A;  4QEV A;  5TB6 A;  4QBM A;  4BHW A;  5I83 A;  5CUA A;  2RNW A;  4Y03 A;  4IR6 A;  5E3D A;  4QC1 A;  4ALH A;  3D7C A;  5A81 A;  5L96 A;  3U5M A;  4YYH A;  5AME A;  5IGN A;  5DYA A;  4YYM A;  3LXJ A;  5I40 A;  5EQ1 A;  5KTU A;  3O35 A;  4OUF A;  4PS5 A;  2NXB A;  5A5O A;  5D3P A;  4J0R A;  4TT2 A;  4BW1 A;  5E73 A;  5ENE A;  5D26 A;  5FG5 A;  4XY9 A;  5D7X A;  5E9I A;  5HEN A;  2RI7 A;  5DW2 A;  4HBY A;  5DW1 A;  1F68 A;  3K2J A;  3MXF A;  5EIS A;  5FB1 A;  4A9H A;  5KHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...